F313049

General Info

Members Datasets Scaffolds Average Seq Length
204 164 201 351

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0318139|Ga0501034_0318139_60_1187
Length 375
Sequence MRLEILKRPEPSRLMIVGAPLLAILLTLITGAIIFIALGKDPLYGLYVFYVEPLTALWTLEELAVKAVPLVLIALGLSLCYRANAWNIGAEGQFTLGAITGAIIPVYFPEWNSWLVLPLMLLLGAAGGMLWASIPAYLRVKFGASEILTSLMLVYVAQHFLDWLLRGPFRNPNGFNYGETRIFQEAARVPILIPDTRVRIGLLIALVAVPLIWFLLRRTFAGFAVDVVGEAPRAARFGGFSRNRVILGTFMASGALAGLAGILEAAGPLGQLKPVLSPGYGFTAIIVAFVGRLNPVAIVFAGVLVALSYLGGEAAQISLRLSEKMARVFQGVLLFYVLACNTLVHNRIRLVRSPRSAPVAGGEVTAPAEVSHGNS

Samples

Sample ID Description Type Environment
1 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
2 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
3 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
70 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
71 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
72 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
79 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
80 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
81 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
82 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
92 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
93 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
154 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
155 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
156 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
157 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
158 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
159 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
162 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
163 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 0.49
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.29
Nodule 0
Rhizoplane 1.47
Rhizosphere 80.39
Stem 0
Stem Tuber 0
Unclassified 7.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10038867 3300003203 Bacteria 1702
2 JGI25153J46596_10003564 3300003215 Bacteria 8667
3 Ga0055542_1004103 3300003762 Bacteria 3666
4 Ga0065707_10210587 3300005295 Bacteria 1267
5 Ga0070670_100038058 3300005331 Bacteria 4136
6 Ga0070666_10156264 3300005335 Bacteria 1593
7 Ga0070668_100201876 3300005347 Bacteria 1632
8 Ga0070667_100109249 3300005367 Bacteria 2397
9 Ga0070709_10000216 3300005434 Bacteria 37230
10 Ga0070714_100061890 3300005435 Bacteria 3216
11 Ga0070714_100201960 3300005435 Bacteria 1819
12 Ga0070713_100180478 3300005436 Bacteria 1897
13 Ga0070710_10000168 3300005437 Bacteria 30165
14 Ga0070711_100001315 3300005439 Bacteria 13526
15 Ga0070679_100226063 3300005530 Bacteria 1832
16 Ga0068853_100154203 3300005539 Bacteria 2069
17 Ga0068854_100041452 3300005578 Bacteria 3253
18 Ga0068852_100036521 3300005616 Bacteria 4112
19 Ga0081539_10000800 3300005985 Bacteria 61179
20 Ga0070717_10046336 3300006028 Bacteria 3557
21 Ga0070717_10113033 3300006028 Bacteria 2318
22 Ga0075365_10108149 3300006038 Bacteria 1909
23 Ga0070716_100016135 3300006173 Bacteria 3851
24 Ga0070712_100007118 3300006175 Bacteria 6979
25 Ga0075430_100143342 3300006846 Bacteria 1990
26 Ga0075431_100013187 3300006847 Bacteria 8349
