F310108
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 202 | 145 | 202 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300035410|Ga0373924_0015052|Ga0373924_0015052_1374_1739 |
| Length | 121 |
| Sequence | LIISFWREVLPEFLINIINSKRVSMLIVYLERLSAFGKNHANARKSLTVWKMVVEQTTWRKKQDVLTDFPKAKMIKNNRARFEIVHNTYRLIAQIDYEDQIVEVRFIGTHNEYDKIDPETI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 67 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 99 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 100 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 101 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 102 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 103 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 104 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 105 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 106 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 107 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 108 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 109 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 110 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 111 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 112 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 113 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 114 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 115 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 138 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 141 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 143 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 144 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 145 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.47 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 93.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000297 | 3300002459 | Bacteria | 18753 |
| 2 | rootH1_10190967 | 3300003323 | Bacteria | 6418 |
| 3 | Ga0065707_10360659 | 3300005295 | Bacteria | 904 |
| 4 | Ga0070658_10009396 | 3300005327 | Bacteria | 7855 |
| 5 | Ga0070683_100002701 | 3300005329 | Bacteria | 14166 |
| 6 | Ga0070690_100227809 | 3300005330 | Bacteria | 1309 |
| 7 | Ga0068869_100021560 | 3300005334 | Bacteria | 4434 |
| 8 | Ga0070682_100088955 | 3300005337 | Bacteria | 2016 |
| 9 | Ga0068868_101834930 | 3300005338 | Bacteria | 573 |
| 10 | Ga0070660_100387333 | 3300005339 | Bacteria | 1154 |
| 11 | Ga0070660_100933380 | 3300005339 | Bacteria | 732 |
| 12 | Ga0070687_100461226 | 3300005343 | Bacteria | 847 |
| 13 | Ga0070661_100000522 | 3300005344 | Bacteria | 29477 |
| 14 | Ga0070668_100070312 | 3300005347 | Bacteria | 2724 |
| 15 | Ga0070669_100428040 | 3300005353 | Bacteria | 1087 |
| 16 | Ga0070675_101016057 | 3300005354 | Bacteria | 761 |
| 17 | Ga0070671_100477868 | 3300005355 | Bacteria | 1070 |
| 18 | Ga0070674_100454800 | 3300005356 | Bacteria | 1057 |
| 19 | Ga0070659_100003078 | 3300005366 | Bacteria | 11846 |
| 20 | Ga0070667_100470767 | 3300005367 | Bacteria | 1150 |
| 21 | Ga0070678_100231790 | 3300005456 | Bacteria | 1540 |
| 22 | Ga0070662_100290555 | 3300005457 | Bacteria | 1325 |
| 23 | Ga0070681_10414872 | 3300005458 | Bacteria | 1258 |
| 24 | Ga0068867_100529698 | 3300005459 | Bacteria | 1017 |
| 25 | Ga0070707_100710899 | 3300005468 | Bacteria | 968 |
| 26 | Ga0070698_100015357 | 3300005471 | Bacteria | 8093 |
| 27 | Ga0070698_100116782 | 3300005471 | Bacteria | 2631 |
| 28 | Ga0070699_100332022 | 3300005518 | Bacteria | 1368 |
| 29 | Ga0070679_101439008 | 3300005530 | Bacteria | 636 |
| 30 | Ga0070684_100013314 | 3300005535 | Bacteria | 6628 |
| 31 | Ga0068853_100078785 | 3300005539 | Bacteria | 2880 |
| 32 | Ga0068853_100363796 | 3300005539 | Bacteria | 1348 |
| 33 | Ga0068853_101462617 | 3300005539 | Unclassified | 661 |
