F310108

General Info

Members Datasets Scaffolds Average Seq Length
202 145 202 99

Family's Representative Sequence

Representative Sequence 3300035410|Ga0373924_0015052|Ga0373924_0015052_1374_1739
Length 121
Sequence LIISFWREVLPEFLINIINSKRVSMLIVYLERLSAFGKNHANARKSLTVWKMVVEQTTWRKKQDVLTDFPKAKMIKNNRARFEIVHNTYRLIAQIDYEDQIVEVRFIGTHNEYDKIDPETI

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
106 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
107 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
108 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
109 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
110 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
111 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
143 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
144 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
145 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.47
Nodule 0
Rhizoplane 0
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000297 3300002459 Bacteria 18753
2 rootH1_10190967 3300003323 Bacteria 6418
3 Ga0065707_10360659 3300005295 Bacteria 904
4 Ga0070658_10009396 3300005327 Bacteria 7855
5 Ga0070683_100002701 3300005329 Bacteria 14166
6 Ga0070690_100227809 3300005330 Bacteria 1309
7 Ga0068869_100021560 3300005334 Bacteria 4434
8 Ga0070682_100088955 3300005337 Bacteria 2016
9 Ga0068868_101834930 3300005338 Bacteria 573
10 Ga0070660_100387333 3300005339 Bacteria 1154
11 Ga0070660_100933380 3300005339 Bacteria 732
12 Ga0070687_100461226 3300005343 Bacteria 847
13 Ga0070661_100000522 3300005344 Bacteria 29477
14 Ga0070668_100070312 3300005347 Bacteria 2724
15 Ga0070669_100428040 3300005353 Bacteria 1087
16 Ga0070675_101016057 3300005354 Bacteria 761
17 Ga0070671_100477868 3300005355 Bacteria 1070
18 Ga0070674_100454800 3300005356 Bacteria 1057
19 Ga0070659_100003078 3300005366 Bacteria 11846
20 Ga0070667_100470767 3300005367 Bacteria 1150
21 Ga0070678_100231790 3300005456 Bacteria 1540
22 Ga0070662_100290555 3300005457 Bacteria 1325
23 Ga0070681_10414872 3300005458 Bacteria 1258
24 Ga0068867_100529698 3300005459 Bacteria 1017
25 Ga0070707_100710899 3300005468 Bacteria 968
26 Ga0070698_100015357 3300005471 Bacteria 8093
27 Ga0070698_100116782 3300005471 Bacteria 2631
28 Ga0070699_100332022 3300005518 Bacteria 1368
29 Ga0070679_101439008 3300005530 Bacteria 636
30 Ga0070684_100013314 3300005535 Bacteria 6628
31 Ga0068853_100078785 3300005539 Bacteria 2880
32 Ga0068853_100363796 3300005539 Bacteria 1348
33 Ga0068853_101462617 3300005539 Unclassified 661
34 Ga0070695_100254392 3300005545 Bacteria 1280
35 Ga0070704_100615247 3300005549 Bacteria 956
36 Ga0068855_101044247 3300005563 Unclassified 857
37 Ga0070664_100006070 3300005564 Bacteria 9764
38 Ga0068857_100009309 3300005577 Bacteria 8526
39 Ga0068857_100042824 3300005577 Bacteria 4017
40 Ga0068857_101064151 3300005577 Bacteria 780
41 Ga0068857_101261216 3300005577 Bacteria 716
42 Ga0068856_100022661 3300005614 Bacteria 6107
43 Ga0068856_100025243 3300005614 Bacteria 5790
