F311998

General Info

Members Datasets Scaffolds Average Seq Length
204 167 408 434

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10012166|JGI25406J46586_100121664
Length 469
Sequence VWSTSYPMLRDHSQRGPTFPPRRVACYTHTVVVDAQVVPLVEPDAEGVDPQRRRELQQHRLSQLVDRLLAAGGLQAGRLRDVGVRSGADVPLDDLSRLPTVTKRDLWDHYPDGLRAVPVDDVVCVHGSSGTGGQPTLVPYTASDVDVWAQVMARALGGAGATRRSLVHNAYGYGLFTGGLGVHHGAMRLGATVLPLSGGMTERQVRMITDLKPDILTCTPSYAIFLGEALGAPPPSLRAGLFGAEPWTNEMRAQIEQLLGLRALDIYGLSEIIGPGVAAESLDSGSMLNVAEDHFFVEAIDAEGRAVPDGTPGELVFTTLTKTGMPLLRYRTGDVAALAGPVPGAPRTLRRMSKLLGRTDDMLVVRGVNVFPTEIEAVLLADDRVSPHYLVVDDRRDAARPELLVAVEPVTAAAADLAADLGVALRERLGITCVVRVVGAGSVPRTEVGKAKRYVRWTDGPAPVEGLAG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
53 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
63 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
69 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
72 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
83 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
86 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
87 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
91 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
114 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
120 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
121 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
122 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
123 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
124 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
125 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
126 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
127 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
128 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
129 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
130 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
131 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
132 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
133 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
134 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
135 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
136 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
137 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
138 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
139 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
140 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
141 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
142 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
143 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
144 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
145 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
146 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
147 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
148 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
149 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
150 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
151 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
152 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
153 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
154 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
155 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
156 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
157 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
158 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
159 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
160 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