27 Ga0075429_100082203 3300006880 Bacteria 2808
28 Ga0105240_10001168 3300009093 Bacteria 46052
29 Ga0105240_10307692 3300009093 Bacteria 1811
30 Ga0105240_10634323 3300009093 Bacteria 1173
31 Ga0111539_10000169 3300009094 Bacteria 75594
32 Ga0105245_10191151 3300009098 Bacteria 1961
33 Ga0114129_10025442 3300009147 Bacteria 8388
34 Ga0114129_10082332 3300009147 Bacteria 4472
35 Ga0105237_10020701 3300009545 Bacteria 6774
36 Ga0105237_10240085 3300009545 Bacteria 1813
37 Ga0105238_10143403 3300009551 Bacteria 2365
38 Ga0105246_10360995 3300011119 Bacteria 1194
39 Ga0157375_10068876 3300013308 Bacteria 3542
40 Ga0163163_10323386 3300014325 Bacteria 1596
41 Ga0157379_10364760 3300014968 Bacteria 1324
42 Ga0213876_10032201 3300021384 Bacteria 2765
43 Ga0213875_10003773 3300021388 Bacteria 8532
44 Ga0209563_107014 3300025230 Bacteria 1882
45 Ga0209148_1001162 3300025254 Bacteria 15314
46 Ga0209148_1001630 3300025254 Bacteria 10309
47 Ga0209455_1000877 3300025272 Bacteria 15903
48 Ga0209455_1016587 3300025272 Bacteria 1578
49 Ga0209758_1007964 3300025297 Bacteria 7020
50 Ga0207692_10018077 3300025898 Bacteria 3157
51 Ga0207699_10000420 3300025906 Bacteria 21716
52 Ga0207645_10064101 3300025907 Bacteria 2348
53 Ga0207695_10000240 3300025913 Bacteria 143196
54 Ga0207671_10029302 3300025914 Bacteria 4109
55 Ga0207671_10169682 3300025914 Bacteria 1694
56 Ga0207693_10033897 3300025915 Bacteria 4028
57 Ga0207693_10066897 3300025915 Bacteria 2813
58 Ga0207663_10009399 3300025916 Bacteria 5160
59 Ga0207649_10095293 3300025920 Bacteria 1958
60 Ga0207694_10078976 3300025924 Bacteria 2580
61 Ga0207650_10015434 3300025925 Bacteria 5319
62 Ga0207659_10077838 3300025926 Bacteria 2442
63 Ga0207664_10051549 3300025929 Bacteria 3250
64 Ga0207690_10084337 3300025932 Bacteria 2227
65 Ga0207689_10177993 3300025942 Bacteria 1754
66 Ga0207667_10177043 3300025949 Bacteria 2191
67 Ga0207668_10190708 3300025972 Bacteria 1624
68 Ga0207640_10033355 3300025981 Bacteria 3203
69 Ga0207658_10071627 3300025986 Bacteria 2625
70 Ga0207428_10000072 3300027907 Bacteria 143629
71 Ga0268266_10080782 3300028379 Bacteria 2833
72 Ga0265318_10036135 3300028577 Bacteria 1897
73 Ga0265325_10005822 3300031241 Bacteria 7552
74 Ga0265339_10006119 3300031249 Bacteria 7939
75 Ga0265339_10075742 3300031249 Bacteria 1786
76 Ga0307513_10224224 3300031456 Bacteria 1698
77 Ga0265313_10000856 3300031595 Bacteria 30671
78 Ga0307508_10000001 3300031616 Bacteria 553635
79 Ga0307508_10027494 3300031616 Bacteria 5147
80 Ga0316575_10064878 3300031665 Bacteria 1462
81 Ga0316579_10020815 3300031691 Bacteria 2915
82 Ga0265314_10004213 3300031711 Bacteria 13485
83 Ga0265342_10041759 3300031712 Bacteria 2774
84 Ga0316576_10002005 3300031727 Bacteria 11400
85 Ga0316576_10005618 3300031727 Bacteria 7698
86 Ga0316576_10010390 3300031727 Bacteria 6046
87 Ga0316576_10021334 3300031727 Bacteria 4478
88 Ga0316576_10066972 3300031727 Bacteria 2643
89 Ga0316576_10110756 3300031727 Bacteria 2058
90 Ga0316578_10001361 3300031728 Bacteria 9848
91 Ga0316578_10028424 3300031728 Bacteria 3166
92 Ga0316578_10046452 3300031728 Bacteria 2531
93 Ga0307413_10073505 3300031824 Bacteria 2161