44 Ga0068852_100104204 3300005616 Bacteria 2567
45 Ga0068859_100939634 3300005617 Bacteria 948
46 Ga0068859_102076096 3300005617 Bacteria 627
47 Ga0068866_10143994 3300005718 Bacteria 1372
48 Ga0068861_100163863 3300005719 Bacteria 1836
49 Ga0068863_100304024 3300005841 Unclassified 1548
50 Ga0068860_101477125 3300005843 Bacteria 701
51 Ga0068862_102341014 3300005844 Bacteria 546
52 Ga0075366_10020412 3300006195 Bacteria 3845
53 Ga0075366_10020531 3300006195 Bacteria 3834
54 Ga0097621_100320160 3300006237 Bacteria 1373
55 Ga0097621_100528691 3300006237 Bacteria 1071
56 Ga0068871_100834574 3300006358 Bacteria 851
57 Ga0075428_101415014 3300006844 Bacteria 730
58 Ga0075428_102358578 3300006844 Unclassified 547
59 Ga0068865_100469292 3300006881 Bacteria 1044
60 Ga0097620_100939703 3300006931 Bacteria 948
61 Ga0097620_101955767 3300006931 Unclassified 647
62 Ga0097620_102075965 3300006931 Bacteria 627
63 Ga0105240_10003164 3300009093 Bacteria 25888
64 Ga0105240_10045479 3300009093 Bacteria 5568
65 Ga0105240_10297670 3300009093 Bacteria 1847
66 Ga0111539_10491131 3300009094 Bacteria 1430
67 Ga0111539_11175761 3300009094 Bacteria 891
68 Ga0111539_12839246 3300009094 Unclassified 561
69 Ga0105243_12108012 3300009148 Bacteria 599
70 Ga0105241_10002036 3300009174 Bacteria 15289
71 Ga0105241_10286184 3300009174 Bacteria 1410
72 Ga0105242_10022274 3300009176 Bacteria 4980
73 Ga0105242_10637568 3300009176 Bacteria 1034
74 Ga0105242_10989887 3300009176 Bacteria 848
75 Ga0105242_11151027 3300009176 Bacteria 792
76 Ga0105237_10000144 3300009545 Bacteria 100105
77 Ga0105237_10003823 3300009545 Bacteria 17699
78 Ga0105237_10006744 3300009545 Bacteria 12680
79 Ga0105237_11916716 3300009545 Unclassified 601
80 Ga0105238_10120168 3300009551 Bacteria 2607
81 Ga0105238_10258664 3300009551 Bacteria 1720
82 Ga0105249_10031069 3300009553 Bacteria 4828
83 Ga0105249_10193257 3300009553 Viruses 1987
84 Ga0105249_11457425 3300009553 Bacteria 757
85 Ga0105249_11549014 3300009553 Bacteria 735
86 Ga0105249_12333292 3300009553 Bacteria 608
87 Ga0105239_10000004 3300010375 Bacteria 532483
88 Ga0105239_10016597 3300010375 Bacteria 8140
89 Ga0105239_10121355 3300010375 Bacteria 2903
90 Ga0105239_10522886 3300010375 Bacteria 1350
91 Ga0105239_11607805 3300010375 Unclassified 752
92 Ga0105246_10554995 3300011119 Bacteria 985
93 Ga0157373_10069477 3300013100 Unclassified 2490
94 Ga0157373_11236322 3300013100 Bacteria 564
95 Ga0157371_10146820 3300013102 Bacteria 1681
96 Ga0157378_10012777 3300013297 Bacteria 7350
97 Ga0157372_10098150 3300013307 Bacteria 3342
98 Ga0157372_10305859 3300013307 Bacteria 1850
99 Ga0157372_10471819 3300013307 Bacteria 1463
100 Ga0157372_12612678 3300013307 Bacteria 579
101 Ga0157375_10890154 3300013308 Bacteria 1035
102 Ga0157375_11296850 3300013308 Unclassified 856
103 Ga0157375_11617897 3300013308 Bacteria 766
104 Ga0163163_10485106 3300014325 Bacteria 1297
105 Ga0157380_10086619 3300014326 Bacteria 2574
106 Ga0157380_10282338 3300014326 Bacteria 1520
107 Ga0157380_10454019 3300014326 Bacteria 1232