161 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
162 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
163 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
164 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
165 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
166 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
167 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.47
Metatranscriptomes 0
Isolates 23.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.98
Bulb 0
Endosphere 0.98
Nodule 0.49
Rhizoplane 0.49
Rhizosphere 81.37
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10012166 3300003203 Bacteria 3744
2 JGI24741J21665_1000992 3300001915 Bacteria 8533
3 JGI25406J46586_10019475 3300003203 Bacteria 2765
4 rootL2_10061874 3300003322 Bacteria 2851
5 rootH1_10226724 3300003323 Bacteria 4845
6 Ga0055534_1007411 3300003784 Bacteria 2616
7 Ga0065714_10064884 3300005288 Bacteria 16082
8 Ga0070682_100000064 3300005337 Bacteria 100988
9 Ga0070668_100035073 3300005347 Bacteria 3824
10 Ga0070709_10013826 3300005434 Bacteria 4549
11 Ga0070714_100170915 3300005435 Bacteria 1972
12 Ga0070708_100001788 3300005445 Bacteria 16502
13 Ga0070708_100030853 3300005445 Bacteria 4636
14 Ga0070708_100115236 3300005445 Bacteria 2474
15 Ga0070708_100127151 3300005445 Bacteria 2357
16 Ga0070708_100178823 3300005445 Bacteria 1982
17 Ga0070706_100077913 3300005467 Bacteria 3068
18 Ga0070706_100096660 3300005467 Bacteria 2742
19 Ga0070707_100180382 3300005468 Bacteria 2058
20 Ga0070698_100037604 3300005471 Bacteria 4990
21 Ga0070698_100065505 3300005471 Bacteria 3658
22 Ga0070699_100008582 3300005518 Bacteria 8856
23 Ga0070699_100040084 3300005518 Bacteria 4056
24 Ga0070684_100020583 3300005535 Bacteria 5472
25 Ga0070697_100052277 3300005536 Bacteria 3319
26 Ga0070696_100030337 3300005546 Bacteria 3701
27 Ga0068854_100140187 3300005578 Bacteria 1855
28 Ga0068866_10073384 3300005718 Bacteria 1815
29 Ga0081538_10017894 3300005981 Bacteria 5353
30 Ga0081539_10000845 3300005985 Bacteria 58627
31 Ga0075428_100002904 3300006844 Bacteria 18646
32 Ga0075428_100035158 3300006844 Bacteria 5524
33 Ga0075428_100099452 3300006844 Bacteria 3171
34 Ga0075430_100027237 3300006846 Bacteria 4859
35 Ga0075431_100001857 3300006847 Bacteria 20009
36 Ga0075431_100014807 3300006847 Bacteria 7896
37 Ga0075429_100036633 3300006880 Bacteria 4268
38 Ga0075429_100084041 3300006880 Bacteria 2774
39 Ga0099794_10026794 3300007265 Bacteria 2668
40 Ga0105244_10000068 3300009036 Bacteria 121140
41 Ga0105250_10003868 3300009092 Bacteria 7019
42 Ga0105245_10151796 3300009098 Bacteria 2191
43 Ga0114129_10000146 3300009147 Bacteria 74508
44 Ga0114129_10073170 3300009147 Bacteria 4775
45 Ga0114129_10081774 3300009147 Bacteria 4490
46 Ga0114129_10148952 3300009147 Bacteria 3203
47 Ga0114129_10192957 3300009147 Bacteria 2764
48 Ga0105243_10000160 3300009148 Bacteria 76215
49 Ga0157373_10000758 3300013100 Bacteria 25038
50 Ga0157370_10001365 3300013104 Bacteria 30203
51 Ga0157375_10000598 3300013308 Bacteria 32026
52 Ga0163163_10091171 3300014325 Bacteria 3062
53 Ga0182008_10000062 3300014497 Bacteria 90671
54 Ga0182006_1000001 3300015261 Bacteria 1091090
55 Ga0163161_10013249 3300017792 Bacteria 5732
56 Ga0209675_1000146 3300025291 Bacteria 93829
57 Ga0207696_1004897 3300025711 Bacteria 5673
58 Ga0207655_1000164 3300025728 Bacteria 121490
59 Ga0207642_10064408 3300025899 Bacteria 1718
60 Ga0207699_10002760 3300025906 Bacteria 8300
61 Ga0207684_10077176 3300025910 Bacteria 2832
62 Ga0207654_10033724 3300025911 Bacteria 2840
63 Ga0207663_10040368 3300025916 Bacteria 2836