| 34 | Ga0070695_100254392 | 3300005545 | Bacteria | 1280 |
| 35 | Ga0070704_100615247 | 3300005549 | Bacteria | 956 |
| 36 | Ga0068855_101044247 | 3300005563 | Unclassified | 857 |
| 37 | Ga0070664_100006070 | 3300005564 | Bacteria | 9764 |
| 38 | Ga0068857_100009309 | 3300005577 | Bacteria | 8526 |
| 39 | Ga0068857_100042824 | 3300005577 | Bacteria | 4017 |
| 40 | Ga0068857_101064151 | 3300005577 | Bacteria | 780 |
| 41 | Ga0068857_101261216 | 3300005577 | Bacteria | 716 |
| 42 | Ga0068856_100022661 | 3300005614 | Bacteria | 6107 |
| 43 | Ga0068856_100025243 | 3300005614 | Bacteria | 5790 |
| 44 | Ga0068852_100104204 | 3300005616 | Bacteria | 2567 |
| 45 | Ga0068859_100939634 | 3300005617 | Bacteria | 948 |
| 46 | Ga0068859_102076096 | 3300005617 | Bacteria | 627 |
| 47 | Ga0068866_10143994 | 3300005718 | Bacteria | 1372 |
| 48 | Ga0068861_100163863 | 3300005719 | Bacteria | 1836 |
| 49 | Ga0068863_100304024 | 3300005841 | Unclassified | 1548 |
| 50 | Ga0068860_101477125 | 3300005843 | Bacteria | 701 |
| 51 | Ga0068862_102341014 | 3300005844 | Bacteria | 546 |
| 52 | Ga0075366_10020412 | 3300006195 | Bacteria | 3845 |
| 53 | Ga0075366_10020531 | 3300006195 | Bacteria | 3834 |
| 54 | Ga0097621_100320160 | 3300006237 | Bacteria | 1373 |
| 55 | Ga0097621_100528691 | 3300006237 | Bacteria | 1071 |
| 56 | Ga0068871_100834574 | 3300006358 | Bacteria | 851 |
| 57 | Ga0075428_101415014 | 3300006844 | Bacteria | 730 |
| 58 | Ga0075428_102358578 | 3300006844 | Unclassified | 547 |
| 59 | Ga0068865_100469292 | 3300006881 | Bacteria | 1044 |
| 60 | Ga0097620_100939703 | 3300006931 | Bacteria | 948 |
| 61 | Ga0097620_101955767 | 3300006931 | Unclassified | 647 |
| 62 | Ga0097620_102075965 | 3300006931 | Bacteria | 627 |
| 63 | Ga0105240_10003164 | 3300009093 | Bacteria | 25888 |
| 64 | Ga0105240_10045479 | 3300009093 | Bacteria | 5568 |
| 65 | Ga0105240_10297670 | 3300009093 | Bacteria | 1847 |
| 66 | Ga0111539_10491131 | 3300009094 | Bacteria | 1430 |
| 67 | Ga0111539_11175761 | 3300009094 | Bacteria | 891 |
| 68 | Ga0111539_12839246 | 3300009094 | Unclassified | 561 |
| 69 | Ga0105243_12108012 | 3300009148 | Bacteria | 599 |
| 70 | Ga0105241_10002036 | 3300009174 | Bacteria | 15289 |
| 71 | Ga0105241_10286184 | 3300009174 | Bacteria | 1410 |
| 72 | Ga0105242_10022274 | 3300009176 | Bacteria | 4980 |
| 73 | Ga0105242_10637568 | 3300009176 | Bacteria | 1034 |
| 74 | Ga0105242_10989887 | 3300009176 | Bacteria | 848 |
| 75 | Ga0105242_11151027 | 3300009176 | Bacteria | 792 |
| 76 | Ga0105237_10000144 | 3300009545 | Bacteria | 100105 |
| 77 | Ga0105237_10003823 | 3300009545 | Bacteria | 17699 |
| 78 | Ga0105237_10006744 | 3300009545 | Bacteria | 12680 |
| 79 | Ga0105237_11916716 | 3300009545 | Unclassified | 601 |
| 80 | Ga0105238_10120168 | 3300009551 | Bacteria | 2607 |
| 81 | Ga0105238_10258664 | 3300009551 | Bacteria | 1720 |
| 82 | Ga0105249_10031069 | 3300009553 | Bacteria | 4828 |
| 83 | Ga0105249_10193257 | 3300009553 | Viruses | 1987 |
| 84 | Ga0105249_11457425 | 3300009553 | Bacteria | 757 |
| 85 | Ga0105249_11549014 | 3300009553 | Bacteria | 735 |
| 86 | Ga0105249_12333292 | 3300009553 | Bacteria | 608 |
| 87 | Ga0105239_10000004 | 3300010375 | Bacteria | 532483 |
| 88 | Ga0105239_10016597 | 3300010375 | Bacteria | 8140 |
| 89 | Ga0105239_10121355 | 3300010375 | Bacteria | 2903 |
| 90 | Ga0105239_10522886 | 3300010375 | Bacteria | 1350 |
| 91 | Ga0105239_11607805 | 3300010375 | Unclassified | 752 |
| 92 | Ga0105246_10554995 | 3300011119 | Bacteria | 985 |
| 93 | Ga0157373_10069477 | 3300013100 | Unclassified | 2490 |
| 94 | Ga0157373_11236322 | 3300013100 | Bacteria | 564 |
| 95 | Ga0157371_10146820 | 3300013102 | Bacteria | 1681 |