108 Ga0213872_10012297 3300021361 Bacteria 4029
109 Ga0207642_10602983 3300025899 Bacteria 684
110 Ga0207688_10174066 3300025901 Bacteria 1281
111 Ga0207647_10393626 3300025904 Unclassified 781
112 Ga0207705_10081097 3300025909 Bacteria 2365
113 Ga0207654_10002079 3300025911 Bacteria 10262
114 Ga0207707_10948635 3300025912 Bacteria 709
115 Ga0207695_10001122 3300025913 Bacteria 46534
116 Ga0207695_10001383 3300025913 Bacteria 41051
117 Ga0207671_10001502 3300025914 Bacteria 26900
118 Ga0207671_10001689 3300025914 Bacteria 25015
119 Ga0207671_10003338 3300025914 Bacteria 16119
120 Ga0207662_10181544 3300025918 Bacteria 1354
121 Ga0207649_10006869 3300025920 Bacteria 6183
122 Ga0207694_10240604 3300025924 Bacteria 1479
123 Ga0207694_10339530 3300025924 Bacteria 1242
124 Ga0207644_10086849 3300025931 Bacteria 2323
125 Ga0207690_10031769 3300025932 Bacteria 3382
126 Ga0207686_10095752 3300025934 Bacteria 1970
127 Ga0207686_10359861 3300025934 Bacteria 1098
128 Ga0207686_10712208 3300025934 Bacteria 799
129 Ga0207704_10473894 3300025938 Bacteria 1004
130 Ga0207689_10005296 3300025942 Bacteria 11553
131 Ga0207661_10008458 3300025944 Bacteria 7357
132 Ga0207661_10692644 3300025944 Bacteria 937
133 Ga0207679_10000358 3300025945 Bacteria 33285
134 Ga0207712_10054177 3300025961 Bacteria 2816
135 Ga0207712_11679562 3300025961 Bacteria 569
136 Ga0207668_10917147 3300025972 Unclassified 780
137 Ga0207639_10016276 3300026041 Bacteria 5257
138 Ga0207708_11081914 3300026075 Bacteria 699
139 Ga0207702_10001487 3300026078 Bacteria 23201
140 Ga0207702_10055750 3300026078 Bacteria 3353
141 Ga0207702_10348126 3300026078 Bacteria 1417
142 Ga0207648_10748037 3300026089 Bacteria 908
143 Ga0207648_11600296 3300026089 Bacteria 612
144 Ga0207674_10015725 3300026116 Bacteria 8303
145 Ga0207674_11529466 3300026116 Bacteria 636
146 Ga0207675_100036277 3300026118 Bacteria 4600
147 Ga0207683_10376662 3300026121 Bacteria 1304
148 Ga0207698_10090889 3300026142 Bacteria 2498
149 Ga0209996_1051584 3300027395 Unclassified 623
150 Ga0209968_1013760 3300027526 Bacteria 1271
151 Ga0268265_10270544 3300028380 Viruses 1515
152 Ga0307517_10538213 3300028786 Bacteria 586
153 Ga0307513_10189508 3300031456 Bacteria 1910
154 Ga0307414_10891691 3300032004 Bacteria 815
155 Ga0373924_0015052 3300035410 Bacteria 2933
156 Ga0373935_0444508 3300035692 Bacteria 936
157 Ga0373937_0161827 3300036401 Bacteria 2098
158 Ga0373937_0303770 3300036401 Bacteria 1508
159 Ga0436361_0372406 3300039447 Bacteria 10660
160 Ga0439453_0099404 3300041408 Unclassified 647
161 Ga0451835_1144140 3300041492 Bacteria 536
162 Ga0451839_0113633 3300041496 Bacteria 516
163 Ga0439441_174726 3300042001 Bacteria 514
164 Ga0439443_116204 3300042003 Bacteria 522
165 Ga0439464_0218154 3300042439 Bacteria 611
166 Ga0439460_0374036 3300042461 Bacteria 504
167 Ga0466972_0016389 3300044658 Bacteria 3706
168 Ga0466968_0029116 3300044735 Bacteria 2282
169 Ga0466960_0477451 3300044901 Bacteria 728
170 Ga0495592_0089420 3300046454 Bacteria 2212
171 Ga0495638_0491971 3300046460 Unclassified 619