94 Ga0316583_10002654 3300032133 Bacteria 6250
95 Ga0316583_10004658 3300032133 Bacteria 4894
96 Ga0316585_10063762 3300032137 Bacteria 1192
97 Ga0316580_10044774 3300032139 Bacteria 1365
98 Ga0307510_10169334 3300033180 Bacteria 1766
99 Ga0316596_1007593 3300033541 Bacteria 2568
100 Ga0316574_0003675 3300035398 Bacteria 7944
101 Ga0316574_0013473 3300035398 Bacteria 4704
102 Ga0373935_0044393 3300035692 Bacteria 2801
103 Ga0373927_0040149 3300035695 Bacteria 3037
104 Ga0373927_0051096 3300035695 Bacteria 2673
105 Ga0373947_0214222 3300035725 Bacteria 1264
106 Ga0373947_0237270 3300035725 Bacteria 1202
107 Ga0316582_0013088 3300036647 Bacteria 4657
108 Ga0316582_0013808 3300036647 Bacteria 4560
109 Ga0316582_0102453 3300036647 Bacteria 1897
110 Ga0316584_0036243 3300036712 Bacteria 3659
111 Ga0316584_0083953 3300036712 Bacteria 2385
112 Ga0316584_0099168 3300036712 Bacteria 2181
113 Ga0373925_0034598 3300037068 Bacteria 3725
114 Ga0436364_0358106 3300037853 Bacteria 8532
115 Ga0436364_1242379 3300037853 Bacteria 1927
116 Ga0400484_16310 3300038725 Bacteria 2074
117 Ga0400488_51496 3300038741 Bacteria 9365
118 Ga0400483_100029 3300039062 Bacteria 1500
119 Ga0436365_0751411 3300039437 Bacteria 3679
120 Ga0436361_0846280 3300039447 Bacteria 2052
121 Ga0436362_0843745 3300039453 Bacteria 3762
122 Ga0453683_0244986 3300044673 Bacteria 1142
123 Ga0466966_0066631 3300044684 Bacteria 2263
124 Ga0466961_0000016 3300044693 Bacteria 111421
125 Ga0466964_0056134 3300044706 Bacteria 1628
126 Ga0453684_0002952 3300044712 Bacteria 39890
127 Ga0453684_0056053 3300044712 Bacteria 5117
128 Ga0453684_0134594 3300044712 Bacteria 2961
129 Ga0466959_0019307 3300045049 Bacteria 5013
130 Ga0466959_0039052 3300045049 Bacteria 3508
131 Ga0451576_0013057 3300045051 Bacteria 9303
132 Ga0495629_0105045 3300046459 Bacteria 1970
133 Ga0495651_0014203 3300046462 Bacteria 6155
134 Ga0495651_0046834 3300046462 Bacteria 3346
135 Ga0495653_0159152 3300046463 Bacteria 1569
136 Ga0495594_0106410 3300046499 Bacteria 1580
137 Ga0495608_0140543 3300046511 Bacteria 1541
138 Ga0495648_0000404 3300046524 Bacteria 47523
139 Ga0495648_0014314 3300046524 Bacteria 5815
140 Ga0495652_0002975 3300046529 Bacteria 17033
141 Ga0495587_0139110 3300046536 Bacteria 1386
142 Ga0495645_0025578 3300046543 Bacteria 4285
143 Ga0495667_0002283 3300046559 Bacteria 12848
144 Ga0495668_0133158 3300046616 Bacteria 1361
145 Ga0495635_0058572 3300046663 Bacteria 2650
146 Ga0495657_0003154 3300046675 Bacteria 13586
147 Ga0495657_0122211 3300046675 Bacteria 1639
148 Ga0495599_0183878 3300046678 Bacteria 1287
149 Ga0495623_0004304 3300046679 Bacteria 9369
150 Ga0495646_0020711 3300046680 Bacteria 4160
151 Ga0495658_0049497 3300046683 Bacteria 2374
152 Ga0495649_0030593 3300046694 Bacteria 2973
153 Ga0495604_0001723 3300047317 Bacteria 17944
154 Ga0495674_0017696 3300047319 Bacteria 6635
155 Ga0495680_0003603 3300047322 Bacteria 15156
156 Ga0495680_0126452 3300047322 Bacteria 1882
157 Ga0495675_0082506 3300047444 Bacteria 2024
158 Ga0495684_0090641 3300047471 Bacteria 2316
159 Ga0495602_0030354 3300048088 Bacteria 5128
160 Ga0495602_0089580 3300048088 Bacteria 2558