| 96 | Ga0157378_10012777 | 3300013297 | Bacteria | 7350 |
| 97 | Ga0157372_10098150 | 3300013307 | Bacteria | 3342 |
| 98 | Ga0157372_10305859 | 3300013307 | Bacteria | 1850 |
| 99 | Ga0157372_10471819 | 3300013307 | Bacteria | 1463 |
| 100 | Ga0157372_12612678 | 3300013307 | Bacteria | 579 |
| 101 | Ga0157375_10890154 | 3300013308 | Bacteria | 1035 |
| 102 | Ga0157375_11296850 | 3300013308 | Unclassified | 856 |
| 103 | Ga0157375_11617897 | 3300013308 | Bacteria | 766 |
| 104 | Ga0163163_10485106 | 3300014325 | Bacteria | 1297 |
| 105 | Ga0157380_10086619 | 3300014326 | Bacteria | 2574 |
| 106 | Ga0157380_10282338 | 3300014326 | Bacteria | 1520 |
| 107 | Ga0157380_10454019 | 3300014326 | Bacteria | 1232 |
| 108 | Ga0213872_10012297 | 3300021361 | Bacteria | 4029 |
| 109 | Ga0207642_10602983 | 3300025899 | Bacteria | 684 |
| 110 | Ga0207688_10174066 | 3300025901 | Bacteria | 1281 |
| 111 | Ga0207647_10393626 | 3300025904 | Unclassified | 781 |
| 112 | Ga0207705_10081097 | 3300025909 | Bacteria | 2365 |
| 113 | Ga0207654_10002079 | 3300025911 | Bacteria | 10262 |
| 114 | Ga0207707_10948635 | 3300025912 | Bacteria | 709 |
| 115 | Ga0207695_10001122 | 3300025913 | Bacteria | 46534 |
| 116 | Ga0207695_10001383 | 3300025913 | Bacteria | 41051 |
| 117 | Ga0207671_10001502 | 3300025914 | Bacteria | 26900 |
| 118 | Ga0207671_10001689 | 3300025914 | Bacteria | 25015 |
| 119 | Ga0207671_10003338 | 3300025914 | Bacteria | 16119 |
| 120 | Ga0207662_10181544 | 3300025918 | Bacteria | 1354 |
| 121 | Ga0207649_10006869 | 3300025920 | Bacteria | 6183 |
| 122 | Ga0207694_10240604 | 3300025924 | Bacteria | 1479 |
| 123 | Ga0207694_10339530 | 3300025924 | Bacteria | 1242 |
| 124 | Ga0207644_10086849 | 3300025931 | Bacteria | 2323 |
| 125 | Ga0207690_10031769 | 3300025932 | Bacteria | 3382 |
| 126 | Ga0207686_10095752 | 3300025934 | Bacteria | 1970 |
| 127 | Ga0207686_10359861 | 3300025934 | Bacteria | 1098 |
| 128 | Ga0207686_10712208 | 3300025934 | Bacteria | 799 |
| 129 | Ga0207704_10473894 | 3300025938 | Bacteria | 1004 |
| 130 | Ga0207689_10005296 | 3300025942 | Bacteria | 11553 |
| 131 | Ga0207661_10008458 | 3300025944 | Bacteria | 7357 |
| 132 | Ga0207661_10692644 | 3300025944 | Bacteria | 937 |
| 133 | Ga0207679_10000358 | 3300025945 | Bacteria | 33285 |
| 134 | Ga0207712_10054177 | 3300025961 | Bacteria | 2816 |
| 135 | Ga0207712_11679562 | 3300025961 | Bacteria | 569 |
| 136 | Ga0207668_10917147 | 3300025972 | Unclassified | 780 |
| 137 | Ga0207639_10016276 | 3300026041 | Bacteria | 5257 |
| 138 | Ga0207708_11081914 | 3300026075 | Bacteria | 699 |
| 139 | Ga0207702_10001487 | 3300026078 | Bacteria | 23201 |
| 140 | Ga0207702_10055750 | 3300026078 | Bacteria | 3353 |
| 141 | Ga0207702_10348126 | 3300026078 | Bacteria | 1417 |
| 142 | Ga0207648_10748037 | 3300026089 | Bacteria | 908 |
| 143 | Ga0207648_11600296 | 3300026089 | Bacteria | 612 |
| 144 | Ga0207674_10015725 | 3300026116 | Bacteria | 8303 |
| 145 | Ga0207674_11529466 | 3300026116 | Bacteria | 636 |
| 146 | Ga0207675_100036277 | 3300026118 | Bacteria | 4600 |
| 147 | Ga0207683_10376662 | 3300026121 | Bacteria | 1304 |
| 148 | Ga0207698_10090889 | 3300026142 | Bacteria | 2498 |
| 149 | Ga0209996_1051584 | 3300027395 | Unclassified | 623 |
| 150 | Ga0209968_1013760 | 3300027526 | Bacteria | 1271 |
| 151 | Ga0268265_10270544 | 3300028380 | Viruses | 1515 |
| 152 | Ga0307517_10538213 | 3300028786 | Bacteria | 586 |
| 153 | Ga0307513_10189508 | 3300031456 | Bacteria | 1910 |
| 154 | Ga0307414_10891691 | 3300032004 | Bacteria | 815 |
| 155 | Ga0373924_0015052 | 3300035410 | Bacteria | 2933 |
| 156 | Ga0373935_0444508 | 3300035692 | Bacteria | 936 |
| 157 | Ga0373937_0161827 | 3300036401 | Bacteria | 2098 |
| 158 | Ga0373937_0303770 | 3300036401 | Bacteria | 1508 |