172 Ga0495606_0003961 3300046507 Bacteria 15192
173 Ga0495606_0009411 3300046507 Bacteria 8272
174 Ga0495608_0280948 3300046511 Bacteria 1033
175 Ga0495610_0002268 3300046512 Bacteria 16251
176 Ga0495616_0095590 3300046513 Bacteria 1400
177 Ga0495618_0055434 3300046514 Bacteria 2510
178 Ga0495628_0050920 3300046516 Bacteria 3275
179 Ga0495630_0077421 3300046517 Bacteria 2507
180 Ga0495652_0870883 3300046529 Bacteria 596
181 Ga0495598_0036575 3300046537 Bacteria 1412
182 Ga0495668_0000302 3300046616 Bacteria 68079
183 Ga0495634_0149315 3300046642 Bacteria 1479
184 Ga0495661_0040590 3300046665 Bacteria 2885
185 Ga0495657_0273207 3300046675 Bacteria 1013
186 Ga0495599_0049943 3300046678 Bacteria 2622
187 Ga0495613_0308702 3300046689 Bacteria 1094
188 Ga0495600_0283253 3300046809 Bacteria 1049
189 Ga0495674_0447818 3300047319 Bacteria 1038
190 Ga0495672_0243380 3300047320 Bacteria 877
191 Ga0495683_0039590 3300047323 Bacteria 2382
192 Ga0495684_0032470 3300047471 Bacteria 4009
193 Ga0496120_0386678 3300048923 Bacteria 621
194 Ga0501034_0078854 3300049571 Bacteria 3297
195 Ga0501035_0283385 3300049822 Bacteria 1400
196 nmdc:mga0k408_9586_c1 3300050493 Bacteria 5226
197 nmdc:mga08y16_1193102_c1 3300050511 Bacteria 732
198 nmdc:mga08y16_281211_c1 3300050511 Bacteria 1716
199 Ga0500595_203333 3300053119 Unclassified 546
200 Ga0500655_106717 3300053133 Bacteria 589
201 Ga0500637_0054595 3300053178 Bacteria 2281
202 Ga0500587_030060 3300053739 Bacteria 742

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002459 JGI24751J29686_10000297 JGI24751J29686_1000029718 97
2 3300003323 rootH1_10190967 rootH1_101909673 97
3 3300005295 Ga0065707_10360659 Ga0065707_103606591 97
4 3300005327 Ga0070658_10009396 Ga0070658_100093967 97
5 3300005329 Ga0070683_100002701 Ga0070683_1000027017 97
6 3300005330 Ga0070690_100227809 Ga0070690_1002278093 97
7 3300005334 Ga0068869_100021560 Ga0068869_1000215606 97
8 3300005337 Ga0070682_100088955 Ga0070682_1000889552 97
9 3300005338 Ga0068868_101834930 Ga0068868_1018349301 97
10 3300005339 Ga0070660_100387333 Ga0070660_1003873333 97
11 3300005339 Ga0070660_100933380 Ga0070660_1009333801 97
12 3300005343 Ga0070687_100461226 Ga0070687_1004612262 97
13 3300005344 Ga0070661_100000522 Ga0070661_1000005226 97
14 3300005347 Ga0070668_100070312 Ga0070668_1000703123 97
15 3300005353 Ga0070669_100428040 Ga0070669_1004280401 97
16 3300005354 Ga0070675_101016057 Ga0070675_1010160571 97
17 3300005355 Ga0070671_100477868 Ga0070671_1004778682 97
18 3300005356 Ga0070674_100454800 Ga0070674_1004548002 97
19 3300005366 Ga0070659_100003078 Ga0070659_1000030786 97
20 3300005367 Ga0070667_100470767 Ga0070667_1004707672 97
21 3300005456 Ga0070678_100231790 Ga0070678_1002317903 97
22 3300005457 Ga0070662_100290555 Ga0070662_1002905551 97
23 3300005458 Ga0070681_10414872 Ga0070681_104148722 97
24 3300005459 Ga0068867_100529698 Ga0068867_1005296981 97
25 3300005468 Ga0070707_100710899 Ga0070707_1007108992 97
26 3300005471 Ga0070698_100015357 Ga0070698_1000153576 97
