F307079

General Info

Members Datasets Scaffolds Average Seq Length
200 159 400 280

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10747101|Ga0114129_107471012
Length 308
Sequence VRSYHDVICDAAWSGVRTEVVLKSAAVENGFSQFSGTKSYITDAALEAAVNAAVVLERPLLVKGEPGTGKTLLAAAVAEALGHELIHWPVKSTTRAQDGLYVYDTVQRLYDARFGDGGPEAVRDIRRYIKPGPLGKALSSLERVVLLIDEVDKADLEFPNDLLHELDRMRFVIPETGDEIVARNRPVVVITSNNEKELPDAFLRRCVFHFIDFPEPELMKRIVRVHHPLIDDSIVDQAIAAFYDVRGVPRVRKRPSTSELIDWIAVLAKSGIGEDRIRSELPFGGVLIKKEQDQGTVAEHRAGRSRRW

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
111 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
155 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9
Nodule 0
Rhizoplane 0.5
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10747101 3300009147 Bacteria 1253
2 JGI24735J21928_10065904 3300002067 Bacteria 1039
3 JGI25405J52794_10010967 3300003911 Bacteria 1731
4 Ga0070658_10014161 3300005327 Bacteria 6401
5 Ga0070683_100035291 3300005329 Bacteria 4571
6 Ga0070683_100440146 3300005329 Bacteria 1244
7 Ga0070690_100259509 3300005330 Bacteria 1232
8 Ga0070680_100005638 3300005336 Bacteria 9484
9 Ga0070682_100501479 3300005337 Bacteria 941
10 Ga0068868_100010856 3300005338 Bacteria 6609
11 Ga0068868_100274316 3300005338 Bacteria 1425
12 Ga0070689_100047688 3300005340 Bacteria 3303
13 Ga0070661_100416165 3300005344 Bacteria 1065
14 Ga0070669_100086767 3300005353 Bacteria 2339
15 Ga0070675_100278434 3300005354 Bacteria 1469
16 Ga0070671_100534230 3300005355 Bacteria 1010
17 Ga0070709_10028726 3300005434 Bacteria 3319
18 Ga0070713_100042314 3300005436 Bacteria 3717
19 Ga0070700_100405782 3300005441 Bacteria 1026
20 Ga0070708_100039932 3300005445 Bacteria 4108
21 Ga0070678_100258397 3300005456 Bacteria 1463
22 Ga0070681_10038108 3300005458 Bacteria 4820
23 Ga0070681_10335033 3300005458 Bacteria 1422
24 Ga0068867_100079921 3300005459 Bacteria 2461
25 Ga0070706_100038586 3300005467 Bacteria 4408
26 Ga0070698_100005532 3300005471 Bacteria 13804
27 Ga0070699_100178891 3300005518 Bacteria 1882
28 Ga0070679_100107657 3300005530 Bacteria 2773
29 Ga0070684_100085682 3300005535 Bacteria 2794
30 Ga0070696_100148383 3300005546 Bacteria 1719
31 Ga0070665_100008142 3300005548 Bacteria 10610
32 Ga0070665_100052942 3300005548 Bacteria 4071
33 Ga0070665_100260236 3300005548 Bacteria 1736
34 Ga0070704_100301521 3300005549 Bacteria 1335
35 Ga0068855_100031998 3300005563 Bacteria 6280
36 Ga0068855_100439306 3300005563 Bacteria 1425
37 Ga0070664_100079658 3300005564 Bacteria 2820
38 Ga0068857_100061564 3300005577 Bacteria 3334
39 Ga0068856_100164037 3300005614 Bacteria 2233
40 Ga0068863_100391148 3300005841 Bacteria 1359
41 Ga0068860_100012555 3300005843 Bacteria 8340
42 Ga0068860_100414238 3300005843 Bacteria 1335
43 Ga0081455_10019020 3300005937 Bacteria 6514
44 Ga0081455_10044329 3300005937 Bacteria 3882
45 Ga0081539_10006591 3300005985 Bacteria 11030
46 Ga0081539_10008293 3300005985 Bacteria 9105
47 Ga0075365_10084765 3300006038 Bacteria 2151