161 Ga0496104_0439951 3300048907 Bacteria 1216
162 Ga0496107_0098400 3300048910 Bacteria 2143
163 Ga0496112_0014385 3300048915 Bacteria 7338
164 Ga0496121_0073105 3300048924 Bacteria 2749
165 Ga0496126_0221185 3300048929 Bacteria 1590
166 Ga0501034_0318139 3300049571 Bacteria 1489
167 Ga0501038_0028156 3300049574 Bacteria 4992
168 Ga0501043_0116129 3300049579 Bacteria 2100
169 Ga0501068_0051271 3300049584 Bacteria 2496
170 Ga0501070_0004357 3300049586 Bacteria 12167
171 Ga0501071_0029007 3300049587 Bacteria 3903
172 Ga0501072_0049062 3300049588 Bacteria 3323
173 Ga0501073_0055986 3300049589 Bacteria 2759
174 Ga0501074_0009818 3300049590 Bacteria 6952
175 Ga0501076_0226582 3300049592 Bacteria 1528
176 Ga0501080_0099456 3300049742 Bacteria 2699
177 Ga0501083_0155653 3300049744 Bacteria 1496
178 Ga0501035_0028285 3300049822 Bacteria 5118
179 Ga0501044_0197771 3300049823 Bacteria 1969
180 Ga0501045_0150408 3300049824 Bacteria 1732
181 nmdc:mga0yw44_10113_c1 3300050492 Bacteria 4804
182 nmdc:mga05p37_245757_c1 3300050507 Bacteria 2148
183 nmdc:mga05p37_247114_c1 3300050507 Bacteria 2141
184 nmdc:mga06r32_402946_c1 3300050510 Bacteria 1350
185 nmdc:mga06r32_9966_c1 3300050510 Bacteria 8573
186 nmdc:mga08y16_38_c1 3300050511 Bacteria 135093
187 nmdc:mga0rr50_217560_c1 3300050513 Bacteria 1576
188 nmdc:mga0rr50_51442_c1 3300050513 Bacteria 3056
189 Ga0500643_005439 3300053087 Bacteria 5486
190 Ga0500644_0016685 3300053088 Bacteria 2117
191 Ga0500651_0098005 3300053093 Bacteria 1800
192 Ga0500566_0043682 3300053094 Bacteria 2582
193 Ga0500554_000346 3300053102 Bacteria 9962
194 Ga0500595_000010 3300053119 Bacteria 275806
195 Ga0500603_000250 3300053150 Bacteria 14160
196 Ga0500616_0000001 3300053153 Bacteria 1986011
197 Ga0500636_0052728 3300053177 Bacteria 2388
198 Ga0500637_0004067 3300053178 Bacteria 6878
199 Ga0500645_000763 3300053730 Bacteria 19642
200 Ga0501082_0000012 3300060353 Bacteria 119898
201 Ga0501082_0529655 3300060353 Bacteria 1030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0529655 Ga0501082_0529655_17_943 297
2 3300038725 Ga0400484_16310 Ga0400484_16310_1061_2041 318
3 3300038741 Ga0400488_51496 Ga0400488_51496_6517_7497 318
4 3300039062 Ga0400483_100029 Ga0400483_100029_334_1314 318
5 3300044673 Ga0453683_0244986 Ga0453683_0244986_85_1101 320
6 3300035725 Ga0373947_0237270 Ga0373947_0237270_10_1131 323
7 3300046459 Ga0495629_0105045 Ga0495629_0105045_167_1258 323
8 3300046463 Ga0495653_0159152 Ga0495653_0159152_301_1392 323
9 3300046511 Ga0495608_0140543 Ga0495608_0140543_273_1364 323
10 3300046675 Ga0495657_0122211 Ga0495657_0122211_152_1243 323
11 3300046678 Ga0495599_0183878 Ga0495599_0183878_41_1132 323
12 3300047322 Ga0495680_0126452 Ga0495680_0126452_174_1265 323
13 3300028379 Ga0268266_10080782 Ga0268266_100807822 325
14 3300044712 Ga0453684_0002952 Ga0453684_0002952_32863_33864 325
15 3300005331 Ga0070670_100038058 Ga0070670_1000380582 327
16 3300005335 Ga0070666_10156264 Ga0070666_101562642 327
17 3300005367 Ga0070667_100109249 Ga0070667_1001092492 327
18 3300005435 Ga0070714_100061890 Ga0070714_1000618903 327
19 3300006028 Ga0070717_10113033 Ga0070717_101130332 327