27 3300005471 Ga0070698_100116782 Ga0070698_1001167824 97
28 3300005518 Ga0070699_100332022 Ga0070699_1003320223 97
29 3300005530 Ga0070679_101439008 Ga0070679_1014390081 97
30 3300005535 Ga0070684_100013314 Ga0070684_1000133146 97
31 3300005539 Ga0068853_100078785 Ga0068853_1000787853 97
32 3300005539 Ga0068853_100363796 Ga0068853_1003637961 97
33 3300005539 Ga0068853_101462617 Ga0068853_1014626171 97
34 3300005545 Ga0070695_100254392 Ga0070695_1002543922 97
35 3300005549 Ga0070704_100615247 Ga0070704_1006152473 97
36 3300005563 Ga0068855_101044247 Ga0068855_1010442472 97
37 3300005564 Ga0070664_100006070 Ga0070664_10000607011 97
38 3300005577 Ga0068857_100009309 Ga0068857_1000093099 97
39 3300005577 Ga0068857_100042824 Ga0068857_1000428242 97
40 3300005577 Ga0068857_101064151 Ga0068857_1010641512 97
41 3300005577 Ga0068857_101261216 Ga0068857_1012612161 97
42 3300005614 Ga0068856_100022661 Ga0068856_1000226615 97
43 3300005614 Ga0068856_100025243 Ga0068856_1000252433 97
44 3300005616 Ga0068852_100104204 Ga0068852_1001042046 97
45 3300005617 Ga0068859_100939634 Ga0068859_1009396343 97
46 3300005617 Ga0068859_102076096 Ga0068859_1020760961 97
47 3300005718 Ga0068866_10143994 Ga0068866_101439942 97
48 3300005719 Ga0068861_100163863 Ga0068861_1001638633 97
49 3300005841 Ga0068863_100304024 Ga0068863_1003040242 97
50 3300005843 Ga0068860_101477125 Ga0068860_1014771251 97
51 3300005844 Ga0068862_102341014 Ga0068862_1023410141 97
52 3300006195 Ga0075366_10020412 Ga0075366_100204125 97
53 3300006195 Ga0075366_10020531 Ga0075366_100205315 97
54 3300006237 Ga0097621_100320160 Ga0097621_1003201603 97
55 3300006237 Ga0097621_100528691 Ga0097621_1005286913 97
56 3300006358 Ga0068871_100834574 Ga0068871_1008345741 97
57 3300006844 Ga0075428_101415014 Ga0075428_1014150141 97
58 3300006844 Ga0075428_102358578 Ga0075428_1023585781 97
59 3300006881 Ga0068865_100469292 Ga0068865_1004692922 97
60 3300006931 Ga0097620_100939703 Ga0097620_1009397033 97
61 3300006931 Ga0097620_101955767 Ga0097620_1019557672 97
62 3300006931 Ga0097620_102075965 Ga0097620_1020759651 97
63 3300009093 Ga0105240_10003164 Ga0105240_1000316410 97
64 3300009093 Ga0105240_10045479 Ga0105240_100454792 97
65 3300009093 Ga0105240_10297670 Ga0105240_102976703 97
66 3300009094 Ga0111539_10491131 Ga0111539_104911313 97
67 3300009094 Ga0111539_11175761 Ga0111539_111757612 97
68 3300009094 Ga0111539_12839246 Ga0111539_128392462 97
69 3300009148 Ga0105243_12108012 Ga0105243_121080122 97
70 3300009174 Ga0105241_10002036 Ga0105241_100020368 97
71 3300009174 Ga0105241_10286184 Ga0105241_102861843 97
72 3300009176 Ga0105242_10022274 Ga0105242_100222744 97
73 3300009176 Ga0105242_10637568 Ga0105242_106375681 97
74 3300009176 Ga0105242_10989887 Ga0105242_109898872 97
75 3300009176 Ga0105242_11151027 Ga0105242_111510272 97
76 3300009545 Ga0105237_10000144 Ga0105237_1000014429 97
77 3300009545 Ga0105237_10003823 Ga0105237_1000382310 97
78 3300009545 Ga0105237_10006744 Ga0105237_100067446 97
79 3300009545 Ga0105237_11916716 Ga0105237_119167161 97
80 3300009551 Ga0105238_10120168 Ga0105238_101201682 97