| 159 | Ga0436361_0372406 | 3300039447 | Bacteria | 10660 |
| 160 | Ga0439453_0099404 | 3300041408 | Unclassified | 647 |
| 161 | Ga0451835_1144140 | 3300041492 | Bacteria | 536 |
| 162 | Ga0451839_0113633 | 3300041496 | Bacteria | 516 |
| 163 | Ga0439441_174726 | 3300042001 | Bacteria | 514 |
| 164 | Ga0439443_116204 | 3300042003 | Bacteria | 522 |
| 165 | Ga0439464_0218154 | 3300042439 | Bacteria | 611 |
| 166 | Ga0439460_0374036 | 3300042461 | Bacteria | 504 |
| 167 | Ga0466972_0016389 | 3300044658 | Bacteria | 3706 |
| 168 | Ga0466968_0029116 | 3300044735 | Bacteria | 2282 |
| 169 | Ga0466960_0477451 | 3300044901 | Bacteria | 728 |
| 170 | Ga0495592_0089420 | 3300046454 | Bacteria | 2212 |
| 171 | Ga0495638_0491971 | 3300046460 | Unclassified | 619 |
| 172 | Ga0495606_0003961 | 3300046507 | Bacteria | 15192 |
| 173 | Ga0495606_0009411 | 3300046507 | Bacteria | 8272 |
| 174 | Ga0495608_0280948 | 3300046511 | Bacteria | 1033 |
| 175 | Ga0495610_0002268 | 3300046512 | Bacteria | 16251 |
| 176 | Ga0495616_0095590 | 3300046513 | Bacteria | 1400 |
| 177 | Ga0495618_0055434 | 3300046514 | Bacteria | 2510 |
| 178 | Ga0495628_0050920 | 3300046516 | Bacteria | 3275 |
| 179 | Ga0495630_0077421 | 3300046517 | Bacteria | 2507 |
| 180 | Ga0495652_0870883 | 3300046529 | Bacteria | 596 |
| 181 | Ga0495598_0036575 | 3300046537 | Bacteria | 1412 |
| 182 | Ga0495668_0000302 | 3300046616 | Bacteria | 68079 |
| 183 | Ga0495634_0149315 | 3300046642 | Bacteria | 1479 |
| 184 | Ga0495661_0040590 | 3300046665 | Bacteria | 2885 |
| 185 | Ga0495657_0273207 | 3300046675 | Bacteria | 1013 |
| 186 | Ga0495599_0049943 | 3300046678 | Bacteria | 2622 |
| 187 | Ga0495613_0308702 | 3300046689 | Bacteria | 1094 |
| 188 | Ga0495600_0283253 | 3300046809 | Bacteria | 1049 |
| 189 | Ga0495674_0447818 | 3300047319 | Bacteria | 1038 |
| 190 | Ga0495672_0243380 | 3300047320 | Bacteria | 877 |
| 191 | Ga0495683_0039590 | 3300047323 | Bacteria | 2382 |
| 192 | Ga0495684_0032470 | 3300047471 | Bacteria | 4009 |
| 193 | Ga0496120_0386678 | 3300048923 | Bacteria | 621 |
| 194 | Ga0501034_0078854 | 3300049571 | Bacteria | 3297 |
| 195 | Ga0501035_0283385 | 3300049822 | Bacteria | 1400 |
| 196 | nmdc:mga0k408_9586_c1 | 3300050493 | Bacteria | 5226 |
| 197 | nmdc:mga08y16_1193102_c1 | 3300050511 | Bacteria | 732 |
| 198 | nmdc:mga08y16_281211_c1 | 3300050511 | Bacteria | 1716 |
| 199 | Ga0500595_203333 | 3300053119 | Unclassified | 546 |
| 200 | Ga0500655_106717 | 3300053133 | Bacteria | 589 |
| 201 | Ga0500637_0054595 | 3300053178 | Bacteria | 2281 |
| 202 | Ga0500587_030060 | 3300053739 | Bacteria | 742 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002459 | JGI24751J29686_10000297 | JGI24751J29686_1000029718 | 97 |
| 2 | 3300003323 | rootH1_10190967 | rootH1_101909673 | 97 |
| 3 | 3300005295 | Ga0065707_10360659 | Ga0065707_103606591 | 97 |
| 4 | 3300005327 | Ga0070658_10009396 | Ga0070658_100093967 | 97 |
| 5 | 3300005329 | Ga0070683_100002701 | Ga0070683_1000027017 | 97 |
| 6 | 3300005330 | Ga0070690_100227809 | Ga0070690_1002278093 | 97 |
| 7 | 3300005334 | Ga0068869_100021560 | Ga0068869_1000215606 | 97 |
| 8 | 3300005337 | Ga0070682_100088955 | Ga0070682_1000889552 | 97 |
| 9 | 3300005338 | Ga0068868_101834930 | Ga0068868_1018349301 | 97 |
| 10 | 3300005339 | Ga0070660_100387333 | Ga0070660_1003873333 | 97 |
| 11 | 3300005339 | Ga0070660_100933380 | Ga0070660_1009333801 | 97 |
| 12 | 3300005343 | Ga0070687_100461226 | Ga0070687_1004612262 | 97 |
| 13 | 3300005344 | Ga0070661_100000522 | Ga0070661_1000005226 | 97 |
| 14 | 3300005347 | Ga0070668_100070312 | Ga0070668_1000703123 | 97 |
| 15 | 3300005353 | Ga0070669_100428040 | Ga0070669_1004280401 | 97 |
| 16 | 3300005354 | Ga0070675_101016057 | Ga0070675_1010160571 | 97 |