48 Ga0075362_10000622 3300006177 Bacteria 10352
49 Ga0075362_10016885 3300006177 Bacteria 2998
50 Ga0075367_10164200 3300006178 Bacteria 1381
51 Ga0075366_10013128 3300006195 Bacteria 4710
52 Ga0097621_100016183 3300006237 Bacteria 5632
53 Ga0075370_10033166 3300006353 Bacteria 2890
54 Ga0075428_100023250 3300006844 Bacteria 6856
55 Ga0075430_100084551 3300006846 Bacteria 2657
56 Ga0075430_100087649 3300006846 Bacteria 2605
57 Ga0075431_100097703 3300006847 Bacteria 3032
58 Ga0075434_100551257 3300006871 Bacteria 1172
59 Ga0075429_100226853 3300006880 Bacteria 1636
60 Ga0075435_100011646 3300007076 Bacteria 6483
61 Ga0105240_10044558 3300009093 Bacteria 5636
62 Ga0111539_10006416 3300009094 Bacteria 15164
63 Ga0111539_10038740 3300009094 Bacteria 5751
64 Ga0105247_10001138 3300009101 Bacteria 19677
65 Ga0105237_10609290 3300009545 Bacteria 1099
66 Ga0099796_10110704 3300010159 Bacteria 1045
67 Ga0105246_10611717 3300011119 Bacteria 943
68 Ga0157369_10131995 3300013105 Bacteria 2646
69 Ga0213871_10034551 3300021441 Bacteria 1333
70 Ga0207710_10001571 3300025900 Bacteria 11217
71 Ga0207645_10082129 3300025907 Bacteria 2066
72 Ga0207705_10020555 3300025909 Bacteria 4714
73 Ga0207684_10052075 3300025910 Bacteria 3474
74 Ga0207707_10009959 3300025912 Bacteria 8243
75 Ga0207695_10117000 3300025913 Bacteria 2639
76 Ga0207660_10002736 3300025917 Bacteria 11548
77 Ga0207649_10333554 3300025920 Bacteria 1118
78 Ga0207652_10021211 3300025921 Bacteria 5360
79 Ga0207646_10523583 3300025922 Bacteria 1067
80 Ga0207700_10110094 3300025928 Bacteria 2214
81 Ga0207686_10333103 3300025934 Bacteria 1138
82 Ga0207670_10005388 3300025936 Bacteria 7020
83 Ga0207670_10120281 3300025936 Bacteria 1907
84 Ga0207711_10186840 3300025941 Bacteria 1887
85 Ga0207679_10156188 3300025945 Bacteria 1863
86 Ga0207667_10010141 3300025949 Bacteria 11033
87 Ga0207667_10173451 3300025949 Bacteria 2216
88 Ga0207677_10006714 3300026023 Bacteria 6323
89 Ga0207702_10011879 3300026078 Bacteria 7250
90 Ga0207702_10158396 3300026078 Bacteria 2066
91 Ga0207702_10416167 3300026078 Bacteria 1299
92 Ga0207641_10435777 3300026088 Bacteria 1264
93 Ga0207683_10058003 3300026121 Bacteria 3399
94 Ga0209588_1069703 3300027671 Bacteria 1136
95 Ga0209974_10117811 3300027876 Bacteria 939
96 Ga0207428_10017408 3300027907 Bacteria 6169
97 Ga0268266_10020905 3300028379 Bacteria 5579
98 Ga0268264_10020007 3300028381 Bacteria 5468
99 Ga0265337_1001855 3300028556 Bacteria 10099
100 Ga0265334_10039668 3300028573 Bacteria 1847
101 Ga0265320_10002467 3300031240 Bacteria 12874
102 Ga0265331_10025429 3300031250 Bacteria 2989
103 Ga0307509_10051586 3300031507 Bacteria 4397
104 Ga0307514_10218122 3300031649 Bacteria 1174
105 Ga0265342_10100405 3300031712 Bacteria 1649
106 Ga0316576_10133763 3300031727 Bacteria 1866
107 Ga0316576_10283584 3300031727 Bacteria 1240
108 Ga0307406_10041951 3300031901 Bacteria 2854
109 Ga0307412_10044864 3300031911 Bacteria 2886
110 Ga0307411_10555946 3300032005 Bacteria 980
111 Ga0307415_100135158 3300032126 Bacteria 1874