81 3300009551 Ga0105238_10258664 Ga0105238_102586643 97
82 3300009553 Ga0105249_10031069 Ga0105249_100310694 97
83 3300009553 Ga0105249_10193257 Ga0105249_101932572 97
84 3300009553 Ga0105249_11457425 Ga0105249_114574251 97
85 3300009553 Ga0105249_11549014 Ga0105249_115490142 97
86 3300009553 Ga0105249_12333292 Ga0105249_123332922 97
87 3300010375 Ga0105239_10000004 Ga0105239_1000000436 97
88 3300010375 Ga0105239_10016597 Ga0105239_1001659711 97
89 3300010375 Ga0105239_10121355 Ga0105239_101213553 97
90 3300010375 Ga0105239_10522886 Ga0105239_105228861 97
91 3300010375 Ga0105239_11607805 Ga0105239_116078052 97
92 3300011119 Ga0105246_10554995 Ga0105246_105549952 97
93 3300013100 Ga0157373_10069477 Ga0157373_100694773 97
94 3300013100 Ga0157373_11236322 Ga0157373_112363221 97
95 3300013102 Ga0157371_10146820 Ga0157371_101468203 97
96 3300013297 Ga0157378_10012777 Ga0157378_100127771 97
97 3300013307 Ga0157372_10098150 Ga0157372_100981502 97
98 3300013307 Ga0157372_10305859 Ga0157372_103058593 97
99 3300013307 Ga0157372_10471819 Ga0157372_104718192 97
100 3300013307 Ga0157372_12612678 Ga0157372_126126781 97
101 3300013308 Ga0157375_10890154 Ga0157375_108901542 97
102 3300013308 Ga0157375_11296850 Ga0157375_112968502 97
103 3300013308 Ga0157375_11617897 Ga0157375_116178971 97
104 3300014325 Ga0163163_10485106 Ga0163163_104851062 97
105 3300014326 Ga0157380_10086619 Ga0157380_100866194 97
106 3300014326 Ga0157380_10282338 Ga0157380_102823383 97
107 3300014326 Ga0157380_10454019 Ga0157380_104540193 97
108 3300021361 Ga0213872_10012297 Ga0213872_100122973 97
109 3300025899 Ga0207642_10602983 Ga0207642_106029832 97
110 3300025901 Ga0207688_10174066 Ga0207688_101740662 97
111 3300025904 Ga0207647_10393626 Ga0207647_103936262 97
112 3300025909 Ga0207705_10081097 Ga0207705_100810972 97
113 3300025911 Ga0207654_10002079 Ga0207654_100020796 97
114 3300025912 Ga0207707_10948635 Ga0207707_109486351 97
115 3300025913 Ga0207695_10001122 Ga0207695_1000112229 97
116 3300025913 Ga0207695_10001383 Ga0207695_100013832 97
117 3300025914 Ga0207671_10001502 Ga0207671_1000150223 97
118 3300025914 Ga0207671_10001689 Ga0207671_1000168924 97
119 3300025914 Ga0207671_10003338 Ga0207671_1000333810 97
120 3300025918 Ga0207662_10181544 Ga0207662_101815441 97
121 3300025920 Ga0207649_10006869 Ga0207649_100068693 97
122 3300025924 Ga0207694_10240604 Ga0207694_102406043 97
123 3300025924 Ga0207694_10339530 Ga0207694_103395302 97
124 3300025931 Ga0207644_10086849 Ga0207644_100868492 97
125 3300025932 Ga0207690_10031769 Ga0207690_100317693 97
126 3300025934 Ga0207686_10095752 Ga0207686_100957521 97
127 3300025934 Ga0207686_10359861 Ga0207686_103598611 97
128 3300025934 Ga0207686_10712208 Ga0207686_107122082 97
129 3300025938 Ga0207704_10473894 Ga0207704_104738942 97
130 3300025942 Ga0207689_10005296 Ga0207689_100052965 97
131 3300025944 Ga0207661_10008458 Ga0207661_100084585 97
132 3300025944 Ga0207661_10692644 Ga0207661_106926442 97
133 3300025945 Ga0207679_10000358 Ga0207679_1000035826 97