20 3300009545 Ga0105237_10240085 Ga0105237_102400851 327
21 3300011119 Ga0105246_10360995 Ga0105246_103609951 327
22 3300014325 Ga0163163_10323386 Ga0163163_103233862 327
23 3300014968 Ga0157379_10364760 Ga0157379_103647602 327
24 3300025907 Ga0207645_10064101 Ga0207645_100641013 327
25 3300025915 Ga0207693_10066897 Ga0207693_100668972 327
26 3300025920 Ga0207649_10095293 Ga0207649_100952932 327
27 3300025925 Ga0207650_10015434 Ga0207650_100154343 327
28 3300025926 Ga0207659_10077838 Ga0207659_100778382 327
29 3300025929 Ga0207664_10051549 Ga0207664_100515493 327
30 3300025986 Ga0207658_10071627 Ga0207658_100716272 327
31 3300048910 Ga0496107_0098400 Ga0496107_0098400_563_1654 327
32 3300048915 Ga0496112_0014385 Ga0496112_0014385_5369_6460 327
33 3300050513 nmdc:mga0rr50_217560_c1 nmdc:mga0rr50_217560_c1_107_1198 327
34 3300046683 Ga0495658_0049497 Ga0495658_0049497_985_2076 328
35 3300031241 Ga0265325_10005822 Ga0265325_100058226 330
36 3300031249 Ga0265339_10006119 Ga0265339_100061196 330
37 3300031595 Ga0265313_10000856 Ga0265313_1000085613 330
38 3300049584 Ga0501068_0051271 Ga0501068_0051271_848_1930 333
39 3300005295 Ga0065707_10210587 Ga0065707_102105872 334
40 3300050513 nmdc:mga0rr50_51442_c1 nmdc:mga0rr50_51442_c1_1277_2368 334
41 3300049587 Ga0501071_0029007 Ga0501071_0029007_1919_3010 336
42 3300049590 Ga0501074_0009818 Ga0501074_0009818_3950_5041 336
43 3300009093 Ga0105240_10634323 Ga0105240_106343232 337
44 3300006846 Ga0075430_100143342 Ga0075430_1001433422 338
45 3300006847 Ga0075431_100013187 Ga0075431_1000131873 338
46 3300006880 Ga0075429_100082203 Ga0075429_1000822032 338
47 3300009093 Ga0105240_10307692 Ga0105240_103076922 338
48 3300009147 Ga0114129_10025442 Ga0114129_100254426 338
49 3300025914 Ga0207671_10169682 Ga0207671_101696822 338
50 3300046499 Ga0495594_0106410 Ga0495594_0106410_158_1249 338
51 3300050510 nmdc:mga06r32_9966_c1 nmdc:mga06r32_9966_c1_6107_7189 338
52 3300032133 Ga0316583_10002654 Ga0316583_100026544 339
53 3300036647 Ga0316582_0013808 Ga0316582_0013808_1796_2860 339
54 3300049589 Ga0501073_0055986 Ga0501073_0055986_569_1618 339
55 iso_pu_bacteria 2523533628 2524001062 340
56 3300005539 Ga0068853_100154203 Ga0068853_1001542032 342
57 iso_pu_bacteria 2980125574 2980126665 342
58 3300031711 Ga0265314_10004213 Ga0265314_100042133 343
59 3300045051 Ga0451576_0013057 Ga0451576_0013057_155_1237 343
60 3300044712 Ga0453684_0056053 Ga0453684_0056053_3701_4765 344
61 3300049744 Ga0501083_0155653 Ga0501083_0155653_84_1172 344
62 3300060353 Ga0501082_0000012 Ga0501082_0000012_99051_100145 344
63 3300031691 Ga0316579_10020815 Ga0316579_100208153 345
64 3300031727 Ga0316576_10002005 Ga0316576_100020058 345
65 3300031727 Ga0316576_10010390 Ga0316576_100103903 345
66 3300031727 Ga0316576_10021334 Ga0316576_100213344 345
67 3300031727 Ga0316576_10110756 Ga0316576_101107562 345
68 3300031728 Ga0316578_10001361 Ga0316578_100013614 345
69 3300031728 Ga0316578_10028424 Ga0316578_100284242 345
70 3300032137 Ga0316585_10063762 Ga0316585_100637621 345
71 3300032139 Ga0316580_10044774 Ga0316580_100447742 345
72 3300033541 Ga0316596_1007593 Ga0316596_10075932 345