112 Ga0307415_100439485 3300032126 Bacteria 1125
113 Ga0316593_10068833 3300032168 Bacteria 1222
114 Ga0373941_0088809 3300035115 Bacteria 1057
115 Ga0373943_0034853 3300035170 Bacteria 2403
116 Ga0316574_0037213 3300035398 Bacteria 2983
117 Ga0316574_0045689 3300035398 Bacteria 2713
118 Ga0373931_0023110 3300035691 Bacteria 3137
119 Ga0373927_0095588 3300035695 Bacteria 1931
120 Ga0373927_0146721 3300035695 Bacteria 1545
121 Ga0373933_0103321 3300035724 Bacteria 1770
122 Ga0373933_0119048 3300035724 Bacteria 1653
123 Ga0373947_0106574 3300035725 Bacteria 1767
124 Ga0373937_0085499 3300036401 Bacteria 2919
125 Ga0316584_0297065 3300036712 Bacteria 1170
126 Ga0373925_0154496 3300037068 Bacteria 1804
127 Ga0373925_0242629 3300037068 Bacteria 1443
128 Ga0373925_0558569 3300037068 Bacteria 942
129 Ga0395899_0010634 3300037312 Bacteria 7052
130 Ga0395900_0007918 3300037418 Bacteria 10941
131 Ga0395900_0015781 3300037418 Bacteria 7701
132 Ga0395900_0202866 3300037418 Bacteria 2005
133 Ga0395898_0015169 3300037466 Bacteria 7909
134 Ga0395898_0070774 3300037466 Bacteria 3371
135 Ga0395901_0008765 3300038443 Bacteria 10233
136 Ga0395901_0024341 3300038443 Bacteria 6213
137 Ga0395901_0037182 3300038443 Bacteria 5035
138 Ga0395901_0111762 3300038443 Bacteria 2869
139 Ga0400484_31968 3300038725 Bacteria 5541
140 Ga0400490_50633 3300038726 Bacteria 48494
141 Ga0436365_0557903 3300039437 Bacteria 1314
142 Ga0436360_0384824 3300039438 Bacteria 12212
143 Ga0436360_0585352 3300039438 Bacteria 1250
144 Ga0436361_0156340 3300039447 Bacteria 1230
145 Ga0439461_0028012 3300041410 Bacteria 1159
146 Ga0439448_0006980 3300042005 Bacteria 3258
147 Ga0439446_0069571 3300042156 Bacteria 1075
148 Ga0439460_0002008 3300042461 Bacteria 4873
149 Ga0451577_0402675 3300042876 Bacteria 1242
150 Ga0466963_0019058 3300044694 Bacteria 4297
151 Ga0453684_0019642 3300044712 Bacteria 10267
152 Ga0453684_0060254 3300044712 Bacteria 4884
153 Ga0453684_0455232 3300044712 Bacteria 1424
154 Ga0466967_0084117 3300045976 Bacteria 2878
155 Ga0495598_0059337 3300046537 Bacteria 1176
156 Ga0495622_0041165 3300046557 Bacteria 2149
157 Ga0495667_0255398 3300046559 Bacteria 1115
158 Ga0495636_0001851 3300047318 Bacteria 8097
159 Ga0495615_0010849 3300048090 Bacteria 1834
160 Ga0496100_0264138 3300048903 Bacteria 1277
161 Ga0496126_0031307 3300048929 Bacteria 5029
162 Ga0501034_0002005 3300049571 Bacteria 25731
163 Ga0501043_0264886 3300049579 Bacteria 1321
164 Ga0501047_0038150 3300049581 Bacteria 4647
165 Ga0501047_0198721 3300049581 Bacteria 1866
166 Ga0501067_0005721 3300049583 Bacteria 6899
167 Ga0501068_0001855 3300049584 Bacteria 11222
168 Ga0501070_0054475 3300049586 Bacteria 3317
169 Ga0501072_0000244 3300049588 Bacteria 39999
170 Ga0501073_0014570 3300049589 Bacteria 5712
171 Ga0501076_0098491 3300049592 Bacteria 2355
172 Ga0501077_0009064 3300049593 Bacteria 6177
173 Ga0501079_0059116 3300049741 Bacteria 2957
174 Ga0501083_0044331 3300049744 Bacteria 3011