64 Ga0207646_10010400 3300025922 Bacteria 9099
65 Ga0207664_10006339 3300025929 Bacteria 8129
66 Ga0207706_10064524 3300025933 Bacteria 3224
67 Ga0207709_10000212 3300025935 Bacteria 75306
68 Ga0265323_10007897 3300028653 Bacteria 4400
69 Ga0265323_10012051 3300028653 Bacteria 3473
70 Ga0265322_10011915 3300028654 Unclassified 2515
71 Ga0265336_10000610 3300028666 Bacteria 19881
72 Ga0265324_10000001 3300029957 Bacteria 562975
73 Ga0265330_10004301 3300031235 Bacteria 7242
74 Ga0265325_10005003 3300031241 Bacteria 8251
75 Ga0307513_10021602 3300031456 Bacteria 7594
76 Ga0307412_10000036 3300031911 Bacteria 192270
77 Ga0307412_10002753 3300031911 Bacteria 9771
78 Ga0307412_10014528 3300031911 Bacteria 4645
79 Ga0307416_100000044 3300032002 Bacteria 127948
80 Ga0307414_10000043 3300032004 Bacteria 137764
81 Ga0307414_10059912 3300032004 Bacteria 2690
82 Ga0307507_10076090 3300033179 Bacteria 2997
83 Ga0373955_0009410 3300035172 Bacteria 4571
84 Ga0373927_0060199 3300035695 Bacteria 2457
85 Ga0373933_0022835 3300035724 Bacteria 3568
86 Ga0373947_0013587 3300035725 Bacteria 4665
87 Ga0373937_0000329 3300036401 Bacteria 45063
88 Ga0316582_0114983 3300036647 Bacteria 1795
89 Ga0400489_58653 3300039093 Bacteria 10967
90 Ga0436365_1383653 3300039437 Bacteria 1789
91 Ga0439465_0000431 3300041413 Bacteria 12295
92 Ga0439445_0000032 3300042004 Bacteria 18886
93 Ga0451577_0005982 3300042876 Bacteria 12252
94 Ga0453683_0025998 3300044673 Bacteria 3717
95 Ga0453684_0001826 3300044712 Bacteria 55887
96 Ga0453684_0073412 3300044712 Bacteria 4312
97 Ga0453684_0134191 3300044712 Bacteria 2966
98 Ga0453684_0134973 3300044712 Bacteria 2956
99 Ga0453684_0319054 3300044712 Bacteria 1760
100 Ga0451576_0001281 3300045051 Bacteria 43771
101 Ga0451576_0024223 3300045051 Bacteria 6558
102 Ga0451576_0042371 3300045051 Bacteria 4806
103 Ga0451576_0107303 3300045051 Bacteria 2905
104 Ga0466958_0060969 3300045836 Bacteria 2297
105 Ga0466967_0015075 3300045976 Bacteria 6048
106 Ga0495627_000081 3300046453 Bacteria 116262
107 Ga0495651_0078383 3300046462 Bacteria 2499
108 Ga0495580_0039822 3300046472 Bacteria 3362
109 Ga0495639_0007480 3300046475 Bacteria 4690
110 Ga0495596_0001269 3300046500 Bacteria 14622
111 Ga0495606_0006556 3300046507 Bacteria 10702
112 Ga0495606_0033905 3300046507 Bacteria 3513
113 Ga0495610_0000005 3300046512 Bacteria 924111
114 Ga0495663_0000043 3300046525 Bacteria 63128
115 Ga0495654_0000003 3300046530 Bacteria 863485
116 Ga0495586_0018102 3300046535 Bacteria 3747
117 Ga0495587_0003121 3300046536 Bacteria 11084
118 Ga0495609_0000103 3300046538 Bacteria 100012
119 Ga0495633_0000114 3300046558 Bacteria 108708
120 Ga0495633_0000890 3300046558 Bacteria 25575
121 Ga0495667_0002181 3300046559 Bacteria 13083
122 Ga0495625_0000120 3300046660 Bacteria 121527
123 Ga0495581_0013683 3300047315 Bacteria 4703
124 Ga0495675_0003206 3300047444 Bacteria 9835
125 Ga0495684_0041720 3300047471 Bacteria 3516
126 Ga0495686_0000133 3300047472 Bacteria 151597
127 Ga0496105_0084388 3300048908 Bacteria 2624
128 Ga0496116_0000191 3300048919 Bacteria 122348
129 Ga0496117_0000188 3300048920 Bacteria 126828
130 Ga0496118_0001654 3300048921 Bacteria 32740
131 Ga0496119_0000098 3300048922 Bacteria 126786
132 Ga0496122_0000307 3300048925 Bacteria 108043
133 Ga0496122_0000378 3300048925 Bacteria 95352
134 Ga0496122_0000774 3300048925 Bacteria 61588
135 Ga0496122_0002257 3300048925 Bacteria 27888
136 Ga0496122_0005989 3300048925 Bacteria 14212
137 Ga0496123_0023838 3300048926 Bacteria 4672
138 Ga0496123_0054604 3300048926 Bacteria 2628
139 Ga0496124_0001623 3300048927 Bacteria 32237