| 17 | 3300005355 | Ga0070671_100477868 | Ga0070671_1004778682 | 97 |
| 18 | 3300005356 | Ga0070674_100454800 | Ga0070674_1004548002 | 97 |
| 19 | 3300005366 | Ga0070659_100003078 | Ga0070659_1000030786 | 97 |
| 20 | 3300005367 | Ga0070667_100470767 | Ga0070667_1004707672 | 97 |
| 21 | 3300005456 | Ga0070678_100231790 | Ga0070678_1002317903 | 97 |
| 22 | 3300005457 | Ga0070662_100290555 | Ga0070662_1002905551 | 97 |
| 23 | 3300005458 | Ga0070681_10414872 | Ga0070681_104148722 | 97 |
| 24 | 3300005459 | Ga0068867_100529698 | Ga0068867_1005296981 | 97 |
| 25 | 3300005468 | Ga0070707_100710899 | Ga0070707_1007108992 | 97 |
| 26 | 3300005471 | Ga0070698_100015357 | Ga0070698_1000153576 | 97 |
| 27 | 3300005471 | Ga0070698_100116782 | Ga0070698_1001167824 | 97 |
| 28 | 3300005518 | Ga0070699_100332022 | Ga0070699_1003320223 | 97 |
| 29 | 3300005530 | Ga0070679_101439008 | Ga0070679_1014390081 | 97 |
| 30 | 3300005535 | Ga0070684_100013314 | Ga0070684_1000133146 | 97 |
| 31 | 3300005539 | Ga0068853_100078785 | Ga0068853_1000787853 | 97 |
| 32 | 3300005539 | Ga0068853_100363796 | Ga0068853_1003637961 | 97 |
| 33 | 3300005539 | Ga0068853_101462617 | Ga0068853_1014626171 | 97 |
| 34 | 3300005545 | Ga0070695_100254392 | Ga0070695_1002543922 | 97 |
| 35 | 3300005549 | Ga0070704_100615247 | Ga0070704_1006152473 | 97 |
| 36 | 3300005563 | Ga0068855_101044247 | Ga0068855_1010442472 | 97 |
| 37 | 3300005564 | Ga0070664_100006070 | Ga0070664_10000607011 | 97 |
| 38 | 3300005577 | Ga0068857_100009309 | Ga0068857_1000093099 | 97 |
| 39 | 3300005577 | Ga0068857_100042824 | Ga0068857_1000428242 | 97 |
| 40 | 3300005577 | Ga0068857_101064151 | Ga0068857_1010641512 | 97 |
| 41 | 3300005577 | Ga0068857_101261216 | Ga0068857_1012612161 | 97 |
| 42 | 3300005614 | Ga0068856_100022661 | Ga0068856_1000226615 | 97 |
| 43 | 3300005614 | Ga0068856_100025243 | Ga0068856_1000252433 | 97 |
| 44 | 3300005616 | Ga0068852_100104204 | Ga0068852_1001042046 | 97 |
| 45 | 3300005617 | Ga0068859_100939634 | Ga0068859_1009396343 | 97 |
| 46 | 3300005617 | Ga0068859_102076096 | Ga0068859_1020760961 | 97 |
| 47 | 3300005718 | Ga0068866_10143994 | Ga0068866_101439942 | 97 |
| 48 | 3300005719 | Ga0068861_100163863 | Ga0068861_1001638633 | 97 |
| 49 | 3300005841 | Ga0068863_100304024 | Ga0068863_1003040242 | 97 |
| 50 | 3300005843 | Ga0068860_101477125 | Ga0068860_1014771251 | 97 |
| 51 | 3300005844 | Ga0068862_102341014 | Ga0068862_1023410141 | 97 |
| 52 | 3300006195 | Ga0075366_10020412 | Ga0075366_100204125 | 97 |
| 53 | 3300006195 | Ga0075366_10020531 | Ga0075366_100205315 | 97 |
| 54 | 3300006237 | Ga0097621_100320160 | Ga0097621_1003201603 | 97 |
| 55 | 3300006237 | Ga0097621_100528691 | Ga0097621_1005286913 | 97 |
| 56 | 3300006358 | Ga0068871_100834574 | Ga0068871_1008345741 | 97 |
| 57 | 3300006844 | Ga0075428_101415014 | Ga0075428_1014150141 | 97 |
| 58 | 3300006844 | Ga0075428_102358578 | Ga0075428_1023585781 | 97 |
| 59 | 3300006881 | Ga0068865_100469292 | Ga0068865_1004692922 | 97 |
| 60 | 3300006931 | Ga0097620_100939703 | Ga0097620_1009397033 | 97 |
| 61 | 3300006931 | Ga0097620_101955767 | Ga0097620_1019557672 | 97 |
| 62 | 3300006931 | Ga0097620_102075965 | Ga0097620_1020759651 | 97 |
| 63 | 3300009093 | Ga0105240_10003164 | Ga0105240_1000316410 | 97 |
| 64 | 3300009093 | Ga0105240_10045479 | Ga0105240_100454792 | 97 |
| 65 | 3300009093 | Ga0105240_10297670 | Ga0105240_102976703 | 97 |
| 66 | 3300009094 | Ga0111539_10491131 | Ga0111539_104911313 | 97 |
| 67 | 3300009094 | Ga0111539_11175761 | Ga0111539_111757612 | 97 |
| 68 | 3300009094 | Ga0111539_12839246 | Ga0111539_128392462 | 97 |
| 69 | 3300009148 | Ga0105243_12108012 | Ga0105243_121080122 | 97 |
| 70 | 3300009174 | Ga0105241_10002036 | Ga0105241_100020368 | 97 |