175 Ga0501083_0049555 3300049744 Bacteria 2830
176 Ga0501035_0002826 3300049822 Bacteria 16792
177 Ga0501044_0096342 3300049823 Bacteria 2980
178 nmdc:mga03683_10132_c1 3300050489 Bacteria 3373
179 nmdc:mga03683_2431_c1 3300050489 Bacteria 5782
180 nmdc:mga0yw44_46461_c1 3300050492 Bacteria 2607
181 nmdc:mga0k408_5160_c1 3300050493 Bacteria 6924
182 nmdc:mga06z11_137168_c1 3300050494 Bacteria 1379
183 nmdc:mga06z11_159757_c1 3300050494 Bacteria 1287
184 nmdc:mga06z11_88249_c1 3300050494 Bacteria 1679
185 nmdc:mga07m45_104173_c1 3300050496 Bacteria 1631
186 nmdc:mga07m45_15263_c1 3300050496 Bacteria 4101
187 nmdc:mga09592_45266_c1 3300050508 Bacteria 1647
188 nmdc:mga0qj67_137299_c1 3300050509 Bacteria 1981
189 nmdc:mga0qj67_66357_c1 3300050509 Bacteria 2874
190 nmdc:mga06r32_168076_c1 3300050510 Bacteria 2176
191 nmdc:mga06r32_657412_c1 3300050510 Bacteria 1016
192 nmdc:mga08y16_4110_c1 3300050511 Bacteria 15185
193 nmdc:mga0a205_473479_c1 3300050515 Bacteria 1111
194 nmdc:mga0sz30_1413_c1 3300050516 Bacteria 8581
195 Ga0500641_0001346 3300053096 Bacteria 8739
196 Ga0500616_0018428 3300053153 Bacteria 3947
197 Ga0501084_0000394 3300054114 Bacteria 33494
198 Ga0501082_0000059 3300060353 Bacteria 78018
199 Ga0530510_0005459 3300061734 Bacteria 8799
200 Ga0530510_0299127 3300061734 Bacteria 1204
201 Ga0114129_10747101
202 JGI24735J21928_10065904
203 JGI25405J52794_10010967
204 Ga0070658_10014161
205 Ga0070683_100035291
206 Ga0070683_100440146
207 Ga0070690_100259509
208 Ga0070680_100005638
209 Ga0070682_100501479
210 Ga0068868_100010856
211 Ga0068868_100274316
212 Ga0070689_100047688
213 Ga0070661_100416165
214 Ga0070669_100086767
215 Ga0070675_100278434
216 Ga0070671_100534230
217 Ga0070709_10028726
218 Ga0070713_100042314
219 Ga0070700_100405782
220 Ga0070708_100039932
221 Ga0070678_100258397
222 Ga0070681_10038108
223 Ga0070681_10335033
224 Ga0068867_100079921
225 Ga0070706_100038586
226 Ga0070698_100005532
227 Ga0070699_100178891
228 Ga0070679_100107657
229 Ga0070684_100085682
230 Ga0070696_100148383
231 Ga0070665_100008142
232 Ga0070665_100052942
233 Ga0070665_100260236
234 Ga0070704_100301521
235 Ga0068855_100031998
236 Ga0068855_100439306
237 Ga0070664_100079658
238 Ga0068857_100061564
239 Ga0068856_100164037
240 Ga0068863_100391148
241 Ga0068860_100012555
242 Ga0068860_100414238
243 Ga0081455_10019020
244 Ga0081455_10044329
245 Ga0081539_10006591
246 Ga0081539_10008293
247 Ga0075365_10084765
248 Ga0075362_10000622
249 Ga0075362_10016885
250 Ga0075367_10164200
251 Ga0075366_10013128
252 Ga0097621_100016183
253 Ga0075370_10033166
254 Ga0075428_100023250
255 Ga0075430_100084551
256 Ga0075430_100087649
257 Ga0075431_100097703
258 Ga0075434_100551257
259 Ga0075429_100226853
260 Ga0075435_100011646
261 Ga0105240_10044558
262 Ga0111539_10006416
263 Ga0111539_10038740
264 Ga0105247_10001138
265 Ga0105237_10609290
266 Ga0099796_10110704
267 Ga0105246_10611717
268 Ga0157369_10131995
269 Ga0213871_10034551
270 Ga0207710_10001571
271 Ga0207645_10082129
272 Ga0207705_10020555