73 3300035398 Ga0316574_0013473 Ga0316574_0013473_167_1231 345
74 3300036647 Ga0316582_0013088 Ga0316582_0013088_276_1340 345
75 3300036647 Ga0316582_0102453 Ga0316582_0102453_793_1857 345
76 3300036712 Ga0316584_0036243 Ga0316584_0036243_1391_2455 345
77 3300036712 Ga0316584_0083953 Ga0316584_0083953_554_1618 345
78 3300036712 Ga0316584_0099168 Ga0316584_0099168_120_1184 345
79 3300039447 Ga0436361_0846280 Ga0436361_0846280_215_1279 346
80 3300047471 Ga0495684_0090641 Ga0495684_0090641_54_1145 346
81 iso_pu_bacteria 2864997549 2864999223 346
82 3300009147 Ga0114129_10082332 Ga0114129_100823323 347
83 3300031824 Ga0307413_10073505 Ga0307413_100735052 347
84 3300050507 nmdc:mga05p37_245757_c1 nmdc:mga05p37_245757_c1_936_2003 347
85 3300050507 nmdc:mga05p37_247114_c1 nmdc:mga05p37_247114_c1_859_1926 347
86 3300050510 nmdc:mga06r32_402946_c1 nmdc:mga06r32_402946_c1_236_1303 347
87 3300031727 Ga0316576_10005618 Ga0316576_100056184 348
88 3300031727 Ga0316576_10066972 Ga0316576_100669722 348
89 3300031728 Ga0316578_10046452 Ga0316578_100464523 348
90 3300035398 Ga0316574_0003675 Ga0316574_0003675_4325_5398 348
91 3300005347 Ga0070668_100201876 Ga0070668_1002018762 350
92 3300009094 Ga0111539_10000169 Ga0111539_1000016937 350
93 3300025942 Ga0207689_10177993 Ga0207689_101779932 350
94 3300025972 Ga0207668_10190708 Ga0207668_101907082 350
95 3300027907 Ga0207428_10000072 Ga0207428_1000007210 350
96 3300046616 Ga0495668_0133158 Ga0495668_0133158_150_1238 350
97 3300049588 Ga0501072_0049062 Ga0501072_0049062_1438_2532 350
98 3300049592 Ga0501076_0226582 Ga0501076_0226582_27_1112 350
99 3300049824 Ga0501045_0150408 Ga0501045_0150408_502_1587 350
100 3300050511 nmdc:mga08y16_38_c1 nmdc:mga08y16_38_c1_133150_134229 350
101 3300021388 Ga0213875_10003773 Ga0213875_100037735 351
102 3300028577 Ga0265318_10036135 Ga0265318_100361352 351
103 3300031249 Ga0265339_10075742 Ga0265339_100757421 351
104 3300031456 Ga0307513_10224224 Ga0307513_102242241 351
105 3300031712 Ga0265342_10041759 Ga0265342_100417593 351
106 3300037853 Ga0436364_0358106 Ga0436364_0358106_3216_4301 351
107 3300035695 Ga0373927_0051096 Ga0373927_0051096_341_1432 352
108 3300037068 Ga0373925_0034598 Ga0373925_0034598_1309_2400 352
109 3300037853 Ga0436364_1242379 Ga0436364_1242379_546_1634 352
110 3300053093 Ga0500651_0098005 Ga0500651_0098005_244_1335 352
111 3300006038 Ga0075365_10108149 Ga0075365_101081491 353
112 3300025254 Ga0209148_1001630 Ga0209148_10016303 353
113 3300025932 Ga0207690_10084337 Ga0207690_100843372 353
114 3300025949 Ga0207667_10177043 Ga0207667_101770432 353
115 3300044706 Ga0466964_0056134 Ga0466964_0056134_185_1273 353
116 3300044712 Ga0453684_0134594 Ga0453684_0134594_893_2008 353
117 3300049571 Ga0501034_0318139 Ga0501034_0318139_60_1187 353
118 3300053087 Ga0500643_005439 Ga0500643_005439_283_1374 353
119 3300053088 Ga0500644_0016685 Ga0500644_0016685_581_1672 353
120 3300053094 Ga0500566_0043682 Ga0500566_0043682_190_1281 353
121 3300053119 Ga0500595_000010 Ga0500595_000010_267717_268808 353
122 3300053153 Ga0500616_0000001 Ga0500616_0000001_558080_559171 353
123 3300053730 Ga0500645_000763 Ga0500645_000763_4261_5352 353