| 71 | 3300009174 | Ga0105241_10286184 | Ga0105241_102861843 | 97 |
| 72 | 3300009176 | Ga0105242_10022274 | Ga0105242_100222744 | 97 |
| 73 | 3300009176 | Ga0105242_10637568 | Ga0105242_106375681 | 97 |
| 74 | 3300009176 | Ga0105242_10989887 | Ga0105242_109898872 | 97 |
| 75 | 3300009176 | Ga0105242_11151027 | Ga0105242_111510272 | 97 |
| 76 | 3300009545 | Ga0105237_10000144 | Ga0105237_1000014429 | 97 |
| 77 | 3300009545 | Ga0105237_10003823 | Ga0105237_1000382310 | 97 |
| 78 | 3300009545 | Ga0105237_10006744 | Ga0105237_100067446 | 97 |
| 79 | 3300009545 | Ga0105237_11916716 | Ga0105237_119167161 | 97 |
| 80 | 3300009551 | Ga0105238_10120168 | Ga0105238_101201682 | 97 |
| 81 | 3300009551 | Ga0105238_10258664 | Ga0105238_102586643 | 97 |
| 82 | 3300009553 | Ga0105249_10031069 | Ga0105249_100310694 | 97 |
| 83 | 3300009553 | Ga0105249_10193257 | Ga0105249_101932572 | 97 |
| 84 | 3300009553 | Ga0105249_11457425 | Ga0105249_114574251 | 97 |
| 85 | 3300009553 | Ga0105249_11549014 | Ga0105249_115490142 | 97 |
| 86 | 3300009553 | Ga0105249_12333292 | Ga0105249_123332922 | 97 |
| 87 | 3300010375 | Ga0105239_10000004 | Ga0105239_1000000436 | 97 |
| 88 | 3300010375 | Ga0105239_10016597 | Ga0105239_1001659711 | 97 |
| 89 | 3300010375 | Ga0105239_10121355 | Ga0105239_101213553 | 97 |
| 90 | 3300010375 | Ga0105239_10522886 | Ga0105239_105228861 | 97 |
| 91 | 3300010375 | Ga0105239_11607805 | Ga0105239_116078052 | 97 |
| 92 | 3300011119 | Ga0105246_10554995 | Ga0105246_105549952 | 97 |
| 93 | 3300013100 | Ga0157373_10069477 | Ga0157373_100694773 | 97 |
| 94 | 3300013100 | Ga0157373_11236322 | Ga0157373_112363221 | 97 |
| 95 | 3300013102 | Ga0157371_10146820 | Ga0157371_101468203 | 97 |
| 96 | 3300013297 | Ga0157378_10012777 | Ga0157378_100127771 | 97 |
| 97 | 3300013307 | Ga0157372_10098150 | Ga0157372_100981502 | 97 |
| 98 | 3300013307 | Ga0157372_10305859 | Ga0157372_103058593 | 97 |
| 99 | 3300013307 | Ga0157372_10471819 | Ga0157372_104718192 | 97 |
| 100 | 3300013307 | Ga0157372_12612678 | Ga0157372_126126781 | 97 |
| 101 | 3300013308 | Ga0157375_10890154 | Ga0157375_108901542 | 97 |
| 102 | 3300013308 | Ga0157375_11296850 | Ga0157375_112968502 | 97 |
| 103 | 3300013308 | Ga0157375_11617897 | Ga0157375_116178971 | 97 |
| 104 | 3300014325 | Ga0163163_10485106 | Ga0163163_104851062 | 97 |
| 105 | 3300014326 | Ga0157380_10086619 | Ga0157380_100866194 | 97 |
| 106 | 3300014326 | Ga0157380_10282338 | Ga0157380_102823383 | 97 |
| 107 | 3300014326 | Ga0157380_10454019 | Ga0157380_104540193 | 97 |
| 108 | 3300021361 | Ga0213872_10012297 | Ga0213872_100122973 | 97 |
| 109 | 3300025899 | Ga0207642_10602983 | Ga0207642_106029832 | 97 |
| 110 | 3300025901 | Ga0207688_10174066 | Ga0207688_101740662 | 97 |
| 111 | 3300025904 | Ga0207647_10393626 | Ga0207647_103936262 | 97 |
| 112 | 3300025909 | Ga0207705_10081097 | Ga0207705_100810972 | 97 |
| 113 | 3300025911 | Ga0207654_10002079 | Ga0207654_100020796 | 97 |
| 114 | 3300025912 | Ga0207707_10948635 | Ga0207707_109486351 | 97 |
| 115 | 3300025913 | Ga0207695_10001122 | Ga0207695_1000112229 | 97 |
| 116 | 3300025913 | Ga0207695_10001383 | Ga0207695_100013832 | 97 |
| 117 | 3300025914 | Ga0207671_10001502 | Ga0207671_1000150223 | 97 |
| 118 | 3300025914 | Ga0207671_10001689 | Ga0207671_1000168924 | 97 |
| 119 | 3300025914 | Ga0207671_10003338 | Ga0207671_1000333810 | 97 |
| 120 | 3300025918 | Ga0207662_10181544 | Ga0207662_101815441 | 97 |
| 121 | 3300025920 | Ga0207649_10006869 | Ga0207649_100068693 | 97 |
| 122 | 3300025924 | Ga0207694_10240604 | Ga0207694_102406043 | 97 |
| 123 | 3300025924 | Ga0207694_10339530 | Ga0207694_103395302 | 97 |
| 124 | 3300025931 | Ga0207644_10086849 | Ga0207644_100868492 | 97 |
| 125 | 3300025932 | Ga0207690_10031769 | Ga0207690_100317693 | 97 |