140 Ga0496125_0003526 3300048928 Bacteria 18877
141 Ga0496125_0031634 3300048928 Bacteria 4713
142 Ga0496126_0006806 3300048929 Bacteria 12680
143 Ga0501034_0018758 3300049571 Bacteria 7089
144 Ga0501036_0026117 3300049572 Bacteria 4929
145 Ga0501039_0035978 3300049575 Bacteria 3820
146 Ga0501042_0002468 3300049578 Bacteria 11357
147 Ga0501048_0029533 3300049582 Bacteria 3975
148 Ga0501241_000025 3300049758 Bacteria 60000
149 Ga0501269_000013 3300049766 Bacteria 60610
150 Ga0501044_0072623 3300049823 Bacteria 3498
151 nmdc:mga05p37_1559_c1 3300050507 Bacteria 26625
152 nmdc:mga05p37_87649_c1 3300050507 Bacteria 3836
153 nmdc:mga09592_66984_c1 3300050508 Bacteria 3045
154 nmdc:mga09592_90614_c1 3300050508 Bacteria 2612
155 nmdc:mga06r32_1576_c1 3300050510 Bacteria 20552
156 Ga0495595_0020172 3300053084 Bacteria 2899
157 2511234964 2511231000 Bacteria 4488346
158 2558914764 2558860112 Bacteria 9931328
159 2585144225 2582581278 Bacteria 5296881
160 2585157978 2582581281 Bacteria 4487904
161 2585162278 2582581282 Bacteria 4495830
162 2585425875 2582581873 Bacteria 3032664
163 2587680539 2585428045 Bacteria 5203023
164 2587748759 2585428060 Bacteria 5304711
165 2587753429 2585428061 Bacteria 3939663
166 2587868357 2585428095 Bacteria 3789702
167 2587945434 2585428115 Bacteria 4420269
168 2588212135 2585428182 Bacteria 5007281
169 2588216948 2585428183 Bacteria 5166119
170 2588217219 2585428184 Bacteria 4978681
171 2588222073 2585428185 Bacteria 4969476
172 2588234737 2585428187 Bacteria 4629388
173 2588447696 2588253712 Bacteria 5403181
174 2590604545 2588254255 Bacteria 5014294
175 2590610336 2588254257 Bacteria 5436094
176 2729200632 2728369107 Bacteria 5082720
177 2738701415 2738541273 Bacteria 4048577
178 2739255713 2738543014 Bacteria 4048139
179 2740060563 2739367874 Bacteria 4872888
180 2753671464 2751185877 Bacteria 4921427
181 2765575832 2765235839 Bacteria 5314748
182 2772607142 2772190705 Bacteria 4666226
183 2775674212 2775506739 Bacteria 3855222
184 2776369769 2775506925 Bacteria 7237746
185 2791914862 2791354901 Bacteria 8322202
186 2795797072 2795385472 Bacteria 6627535
187 2816876354 2816332188 Bacteria 5133218
188 2842086380 2842083920 Bacteria 4857652
189 2863068821 2863067949 Bacteria 8541735
190 2870783627 2870782633 Bacteria 9624083
191 2871721923 2871720351 Bacteria 4862476
192 2881955839 2881955468 Bacteria 3545609
193 2889293677 2889290771 Bacteria 5530962
194 2906001061 2905999023 Bacteria 4591259
195 2919100526 2919097161 Bacteria 3860339
196 2919403642 2919399522 Bacteria 5164947
197 2945924680 2945924605 Bacteria 4296724
198 2946024207 2946019816 Bacteria 4621265
199 2977247628 2977243572 Bacteria 4374394
200 2984574574 2984572630 Bacteria 4186940
201 2984608025 2984606641 Bacteria 4186971
202 2993374971 2993372514 Bacteria 4214139
203 2993481826 2993480792 Bacteria 4022225
204 8056215484 8056207758 Bacteria 8639239
205 JGI25406J46586_10012166
206 JGI24741J21665_1000992
207 JGI25406J46586_10019475
208 rootL2_10061874
209 rootH1_10226724
210 Ga0055534_1007411
211 Ga0065714_10064884
212 Ga0070682_100000064
213 Ga0070668_100035073
214 Ga0070709_10013826
215 Ga0070714_100170915
216 Ga0070708_100001788
217 Ga0070708_100030853
218 Ga0070708_100115236
219 Ga0070708_100127151
220 Ga0070708_100178823
221 Ga0070706_100077913
222 Ga0070706_100096660
223 Ga0070707_100180382
224 Ga0070698_100037604
225 Ga0070698_100065505
226 Ga0070699_100008582
227 Ga0070699_100040084
228 Ga0070684_100020583
229 Ga0070697_100052277
230 Ga0070696_100030337
231 Ga0068854_100140187
232 Ga0068866_10073384
233 Ga0081538_10017894
234 Ga0081539_10000845
235 Ga0075428_100002904