134 3300025961 Ga0207712_10054177 Ga0207712_100541773 97
135 3300025961 Ga0207712_11679562 Ga0207712_116795622 97
136 3300025972 Ga0207668_10917147 Ga0207668_109171472 97
137 3300026041 Ga0207639_10016276 Ga0207639_100162764 97
138 3300026075 Ga0207708_11081914 Ga0207708_110819142 97
139 3300026078 Ga0207702_10001487 Ga0207702_100014876 97
140 3300026078 Ga0207702_10055750 Ga0207702_100557504 97
141 3300026078 Ga0207702_10348126 Ga0207702_103481262 97
142 3300026089 Ga0207648_10748037 Ga0207648_107480371 97
143 3300026089 Ga0207648_11600296 Ga0207648_116002962 97
144 3300026116 Ga0207674_10015725 Ga0207674_100157258 97
145 3300026116 Ga0207674_11529466 Ga0207674_115294661 97
146 3300026118 Ga0207675_100036277 Ga0207675_1000362774 97
147 3300026121 Ga0207683_10376662 Ga0207683_103766622 97
148 3300026142 Ga0207698_10090889 Ga0207698_100908894 97
149 3300027395 Ga0209996_1051584 Ga0209996_10515841 97
150 3300027526 Ga0209968_1013760 Ga0209968_10137602 97
151 3300028380 Ga0268265_10270544 Ga0268265_102705442 97
152 3300028786 Ga0307517_10538213 Ga0307517_105382131 97
153 3300031456 Ga0307513_10189508 Ga0307513_101895083 97
154 3300032004 Ga0307414_10891691 Ga0307414_108916912 97
155 3300035410 Ga0373924_0015052 Ga0373924_0015052_1374_1739 97
156 3300035692 Ga0373935_0444508 Ga0373935_0444508_258_623 97
157 3300036401 Ga0373937_0161827 Ga0373937_0161827_93_386 97
158 3300036401 Ga0373937_0303770 Ga0373937_0303770_770_1135 97
159 3300039447 Ga0436361_0372406 Ga0436361_0372406_5442_5735 97
160 3300041408 Ga0439453_0099404 Ga0439453_0099404_51_344 97
161 3300041492 Ga0451835_1144140 Ga0451835_1144140_37_330 97
162 3300041496 Ga0451839_0113633 Ga0451839_0113633_194_487 97
163 3300042001 Ga0439441_174726 Ga0439441_174726_85_378 97
164 3300042003 Ga0439443_116204 Ga0439443_116204_98_391 97
165 3300042439 Ga0439464_0218154 Ga0439464_0218154_200_493 97
166 3300042461 Ga0439460_0374036 Ga0439460_0374036_174_467 97
167 3300044658 Ga0466972_0016389 Ga0466972_0016389_3233_3526 97
168 3300044735 Ga0466968_0029116 Ga0466968_0029116_1767_2060 97
169 3300044901 Ga0466960_0477451 Ga0466960_0477451_67_360 97
170 3300046454 Ga0495592_0089420 Ga0495592_0089420_1130_1495 97
171 3300046460 Ga0495638_0491971 Ga0495638_0491971_174_467 97
172 3300046507 Ga0495606_0003961 Ga0495606_0003961_2582_2875 97
173 3300046507 Ga0495606_0009411 Ga0495606_0009411_4031_4324 97
174 3300046511 Ga0495608_0280948 Ga0495608_0280948_79_444 97
175 3300046512 Ga0495610_0002268 Ga0495610_0002268_9970_10263 97
176 3300046513 Ga0495616_0095590 Ga0495616_0095590_831_1154 97
177 3300046514 Ga0495618_0055434 Ga0495618_0055434_1900_2265 97
178 3300046516 Ga0495628_0050920 Ga0495628_0050920_2200_2565 97
179 3300046517 Ga0495630_0077421 Ga0495630_0077421_1522_1887 97
180 3300046529 Ga0495652_0870883 Ga0495652_0870883_280_573 97
181 3300046537 Ga0495598_0036575 Ga0495598_0036575_562_855 97
182 3300046616 Ga0495668_0000302 Ga0495668_0000302_4252_4545 97
183 3300046642 Ga0495634_0149315 Ga0495634_0149315_222_587 97
184 3300046665 Ga0495661_0040590 Ga0495661_0040590_1218_1511 97