273 Ga0207684_10052075
274 Ga0207707_10009959
275 Ga0207695_10117000
276 Ga0207660_10002736
277 Ga0207649_10333554
278 Ga0207652_10021211
279 Ga0207646_10523583
280 Ga0207700_10110094
281 Ga0207686_10333103
282 Ga0207670_10005388
283 Ga0207670_10120281
284 Ga0207711_10186840
285 Ga0207679_10156188
286 Ga0207667_10010141
287 Ga0207667_10173451
288 Ga0207677_10006714
289 Ga0207702_10011879
290 Ga0207702_10158396
291 Ga0207702_10416167
292 Ga0207641_10435777
293 Ga0207683_10058003
294 Ga0209588_1069703
295 Ga0209974_10117811
296 Ga0207428_10017408
297 Ga0268266_10020905
298 Ga0268264_10020007
299 Ga0265337_1001855
300 Ga0265334_10039668
301 Ga0265320_10002467
302 Ga0265331_10025429
303 Ga0307509_10051586
304 Ga0307514_10218122
305 Ga0265342_10100405
306 Ga0316576_10133763
307 Ga0316576_10283584
308 Ga0307406_10041951
309 Ga0307412_10044864
310 Ga0307411_10555946
311 Ga0307415_100135158
312 Ga0307415_100439485
313 Ga0316593_10068833
314 Ga0373941_0088809
315 Ga0373943_0034853
316 Ga0316574_0037213
317 Ga0316574_0045689
318 Ga0373931_0023110
319 Ga0373927_0095588
320 Ga0373927_0146721
321 Ga0373933_0103321
322 Ga0373933_0119048
323 Ga0373947_0106574
324 Ga0373937_0085499
325 Ga0316584_0297065
326 Ga0373925_0154496
327 Ga0373925_0242629
328 Ga0373925_0558569
329 Ga0395899_0010634
330 Ga0395900_0007918
331 Ga0395900_0015781
332 Ga0395900_0202866
333 Ga0395898_0015169
334 Ga0395898_0070774
335 Ga0395901_0008765
336 Ga0395901_0024341
337 Ga0395901_0037182
338 Ga0395901_0111762
339 Ga0400484_31968
340 Ga0400490_50633
341 Ga0436365_0557903
342 Ga0436360_0384824
343 Ga0436360_0585352
344 Ga0436361_0156340
345 Ga0439461_0028012
346 Ga0439448_0006980
347 Ga0439446_0069571
348 Ga0439460_0002008
349 Ga0451577_0402675
350 Ga0466963_0019058
351 Ga0453684_0019642
352 Ga0453684_0060254
353 Ga0453684_0455232
354 Ga0466967_0084117
355 Ga0495598_0059337
356 Ga0495622_0041165
357 Ga0495667_0255398
358 Ga0495636_0001851
359 Ga0495615_0010849
360 Ga0496100_0264138
361 Ga0496126_0031307
362 Ga0501034_0002005
363 Ga0501043_0264886
364 Ga0501047_0038150
365 Ga0501047_0198721
366 Ga0501067_0005721
367 Ga0501068_0001855
368 Ga0501070_0054475
369 Ga0501072_0000244
370 Ga0501073_0014570
371 Ga0501076_0098491
372 Ga0501077_0009064
373 Ga0501079_0059116
374 Ga0501083_0044331
375 Ga0501083_0049555
376 Ga0501035_0002826
377 Ga0501044_0096342
378 nmdc:mga03683_10132_c1
379 nmdc:mga03683_2431_c1
380 nmdc:mga0yw44_46461_c1
381 nmdc:mga0k408_5160_c1
382 nmdc:mga06z11_137168_c1
383 nmdc:mga06z11_159757_c1
384 nmdc:mga06z11_88249_c1
385 nmdc:mga07m45_104173_c1
386 nmdc:mga07m45_15263_c1
387 nmdc:mga09592_45266_c1
388 nmdc:mga0qj67_137299_c1
389 nmdc:mga0qj67_66357_c1
390 nmdc:mga06r32_168076_c1
391 nmdc:mga06r32_657412_c1
392 nmdc:mga08y16_4110_c1
393 nmdc:mga0a205_473479_c1
394 nmdc:mga0sz30_1413_c1
395 Ga0500641_0001346
396 Ga0500616_0018428
397 Ga0501084_0000394
398 Ga0501082_0000059
399 Ga0530510_0005459
400 Ga0530510_0299127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07728