124 3300003203 JGI25406J46586_10038867 JGI25406J46586_100388672 354
125 3300003215 JGI25153J46596_10003564 JGI25153J46596_100035644 354
126 3300003762 Ga0055542_1004103 Ga0055542_10041034 354
127 3300005434 Ga0070709_10000216 Ga0070709_1000021622 354
128 3300005435 Ga0070714_100201960 Ga0070714_1002019602 354
129 3300005436 Ga0070713_100180478 Ga0070713_1001804782 354
130 3300005437 Ga0070710_10000168 Ga0070710_1000016810 354
131 3300005439 Ga0070711_100001315 Ga0070711_1000013158 354
132 3300005530 Ga0070679_100226063 Ga0070679_1002260632 354
133 3300005578 Ga0068854_100041452 Ga0068854_1000414522 354
134 3300005616 Ga0068852_100036521 Ga0068852_1000365212 354
135 3300005985 Ga0081539_10000800 Ga0081539_1000080010 354
136 3300006028 Ga0070717_10046336 Ga0070717_100463362 354
137 3300006173 Ga0070716_100016135 Ga0070716_1000161352 354
138 3300006175 Ga0070712_100007118 Ga0070712_1000071186 354
139 3300009093 Ga0105240_10001168 Ga0105240_1000116820 354
140 3300009098 Ga0105245_10191151 Ga0105245_101911512 354
141 3300009545 Ga0105237_10020701 Ga0105237_100207015 354
142 3300009551 Ga0105238_10143403 Ga0105238_101434032 354
143 3300013308 Ga0157375_10068876 Ga0157375_100688762 354
144 3300021384 Ga0213876_10032201 Ga0213876_100322012 354
145 3300025230 Ga0209563_107014 Ga0209563_1070142 354
146 3300025254 Ga0209148_1001162 Ga0209148_10011623 354
147 3300025272 Ga0209455_1000877 Ga0209455_10008772 354
148 3300025272 Ga0209455_1016587 Ga0209455_10165872 354
149 3300025297 Ga0209758_1007964 Ga0209758_10079643 354
150 3300025898 Ga0207692_10018077 Ga0207692_100180772 354
151 3300025906 Ga0207699_10000420 Ga0207699_100004206 354
152 3300025913 Ga0207695_10000240 Ga0207695_1000024070 354
153 3300025914 Ga0207671_10029302 Ga0207671_100293024 354
154 3300025915 Ga0207693_10033897 Ga0207693_100338974 354
155 3300025916 Ga0207663_10009399 Ga0207663_100093994 354
156 3300025924 Ga0207694_10078976 Ga0207694_100789762 354
157 3300025981 Ga0207640_10033355 Ga0207640_100333553 354
158 3300031616 Ga0307508_10000001 Ga0307508_10000001264 354
159 3300031616 Ga0307508_10027494 Ga0307508_100274943 354
160 3300031665 Ga0316575_10064878 Ga0316575_100648782 354
161 3300032133 Ga0316583_10004658 Ga0316583_100046582 354
162 3300033180 Ga0307510_10169334 Ga0307510_101693342 354
163 3300035692 Ga0373935_0044393 Ga0373935_0044393_407_1498 354
164 3300035695 Ga0373927_0040149 Ga0373927_0040149_337_1443 354
165 3300035725 Ga0373947_0214222 Ga0373947_0214222_89_1195 354
166 3300039437 Ga0436365_0751411 Ga0436365_0751411_929_2020 354
167 3300039453 Ga0436362_0843745 Ga0436362_0843745_2401_3492 354
168 3300044684 Ga0466966_0066631 Ga0466966_0066631_374_1465 354
169 3300044693 Ga0466961_0000016 Ga0466961_0000016_41054_42145 354
170 3300045049 Ga0466959_0019307 Ga0466959_0019307_3272_4363 354
171 3300045049 Ga0466959_0039052 Ga0466959_0039052_1969_3060 354
172 3300046462 Ga0495651_0014203 Ga0495651_0014203_3143_4234 354
173 3300046462 Ga0495651_0046834 Ga0495651_0046834_241_1332 354
174 3300046524 Ga0495648_0000404 Ga0495648_0000404_2322_3413 354
175 3300046524 Ga0495648_0014314 Ga0495648_0014314_1146_2237 354