| 126 | 3300025934 | Ga0207686_10095752 | Ga0207686_100957521 | 97 |
| 127 | 3300025934 | Ga0207686_10359861 | Ga0207686_103598611 | 97 |
| 128 | 3300025934 | Ga0207686_10712208 | Ga0207686_107122082 | 97 |
| 129 | 3300025938 | Ga0207704_10473894 | Ga0207704_104738942 | 97 |
| 130 | 3300025942 | Ga0207689_10005296 | Ga0207689_100052965 | 97 |
| 131 | 3300025944 | Ga0207661_10008458 | Ga0207661_100084585 | 97 |
| 132 | 3300025944 | Ga0207661_10692644 | Ga0207661_106926442 | 97 |
| 133 | 3300025945 | Ga0207679_10000358 | Ga0207679_1000035826 | 97 |
| 134 | 3300025961 | Ga0207712_10054177 | Ga0207712_100541773 | 97 |
| 135 | 3300025961 | Ga0207712_11679562 | Ga0207712_116795622 | 97 |
| 136 | 3300025972 | Ga0207668_10917147 | Ga0207668_109171472 | 97 |
| 137 | 3300026041 | Ga0207639_10016276 | Ga0207639_100162764 | 97 |
| 138 | 3300026075 | Ga0207708_11081914 | Ga0207708_110819142 | 97 |
| 139 | 3300026078 | Ga0207702_10001487 | Ga0207702_100014876 | 97 |
| 140 | 3300026078 | Ga0207702_10055750 | Ga0207702_100557504 | 97 |
| 141 | 3300026078 | Ga0207702_10348126 | Ga0207702_103481262 | 97 |
| 142 | 3300026089 | Ga0207648_10748037 | Ga0207648_107480371 | 97 |
| 143 | 3300026089 | Ga0207648_11600296 | Ga0207648_116002962 | 97 |
| 144 | 3300026116 | Ga0207674_10015725 | Ga0207674_100157258 | 97 |
| 145 | 3300026116 | Ga0207674_11529466 | Ga0207674_115294661 | 97 |
| 146 | 3300026118 | Ga0207675_100036277 | Ga0207675_1000362774 | 97 |
| 147 | 3300026121 | Ga0207683_10376662 | Ga0207683_103766622 | 97 |
| 148 | 3300026142 | Ga0207698_10090889 | Ga0207698_100908894 | 97 |
| 149 | 3300027395 | Ga0209996_1051584 | Ga0209996_10515841 | 97 |
| 150 | 3300027526 | Ga0209968_1013760 | Ga0209968_10137602 | 97 |
| 151 | 3300028380 | Ga0268265_10270544 | Ga0268265_102705442 | 97 |
| 152 | 3300028786 | Ga0307517_10538213 | Ga0307517_105382131 | 97 |
| 153 | 3300031456 | Ga0307513_10189508 | Ga0307513_101895083 | 97 |
| 154 | 3300032004 | Ga0307414_10891691 | Ga0307414_108916912 | 97 |
| 155 | 3300035410 | Ga0373924_0015052 | Ga0373924_0015052_1374_1739 | 97 |
| 156 | 3300035692 | Ga0373935_0444508 | Ga0373935_0444508_258_623 | 97 |
| 157 | 3300036401 | Ga0373937_0161827 | Ga0373937_0161827_93_386 | 97 |
| 158 | 3300036401 | Ga0373937_0303770 | Ga0373937_0303770_770_1135 | 97 |
| 159 | 3300039447 | Ga0436361_0372406 | Ga0436361_0372406_5442_5735 | 97 |
| 160 | 3300041408 | Ga0439453_0099404 | Ga0439453_0099404_51_344 | 97 |
| 161 | 3300041492 | Ga0451835_1144140 | Ga0451835_1144140_37_330 | 97 |
| 162 | 3300041496 | Ga0451839_0113633 | Ga0451839_0113633_194_487 | 97 |
| 163 | 3300042001 | Ga0439441_174726 | Ga0439441_174726_85_378 | 97 |
| 164 | 3300042003 | Ga0439443_116204 | Ga0439443_116204_98_391 | 97 |
| 165 | 3300042439 | Ga0439464_0218154 | Ga0439464_0218154_200_493 | 97 |
| 166 | 3300042461 | Ga0439460_0374036 | Ga0439460_0374036_174_467 | 97 |
| 167 | 3300044658 | Ga0466972_0016389 | Ga0466972_0016389_3233_3526 | 97 |
| 168 | 3300044735 | Ga0466968_0029116 | Ga0466968_0029116_1767_2060 | 97 |
| 169 | 3300044901 | Ga0466960_0477451 | Ga0466960_0477451_67_360 | 97 |
| 170 | 3300046454 | Ga0495592_0089420 | Ga0495592_0089420_1130_1495 | 97 |
| 171 | 3300046460 | Ga0495638_0491971 | Ga0495638_0491971_174_467 | 97 |
| 172 | 3300046507 | Ga0495606_0003961 | Ga0495606_0003961_2582_2875 | 97 |
| 173 | 3300046507 | Ga0495606_0009411 | Ga0495606_0009411_4031_4324 | 97 |
| 174 | 3300046511 | Ga0495608_0280948 | Ga0495608_0280948_79_444 | 97 |
| 175 | 3300046512 | Ga0495610_0002268 | Ga0495610_0002268_9970_10263 | 97 |
| 176 | 3300046513 | Ga0495616_0095590 | Ga0495616_0095590_831_1154 | 97 |
| 177 | 3300046514 | Ga0495618_0055434 | Ga0495618_0055434_1900_2265 | 97 |