185 3300046675 Ga0495657_0273207 Ga0495657_0273207_531_896 97
186 3300046678 Ga0495599_0049943 Ga0495599_0049943_735_1100 97
187 3300046689 Ga0495613_0308702 Ga0495613_0308702_190_555 97
188 3300046809 Ga0495600_0283253 Ga0495600_0283253_312_677 97
189 3300047319 Ga0495674_0447818 Ga0495674_0447818_47_412 97
190 3300047320 Ga0495672_0243380 Ga0495672_0243380_267_560 97
191 3300047323 Ga0495683_0039590 Ga0495683_0039590_1897_2190 97
192 3300047471 Ga0495684_0032470 Ga0495684_0032470_994_1359 97
193 3300048923 Ga0496120_0386678 Ga0496120_0386678_16_309 97
194 3300049571 Ga0501034_0078854 Ga0501034_0078854_1184_1477 97
195 3300049822 Ga0501035_0283385 Ga0501035_0283385_62_355 97
196 3300050493 nmdc:mga0k408_9586_c1 nmdc:mga0k408_9586_c1_2216_2509 97
197 3300050511 nmdc:mga08y16_1193102_c1 nmdc:mga08y16_1193102_c1_305_598 97
198 3300050511 nmdc:mga08y16_281211_c1 nmdc:mga08y16_281211_c1_840_1133 97
199 3300053119 Ga0500595_203333 Ga0500595_203333_196_513 97
200 3300053133 Ga0500655_106717 Ga0500655_106717_22_315 97
201 3300053178 Ga0500637_0054595 Ga0500637_0054595_1814_2107 97
202 3300053739 Ga0500587_030060 Ga0500587_030060_281_574 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09907

HigB_toxin

HigB_toxin, RelE-like toxic component of a toxin-antitoxin system

43

116

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kml-assembly1.cif.gz_A 2.09 angstrom resolution crystal structure of tetrameric higba toxin-antitoxin complex from e.coli 0.9033 1 90
5ifg-assembly1.cif.gz_C crystal structure of higa-higb complex from e. coli 0.903 1 90
6kmq-assembly1.cif.gz_A 2.3 angstrom resolution structure of dimeric higba toxin-antitoxin complex from e. coli 0.8948 1 86
5ycl-assembly1.cif.gz_D crystal structure of higba complex from shigella flexneri 0.8682 1 90
6kmq-assembly1.cif.gz_A 2.3 angstrom resolution structure of dimeric higba toxin-antitoxin complex from e. coli 0.8411 1 86
ID Description Score Start End Superfamily
af_P64578_19_94_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8941 23 92 3.30.2310.20
af_A0A0P0W3X0_152_455_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8695 55 87 2.120.10.80
af_O13856_4_201_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8679 47 85 2.130.10.10
af_Q8MSW9_149_484_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8474 54 85 2.130.10.10
af_O94533_29_248_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8368 51 85 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A858R8B0-F1-model_v4 Type II toxin-antitoxin system HigB family toxin 0.9986 1 97 GO:0003723
GO:0004519
GO:0110001
AF-A0A846VE57-F1-model_v4 deleted 0.9984 1 97
AF-A0A1Q3YY08-F1-model_v4 Addiction module toxin RelE 0.997 1 97 GO:0003723
GO:0004519
GO:0110001
AF-T0IV01-F1-model_v4 Toxin RelE 0.9964 1 97 GO:0003723
GO:0004519
GO:0110001
AF-A0A317DXB4-F1-model_v4 Type II toxin-antitoxin system HigB family toxin 0.9959 1 97 GO:0003723
GO:0004519
GO:0110001

Feature Viewer

pLDDT pTM Quality
95.92 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map