236 Ga0075428_100035158
237 Ga0075428_100099452
238 Ga0075430_100027237
239 Ga0075431_100001857
240 Ga0075431_100014807
241 Ga0075429_100036633
242 Ga0075429_100084041
243 Ga0099794_10026794
244 Ga0105244_10000068
245 Ga0105250_10003868
246 Ga0105245_10151796
247 Ga0114129_10000146
248 Ga0114129_10073170
249 Ga0114129_10081774
250 Ga0114129_10148952
251 Ga0114129_10192957
252 Ga0105243_10000160
253 Ga0157373_10000758
254 Ga0157370_10001365
255 Ga0157375_10000598
256 Ga0163163_10091171
257 Ga0182008_10000062
258 Ga0182006_1000001
259 Ga0163161_10013249
260 Ga0209675_1000146
261 Ga0207696_1004897
262 Ga0207655_1000164
263 Ga0207642_10064408
264 Ga0207699_10002760
265 Ga0207684_10077176
266 Ga0207654_10033724
267 Ga0207663_10040368
268 Ga0207646_10010400
269 Ga0207664_10006339
270 Ga0207706_10064524
271 Ga0207709_10000212
272 Ga0265323_10007897
273 Ga0265323_10012051
274 Ga0265322_10011915
275 Ga0265336_10000610
276 Ga0265324_10000001
277 Ga0265330_10004301
278 Ga0265325_10005003
279 Ga0307513_10021602
280 Ga0307412_10000036
281 Ga0307412_10002753
282 Ga0307412_10014528
283 Ga0307416_100000044
284 Ga0307414_10000043
285 Ga0307414_10059912
286 Ga0307507_10076090
287 Ga0373955_0009410
288 Ga0373927_0060199
289 Ga0373933_0022835
290 Ga0373947_0013587
291 Ga0373937_0000329
292 Ga0316582_0114983
293 Ga0400489_58653
294 Ga0436365_1383653
295 Ga0439465_0000431
296 Ga0439445_0000032
297 Ga0451577_0005982
298 Ga0453683_0025998
299 Ga0453684_0001826
300 Ga0453684_0073412
301 Ga0453684_0134191
302 Ga0453684_0134973
303 Ga0453684_0319054
304 Ga0451576_0001281
305 Ga0451576_0024223
306 Ga0451576_0042371
307 Ga0451576_0107303
308 Ga0466958_0060969
309 Ga0466967_0015075
310 Ga0495627_000081
311 Ga0495651_0078383
312 Ga0495580_0039822
313 Ga0495639_0007480
314 Ga0495596_0001269
315 Ga0495606_0006556
316 Ga0495606_0033905
317 Ga0495610_0000005
318 Ga0495663_0000043
319 Ga0495654_0000003
320 Ga0495586_0018102
321 Ga0495587_0003121
322 Ga0495609_0000103
323 Ga0495633_0000114
324 Ga0495633_0000890
325 Ga0495667_0002181
326 Ga0495625_0000120
327 Ga0495581_0013683
328 Ga0495675_0003206
329 Ga0495684_0041720
330 Ga0495686_0000133
331 Ga0496105_0084388
332 Ga0496116_0000191
333 Ga0496117_0000188
334 Ga0496118_0001654
335 Ga0496119_0000098
336 Ga0496122_0000307
337 Ga0496122_0000378
338 Ga0496122_0000774
339 Ga0496122_0002257
340 Ga0496122_0005989
341 Ga0496123_0023838
342 Ga0496123_0054604
343 Ga0496124_0001623
344 Ga0496125_0003526
345 Ga0496125_0031634
346 Ga0496126_0006806
347 Ga0501034_0018758
348 Ga0501036_0026117
349 Ga0501039_0035978
350 Ga0501042_0002468
351 Ga0501048_0029533
352 Ga0501241_000025
353 Ga0501269_000013
354 Ga0501044_0072623
355 nmdc:mga05p37_1559_c1
356 nmdc:mga05p37_87649_c1
357 nmdc:mga09592_66984_c1
358 nmdc:mga09592_90614_c1
359 nmdc:mga06r32_1576_c1
360 Ga0495595_0020172
361 2511234964
362 2558914764
363 2585144225
364 2585157978
365 2585162278
366 2585425875
367 2587680539
368 2587748759
369 2587753429
370 2587868357
371 2587945434
372 2588212135
373 2588216948
374 2588217219
375 2588222073
376 2588234737
377 2588447696
378 2590604545
379 2590610336
380 2729200632
381 2738701415
382 2739255713
383 2740060563
384 2753671464
385 2765575832
386 2772607142
387 2775674212
388 2776369769
389 2791914862
390 2795797072
391 2816876354
392 2842086380
393 2863068821
394 2870783627
395 2871721923
396 2881955839
397 2889293677
398 2906001061
399 2919100526
400 2919403642
401 2945924680
402 2946024207
403 2977247628
404 2984574574
405 2984608025
406 2993374971
407 2993481826
408 8056215484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14535