AAA_5

AAA domain (dynein-related subfamily)

59

206

0.84

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

60

214

0.8

PF13401

AAA_22

AAA domain

56

190

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c3c-assembly1.cif.gz_B structural characterization of a newly identified component of alpha-carboxysomes: the aaa+ domain protein cso-cbbq 0.7801 5 270
5c3c-assembly1.cif.gz_A structural characterization of a newly identified component of alpha-carboxysomes: the aaa+ domain protein cso-cbbq 0.7779 5 275
6l1q-assembly1.cif.gz_C crystal structure of afcbbq2, a moxr aaa+-atpase and cbbqo-type rubisco activase from acidithiobacillus ferrooxidans 0.7745 4 275
5c3c-assembly1.cif.gz_A structural characterization of a newly identified component of alpha-carboxysomes: the aaa+ domain protein cso-cbbq 0.7689 5 275
5c3c-assembly1.cif.gz_B structural characterization of a newly identified component of alpha-carboxysomes: the aaa+ domain protein cso-cbbq 0.76 5 270
ID Description Score Start End Superfamily
af_P71922_29_212_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8656 17 189 3.40.50.300
af_O53705_22_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8404 17 189 3.40.50.300
af_P71922_29_212_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8135 17 189 3.40.50.300
af_P33348_59_238_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8 9 188 3.40.50.300
af_P33348_59_238_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7921 9 188 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A524KEE6-F1-model_v4 MoxR family ATPase 0.9651 1 190 GO:0005524
GO:0016887
AF-A0A1G6T0A3-F1-model_v4 MoxR-like ATPase 0.9645 2 279 GO:0005524
GO:0016887
AF-A0A7X9DGX9-F1-model_v4 MoxR family ATPase 0.9645 2 241 GO:0005524
GO:0016887
AF-A0A1Q9MRX4-F1-model_v4 ATPase AAA 0.9641 2 267 GO:0005524
GO:0016887
AF-A0A257PC20-F1-model_v4 AAA+ ATPase domain-containing protein 0.9629 2 176 GO:0005524
GO:0016887

Map