176 3300046529 Ga0495652_0002975 Ga0495652_0002975_13788_14879 354
177 3300046536 Ga0495587_0139110 Ga0495587_0139110_107_1198 354
178 3300046543 Ga0495645_0025578 Ga0495645_0025578_816_1907 354
179 3300046559 Ga0495667_0002283 Ga0495667_0002283_6104_7195 354
180 3300046663 Ga0495635_0058572 Ga0495635_0058572_284_1375 354
181 3300046675 Ga0495657_0003154 Ga0495657_0003154_5680_6771 354
182 3300046679 Ga0495623_0004304 Ga0495623_0004304_2797_3888 354
183 3300046680 Ga0495646_0020711 Ga0495646_0020711_1371_2462 354
184 3300046694 Ga0495649_0030593 Ga0495649_0030593_76_1167 354
185 3300047317 Ga0495604_0001723 Ga0495604_0001723_5964_7055 354
186 3300047319 Ga0495674_0017696 Ga0495674_0017696_353_1444 354
187 3300047322 Ga0495680_0003603 Ga0495680_0003603_10760_11851 354
188 3300047444 Ga0495675_0082506 Ga0495675_0082506_15_1106 354
189 3300048088 Ga0495602_0030354 Ga0495602_0030354_3320_4411 354
190 3300048088 Ga0495602_0089580 Ga0495602_0089580_190_1281 354
191 3300048907 Ga0496104_0439951 Ga0496104_0439951_13_1104 354
192 3300048924 Ga0496121_0073105 Ga0496121_0073105_790_1881 354
193 3300048929 Ga0496126_0221185 Ga0496126_0221185_307_1398 354
194 3300049574 Ga0501038_0028156 Ga0501038_0028156_1557_2648 354
195 3300049579 Ga0501043_0116129 Ga0501043_0116129_206_1297 354
196 3300049586 Ga0501070_0004357 Ga0501070_0004357_5892_6983 354
197 3300049742 Ga0501080_0099456 Ga0501080_0099456_1572_2663 354
198 3300049822 Ga0501035_0028285 Ga0501035_0028285_1352_2443 354
199 3300049823 Ga0501044_0197771 Ga0501044_0197771_790_1881 354
200 3300050492 nmdc:mga0yw44_10113_c1 nmdc:mga0yw44_10113_c1_2088_3179 354
201 3300053102 Ga0500554_000346 Ga0500554_000346_148_1239 354
202 3300053150 Ga0500603_000250 Ga0500603_000250_239_1330 354
203 3300053177 Ga0500636_0052728 Ga0500636_0052728_310_1401 354
204 3300053178 Ga0500637_0004067 Ga0500637_0004067_955_2046 354

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

59

338

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5347 20 332
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5184 20 332
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.5175 16 332
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.5123 47 321
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4991 56 337
ID Description Score Start End Superfamily
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8253 61 330 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8139 61 330 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7701 60 330 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7669 60 330 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.763 60 330 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A519G8P5-F1-model_v4 deleted 0.9706 2 344
AF-A0A257P6S9-F1-model_v4 Sugar ABC transporter permease 0.9699 23 337 GO:0005886
GO:0022857
AF-A0A3B8RM30-F1-model_v4 Sugar ABC transporter permease 0.9585 2 354 GO:0005886
GO:0022857
AF-A0A3B8RM30-F1-model_v4 Sugar ABC transporter permease 0.9532 2 354 GO:0005886
GO:0022857
AF-A0A531KCQ0-F1-model_v4 ABC transporter permease 0.9531 69 208 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
90.11 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map