AMP-binding_C_2

AMP-binding enzyme C-terminal domain

367

456

0.91

PF00501

AMP-binding

AMP-binding enzyme

15

321

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y27-assembly1.cif.gz_A crystal structure of paak1 in complex with atp from burkholderia cenocepacia 0.9565 6 443
2y4n-assembly1.cif.gz_A paak1 in complex with phenylacetyl adenylate 0.9562 5 443
2y4n-assembly1.cif.gz_B paak1 in complex with phenylacetyl adenylate 0.9529 5 443
2y27-assembly1.cif.gz_A crystal structure of paak1 in complex with atp from burkholderia cenocepacia 0.9499 6 443
2y4n-assembly1.cif.gz_B paak1 in complex with phenylacetyl adenylate 0.9485 5 443
ID Description Score Start End Superfamily
2y4nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9726 5 330 3.40.50.12780
2y4nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9667 5 330 3.40.50.12780
3qovC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9576 9 330 3.40.50.12780
3qovC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9313 9 330 3.40.50.12780
af_P76085_328_435_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.8804 330 442 3.30.300.30
ID Description Score Start End GO Terms
AF-A0A3G2G7M5-F1-model_v4 Phenylacetate-coenzyme A ligase (EC 6.2.1.30) (Phenylacetyl-CoA ligase) 0.9811 6 443 GO:0000166
GO:0010124
GO:0047475
AF-A0A7Y8V6J1-F1-model_v4 deleted 0.9794 9 253
AF-A0A357NBS0-F1-model_v4 Phenylacetate--CoA ligase 0.9775 117 310 GO:0016874
AF-A0A7X5IFA5-F1-model_v4 Phenylacetate--CoA ligase 0.9772 13 298 GO:0010124
GO:0047475
AF-A0A3G2G7M5-F1-model_v4 Phenylacetate-coenzyme A ligase (EC 6.2.1.30) (Phenylacetyl-CoA ligase) 0.9767 6 443 GO:0000166
GO:0010124
GO:0047475

Map