| 178 | 3300046516 | Ga0495628_0050920 | Ga0495628_0050920_2200_2565 | 97 |
| 179 | 3300046517 | Ga0495630_0077421 | Ga0495630_0077421_1522_1887 | 97 |
| 180 | 3300046529 | Ga0495652_0870883 | Ga0495652_0870883_280_573 | 97 |
| 181 | 3300046537 | Ga0495598_0036575 | Ga0495598_0036575_562_855 | 97 |
| 182 | 3300046616 | Ga0495668_0000302 | Ga0495668_0000302_4252_4545 | 97 |
| 183 | 3300046642 | Ga0495634_0149315 | Ga0495634_0149315_222_587 | 97 |
| 184 | 3300046665 | Ga0495661_0040590 | Ga0495661_0040590_1218_1511 | 97 |
| 185 | 3300046675 | Ga0495657_0273207 | Ga0495657_0273207_531_896 | 97 |
| 186 | 3300046678 | Ga0495599_0049943 | Ga0495599_0049943_735_1100 | 97 |
| 187 | 3300046689 | Ga0495613_0308702 | Ga0495613_0308702_190_555 | 97 |
| 188 | 3300046809 | Ga0495600_0283253 | Ga0495600_0283253_312_677 | 97 |
| 189 | 3300047319 | Ga0495674_0447818 | Ga0495674_0447818_47_412 | 97 |
| 190 | 3300047320 | Ga0495672_0243380 | Ga0495672_0243380_267_560 | 97 |
| 191 | 3300047323 | Ga0495683_0039590 | Ga0495683_0039590_1897_2190 | 97 |
| 192 | 3300047471 | Ga0495684_0032470 | Ga0495684_0032470_994_1359 | 97 |
| 193 | 3300048923 | Ga0496120_0386678 | Ga0496120_0386678_16_309 | 97 |
| 194 | 3300049571 | Ga0501034_0078854 | Ga0501034_0078854_1184_1477 | 97 |
| 195 | 3300049822 | Ga0501035_0283385 | Ga0501035_0283385_62_355 | 97 |
| 196 | 3300050493 | nmdc:mga0k408_9586_c1 | nmdc:mga0k408_9586_c1_2216_2509 | 97 |
| 197 | 3300050511 | nmdc:mga08y16_1193102_c1 | nmdc:mga08y16_1193102_c1_305_598 | 97 |
| 198 | 3300050511 | nmdc:mga08y16_281211_c1 | nmdc:mga08y16_281211_c1_840_1133 | 97 |
| 199 | 3300053119 | Ga0500595_203333 | Ga0500595_203333_196_513 | 97 |
| 200 | 3300053133 | Ga0500655_106717 | Ga0500655_106717_22_315 | 97 |
| 201 | 3300053178 | Ga0500637_0054595 | Ga0500637_0054595_1814_2107 | 97 |
| 202 | 3300053739 | Ga0500587_030060 | Ga0500587_030060_281_574 | 97 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6kml-assembly1.cif.gz_A | 2.09 angstrom resolution crystal structure of tetrameric higba toxin-antitoxin complex from e.coli | 0.9033 | 1 | 90 |
| 5ifg-assembly1.cif.gz_C | crystal structure of higa-higb complex from e. coli | 0.903 | 1 | 90 |
| 6kmq-assembly1.cif.gz_A | 2.3 angstrom resolution structure of dimeric higba toxin-antitoxin complex from e. coli | 0.8948 | 1 | 86 |
| 5ycl-assembly1.cif.gz_D | crystal structure of higba complex from shigella flexneri | 0.8682 | 1 | 90 |
| 6kmq-assembly1.cif.gz_A | 2.3 angstrom resolution structure of dimeric higba toxin-antitoxin complex from e. coli | 0.8411 | 1 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P64578_19_94_3.30.2310.20 | Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like | 0.8941 | 23 | 92 | 3.30.2310.20 |
| af_A0A0P0W3X0_152_455_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.8695 | 55 | 87 | 2.120.10.80 |
| af_O13856_4_201_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8679 | 47 | 85 | 2.130.10.10 |
| af_Q8MSW9_149_484_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8474 | 54 | 85 | 2.130.10.10 |
| af_O94533_29_248_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8368 | 51 | 85 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A858R8B0-F1-model_v4 | Type II toxin-antitoxin system HigB family toxin | 0.9986 | 1 | 97 |
GO:0003723
GO:0004519 GO:0110001 |
| AF-A0A846VE57-F1-model_v4 | deleted | 0.9984 | 1 | 97 |
|
| AF-A0A1Q3YY08-F1-model_v4 | Addiction module toxin RelE | 0.997 | 1 | 97 |
GO:0003723
GO:0004519 GO:0110001 |
| AF-T0IV01-F1-model_v4 | Toxin RelE | 0.9964 | 1 | 97 |
GO:0003723
GO:0004519 GO:0110001 |
| AF-A0A317DXB4-F1-model_v4 | Type II toxin-antitoxin system HigB family toxin | 0.9959 | 1 | 97 |
GO:0003723
GO:0004519 GO:0110001 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar