F305832
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 199 | 148 | 398 | 367 |
Family's Representative Sequence
| Representative Sequence | 3300021361|Ga0213872_10014312|Ga0213872_100143123 |
| Length | 407 |
| Sequence | MAKCARRDFGVSRLSIAHRFETRYLRLMDETLHPALLPHGLRDILPPDARIEADTVERLMAILGQHGYDRVKPPLVEFESSLLDGPGVAMANETFRLMDPISHRMIAIRADMTLQIARIATARLVKSPRPLRLSYAGQVLRVRGSQLRPERQVGQVGAELIGSAAPEADAEVIALAAEALTAVGVPGLSVDLTLPVLVPSVLXXXXVEGKAAEQLRAALDRKDAAAIAEIGGPSAAILGALMAAAGPXDRAAEAQVAALTEIVRLIRTKAPELMLTIDPVENRGFEYHTGVSFTIFGRNIRGELGRGGRYVAGGHQAETGYARHQPADPQPSTGFTLYTDTLLRSLVFGPQPPRVLLPLGVEPAVGAKLRVEGWVTLAGLEAVADPAAEARRLQCSHVLVDGAPVPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 22 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 23 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 24 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 34 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 37 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 38 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 39 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 40 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 42 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 65 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 66 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 67 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 68 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 69 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 70 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 71 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 72 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 73 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 74 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 75 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 76 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 77 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 78 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 79 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 80 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 81 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 82 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 83 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 84 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 85 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 86 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 87 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 88 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 89 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 90 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 91 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 92 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 99 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 100 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 101 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 102 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 103 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 104 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 105 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 106 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 107 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 108 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 113 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 128 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 129 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 130 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 131 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 132 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 133 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 134 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 135 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 136 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 137 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 138 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 140 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 142 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 143 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 144 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 145 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 146 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 147 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 148 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.98 |
| Metatranscriptomes | 0 |
| Isolates | 4.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.07 |
| Nodule | 0.5 |
| Rhizoplane | 1.01 |
| Rhizosphere | 77.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0213872_10014312 | 3300021361 | Bacteria | 3703 |
| 2 | JGI25151J46595_10000395 | 3300003187 | Bacteria | 45318 |
| 3 | JGI25153J46596_10000105 | 3300003215 | Bacteria | 95783 |
| 4 | JGI25160J50197_1022117 | 3300003354 | Bacteria | 1871 |
| 5 | Ga0070670_100148832 | 3300005331 | Bacteria | 2026 |
| 6 | Ga0070680_100007238 | 3300005336 | Bacteria | 8459 |
| 7 | Ga0070675_100093867 | 3300005354 | Bacteria | 2517 |
| 8 | Ga0070709_10165086 | 3300005434 | Bacteria | 1543 |
| 9 | Ga0070714_100002005 | 3300005435 | Bacteria | 14893 |
| 10 | Ga0070714_100042723 | 3300005435 | Bacteria | 3831 |
| 11 | Ga0070714_100112921 | 3300005435 | Bacteria | 2408 |
| 12 | Ga0070713_100218556 | 3300005436 | Bacteria | 1728 |
| 13 | Ga0070710_10002553 | 3300005437 | Bacteria | 8639 |
| 14 | Ga0070711_100064974 | 3300005439 | Bacteria | 2550 |
| 15 | Ga0070681_10030542 | 3300005458 | Bacteria | 5406 |
| 16 | Ga0070681_10082712 | 3300005458 | Bacteria | 3165 |
| 17 | Ga0070681_10247995 | 3300005458 | Bacteria | 1693 |
| 18 | Ga0070706_100007314 | 3300005467 | Bacteria | 10360 |
| 19 | Ga0070698_100001199 | 3300005471 | Bacteria | 28742 |
| 20 | Ga0070698_100007929 | 3300005471 | Bacteria | 11493 |
| 21 | Ga0070699_100005231 | 3300005518 | Bacteria | 11397 |
| 22 | Ga0070679_100001462 | 3300005530 | Bacteria | 20930 |
| 23 | Ga0070679_100062801 | 3300005530 | Bacteria | 3703 |
| 24 | Ga0070697_100046960 | 3300005536 | Bacteria | 3501 |
| 25 | Ga0070697_100083418 | 3300005536 | Bacteria | 2636 |
| 26 | Ga0068853_100125025 | 3300005539 | Bacteria | 2297 |
| 27 | Ga0070696_100017610 | 3300005546 | Bacteria | 4823 |
| 28 | Ga0068862_100101464 | 3300005844 | Bacteria | 2517 |
| 29 | Ga0081538_10009466 | 3300005981 | Bacteria | 8129 |
| 30 | Ga0081540_1013956 | 3300005983 | Bacteria | 5185 |
| 31 | Ga0070717_10000766 | 3300006028 | Bacteria | 21005 |
| 32 | Ga0070717_10041875 | 3300006028 | Bacteria | 3735 |
| 33 | Ga0070717_10152176 | 3300006028 | Bacteria | 2002 |
| 34 | Ga0070716_100056997 | 3300006173 | Bacteria | 2243 |
| 35 | Ga0070712_100004358 | 3300006175 | Bacteria | 8727 |
| 36 | Ga0070712_100013543 | 3300006175 | Bacteria | 5213 |
| 37 | Ga0070712_100102253 | 3300006175 | Bacteria | 2122 |
| 38 | Ga0099795_10020937 | 3300007788 | Bacteria | 2138 |
| 39 | Ga0105240_10138776 | 3300009093 | Bacteria | 2909 |
| 40 | Ga0111539_10000605 | 3300009094 | Bacteria | 46403 |
| 41 | Ga0114129_10036026 | 3300009147 | Bacteria | 6989 |
| 42 | Ga0105248_10368270 | 3300009177 | Bacteria | 1618 |
| 43 | Ga0105237_10386526 | 3300009545 | Bacteria | 1404 |
| 44 | Ga0099796_10006326 | 3300010159 | Bacteria | 3022 |
| 45 | Ga0157370_10006453 | 3300013104 | Bacteria | 12941 |
| 46 | Ga0157375_10231311 | 3300013308 | Bacteria | 2008 |
| 47 | Ga0213875_10000134 | 3300021388 | Bacteria | 82367 |
| 48 | Ga0213875_10000759 | 3300021388 | Bacteria | 24322 |
| 49 | Ga0213875_10000996 | 3300021388 | Bacteria | 20184 |
| 50 | Ga0213871_10036284 | 3300021441 | Bacteria | 1307 |
| 51 | Ga0209148_1000478 | 3300025254 | Bacteria | 42159 |
| 52 | Ga0209455_1002458 | 3300025272 | Bacteria | 7152 |
| 53 | Ga0209130_1001770 | 3300025284 | Bacteria | 12774 |
| 54 | Ga0209675_1005782 | 3300025291 | Bacteria | 5095 |
| 55 | Ga0209676_1003103 | 3300025292 | Bacteria | 10684 |
| 56 | Ga0209025_1000821 | 3300025294 | Bacteria | 49593 |
| 57 | Ga0209758_1000279 | 3300025297 | Bacteria | 101326 |
| 58 | Ga0209758_1008844 | 3300025297 | Bacteria | 6409 |
| 59 | Ga0207426_1001453 | 3300025302 | Bacteria | 19599 |
| 60 | Ga0209257_1001009 | 3300025304 | Bacteria | 38044 |
| 61 | Ga0207692_10012254 | 3300025898 | Bacteria | 3677 |
| 62 | Ga0207699_10013033 | 3300025906 | Bacteria | 4242 |
| 63 | Ga0207699_10173572 | 3300025906 | Bacteria | 1444 |
| 64 | Ga0207684_10056084 | 3300025910 | Bacteria | 3342 |
| 65 | Ga0207707_10045482 | 3300025912 | Bacteria | 3825 |
| 66 | Ga0207707_10091284 | 3300025912 | Bacteria | 2662 |
| 67 | Ga0207707_10144086 | 3300025912 | Bacteria | 2082 |
| 68 | Ga0207707_10188424 | 3300025912 | Bacteria | 1800 |
| 69 | Ga0207671_10270273 | 3300025914 | Bacteria | 1339 |
| 70 | Ga0207693_10001602 | 3300025915 | Bacteria | 20022 |
| 71 | Ga0207693_10036277 | 3300025915 | Bacteria | 3886 |
| 72 | Ga0207693_10051784 | 3300025915 | Bacteria | 3220 |
| 73 | Ga0207693_10079612 | 3300025915 | Bacteria | 2565 |
| 74 | Ga0207663_10023399 | 3300025916 | Bacteria | 3544 |
| 75 | Ga0207663_10056894 | 3300025916 | Bacteria | 2462 |
| 76 | Ga0207660_10103140 | 3300025917 | Bacteria | 2133 |
| 77 | Ga0207652_10130751 | 3300025921 | Bacteria | 2239 |
| 78 | Ga0207659_10097487 | 3300025926 | Bacteria | 2209 |
| 79 | Ga0207700_10019060 | 3300025928 | Bacteria | 4627 |
| 80 | Ga0207664_10006693 | 3300025929 | Bacteria | 7951 |
| 81 | Ga0207644_10014888 | 3300025931 | Bacteria | 5214 |
| 82 | Ga0207644_10037097 | 3300025931 | Bacteria | 3427 |
| 83 | Ga0207679_10245729 | 3300025945 | Bacteria | 1519 |
| 84 | Ga0207639_10100546 | 3300026041 | Bacteria | 2336 |
| 85 | Ga0207641_10437021 | 3300026088 | Bacteria | 1263 |
| 86 | Ga0209179_1007853 | 3300027512 | Bacteria | 1777 |
| 87 | Ga0207428_10000107 | 3300027907 | Bacteria | 115442 |
| 88 | Ga0265332_10057864 | 3300031238 | Bacteria | 1660 |
| 89 | Ga0265320_10001167 | 3300031240 | Bacteria | 19330 |
| 90 | Ga0265327_10000657 | 3300031251 | Bacteria | 55516 |
| 91 | Ga0265314_10031166 | 3300031711 | Bacteria | 3940 |
| 92 | Ga0265314_10055250 | 3300031711 | Bacteria | 2743 |
| 93 | Ga0307413_10007260 | 3300031824 | Bacteria | 5130 |
| 94 | Ga0307411_10044540 | 3300032005 | Bacteria | 2847 |
| 95 | Ga0373945_0002921 | 3300035116 | Bacteria | 5372 |
| 96 | Ga0373956_0019265 | 3300035119 | Bacteria | 2893 |
| 97 | Ga0373957_0015757 | 3300035120 | Bacteria | 2607 |
| 98 | Ga0373927_0119581 | 3300035695 | Bacteria | 1719 |
| 99 | Ga0373933_0019043 | 3300035724 | Bacteria | 3869 |
| 100 | Ga0373947_0036274 | 3300035725 | Bacteria | 2923 |
| 101 | Ga0373937_0046257 | 3300036401 | Bacteria | 3979 |
| 102 | Ga0373937_0141709 | 3300036401 | Bacteria | 2249 |
| 103 | Ga0373925_0010030 | 3300037068 | Bacteria | 6880 |
| 104 | Ga0373925_0097847 | 3300037068 | Bacteria | 2251 |
| 105 | Ga0395899_0009543 | 3300037312 | Bacteria | 7449 |
| 106 | Ga0395898_0009455 | 3300037466 | Bacteria | 10239 |
| 107 | Ga0436364_0730168 | 3300037853 | Bacteria | 28599 |
| 108 | Ga0436364_1149423 | 3300037853 | Bacteria | 148108 |
| 109 | Ga0436364_1320883 | 3300037853 | Bacteria | 111220 |
| 110 | Ga0395901_0059656 | 3300038443 | Bacteria | 3969 |
| 111 | Ga0395901_0359771 | 3300038443 | Bacteria | 1501 |
| 112 | Ga0436365_0114190 | 3300039437 | Bacteria | 1659 |
| 113 | Ga0436365_1711468 | 3300039437 | Bacteria | 2337 |
| 114 | Ga0436365_1921978 | 3300039437 | Bacteria | 1778 |
| 115 | Ga0436360_0490339 | 3300039438 | Bacteria | 1402 |
| 116 | Ga0436360_1026760 | 3300039438 | Bacteria | 1601 |
| 117 | Ga0436360_1132142 | 3300039438 | Bacteria | 3757 |
| 118 | Ga0436361_0257664 | 3300039447 | Bacteria | 7083 |
| 119 | Ga0436361_0953635 | 3300039447 | Bacteria | 3294 |
| 120 | Ga0436361_1017687 | 3300039447 | Bacteria | 2427 |
| 121 | Ga0436363_1079365 | 3300039450 | Bacteria | 8138 |
| 122 | Ga0436363_1486733 | 3300039450 | Bacteria | 3906 |
| 123 | Ga0436362_0258673 | 3300039453 | Bacteria | 3148 |
| 124 | Ga0450907_011226 | 3300042146 | Bacteria | 1488 |
| 125 | Ga0451577_0224532 | 3300042876 | Bacteria | 1698 |
| 126 | Ga0453684_0118839 | 3300044712 | Bacteria | 3196 |
| 127 | Ga0451576_0000636 | 3300045051 | Bacteria | 72954 |
| 128 | Ga0451576_0060624 | 3300045051 | Bacteria | 3947 |
| 129 | Ga0495580_0037949 | 3300046472 | Bacteria | 3454 |
| 130 | Ga0495610_0008664 | 3300046512 | Bacteria | 6552 |
| 131 | Ga0495640_0139274 | 3300046533 | Bacteria | 1565 |
| 132 | Ga0495586_0020232 | 3300046535 | Bacteria | 3545 |
| 133 | Ga0495586_0038162 | 3300046535 | Bacteria | 2579 |
| 134 | Ga0495680_0232526 | 3300047322 | Bacteria | 1312 |
| 135 | Ga0495684_0236269 | 3300047471 | Bacteria | 1335 |
| 136 | Ga0496112_0165429 | 3300048915 | Bacteria | 2178 |
| 137 | Ga0496113_0074512 | 3300048916 | Bacteria | 2588 |
| 138 | Ga0501031_0074392 | 3300049568 | Bacteria | 2212 |
| 139 | Ga0501032_0012092 | 3300049569 | Bacteria | 6179 |
| 140 | Ga0501033_0006409 | 3300049570 | Bacteria | 9215 |
| 141 | Ga0501033_0054168 | 3300049570 | Bacteria | 2969 |
| 142 | Ga0501034_0037957 | 3300049571 | Bacteria | 4878 |
| 143 | Ga0501034_0073941 | 3300049571 | Bacteria | 3417 |
| 144 | Ga0501036_0032649 | 3300049572 | Bacteria | 4400 |
| 145 | Ga0501036_0260223 | 3300049572 | Bacteria | 1454 |
| 146 | Ga0501037_0005851 | 3300049573 | Bacteria | 8981 |
| 147 | Ga0501038_0057425 | 3300049574 | Bacteria | 3342 |
| 148 | Ga0501038_0304345 | 3300049574 | Bacteria | 1250 |
| 149 | Ga0501039_0008490 | 3300049575 | Bacteria | 7832 |
| 150 | Ga0501042_0166156 | 3300049578 | Bacteria | 1592 |
| 151 | Ga0501043_0010496 | 3300049579 | Bacteria | 7254 |
| 152 | Ga0501046_0001587 | 3300049580 | Bacteria | 21740 |
| 153 | Ga0501046_0152792 | 3300049580 | Bacteria | 1741 |
| 154 | Ga0501067_0010851 | 3300049583 | Bacteria | 5042 |
| 155 | Ga0501069_0001129 | 3300049585 | Bacteria | 12885 |
| 156 | Ga0501071_0119150 | 3300049587 | Bacteria | 1956 |
| 157 | Ga0501072_0025627 | 3300049588 | Bacteria | 4594 |
| 158 | Ga0501072_0056335 | 3300049588 | Bacteria | 3098 |
| 159 | Ga0501073_0000996 | 3300049589 | Bacteria | 20447 |
| 160 | Ga0501073_0003588 | 3300049589 | Bacteria | 11672 |
| 161 | Ga0501073_0007851 | 3300049589 | Bacteria | 7920 |
| 162 | Ga0501074_0001724 | 3300049590 | Bacteria | 14933 |
| 163 | Ga0501079_0056828 | 3300049741 | Bacteria | 3020 |
| 164 | Ga0501080_0013733 | 3300049742 | Bacteria | 7456 |
| 165 | Ga0501083_0001785 | 3300049744 | Bacteria | 14704 |
| 166 | Ga0501035_0000484 | 3300049822 | Bacteria | 44772 |
| 167 | Ga0501044_0014611 | 3300049823 | Bacteria | 8466 |
| 168 | Ga0501044_0031851 | 3300049823 | Bacteria | 5546 |
| 169 | nmdc:mga05p37_50614_c1 | 3300050507 | Bacteria | 5109 |
| 170 | nmdc:mga08y16_815_c1 | 3300050511 | Bacteria | 29853 |
| 171 | nmdc:mga08x19_35137_c1 | 3300050514 | Bacteria | 3170 |
| 172 | Ga0495601_0003785 | 3300053077 | Bacteria | 8709 |
| 173 | Ga0495619_0006663 | 3300053085 | Bacteria | 7307 |
| 174 | Ga0500578_0118753 | 3300053086 | Bacteria | 1663 |
| 175 | Ga0500646_0010063 | 3300053090 | Bacteria | 2423 |
| 176 | Ga0500566_0049047 | 3300053094 | Bacteria | 2419 |
| 177 | Ga0500641_0000853 | 3300053096 | Bacteria | 10918 |
| 178 | Ga0500595_003219 | 3300053119 | Bacteria | 7711 |
| 179 | Ga0500642_0010595 | 3300053130 | Bacteria | 3258 |
| 180 | Ga0500568_0021080 | 3300053139 | Bacteria | 2809 |
| 181 | Ga0500588_0005878 | 3300053146 | Bacteria | 2748 |
| 182 | Ga0500588_0006081 | 3300053146 | Bacteria | 2713 |
| 183 | Ga0500604_0007714 | 3300053151 | Bacteria | 2851 |
| 184 | Ga0500604_0010028 | 3300053151 | Bacteria | 2529 |
| 185 | Ga0500616_0002139 | 3300053153 | Bacteria | 17096 |
| 186 | Ga0500609_000725 | 3300053731 | Bacteria | 4962 |
| 187 | Ga0501084_0002039 | 3300054114 | Bacteria | 16134 |
| 188 | Ga0501084_0057359 | 3300054114 | Bacteria | 3259 |
| 189 | Ga0590075_003332 | 3300059424 | Bacteria | 3827 |
| 190 | Ga0501082_0001669 | 3300060353 | Bacteria | 19564 |
| 191 | Ga0501082_0006249 | 3300060353 | Bacteria | 10339 |
| 192 | 2524611013 | 2524023250 | Bacteria | 5457705 |
| 193 | 2821446905 | 2821443989 | Bacteria | 7658172 |
| 194 | 2842336394 | 2842333319 | Bacteria | 8899485 |
| 195 | 2844538310 | 2844533157 | Bacteria | 7517899 |
| 196 | 2883577865 | 2883577096 | Bacteria | 4709178 |
| 197 | 2894776586 | 2894772417 | Bacteria | 5305674 |
| 198 | 2929205071 | 2929199973 | Bacteria | 7260745 |
| 199 | 8055912995 | 8055909800 | Bacteria | 7278581 |
| 200 | Ga0213872_10014312 | |||
| 201 | JGI25151J46595_10000395 | |||
| 202 | JGI25153J46596_10000105 | |||
| 203 | JGI25160J50197_1022117 | |||
| 204 | Ga0070670_100148832 | |||
| 205 | Ga0070680_100007238 | |||
| 206 | Ga0070675_100093867 | |||
| 207 | Ga0070709_10165086 | |||
| 208 | Ga0070714_100002005 | |||
| 209 | Ga0070714_100042723 | |||
| 210 | Ga0070714_100112921 | |||
| 211 | Ga0070713_100218556 | |||
| 212 | Ga0070710_10002553 | |||
| 213 | Ga0070711_100064974 | |||
| 214 | Ga0070681_10030542 | |||
| 215 | Ga0070681_10082712 | |||
| 216 | Ga0070681_10247995 | |||
| 217 | Ga0070706_100007314 | |||
| 218 | Ga0070698_100001199 | |||
| 219 | Ga0070698_100007929 | |||
| 220 | Ga0070699_100005231 | |||
| 221 | Ga0070679_100001462 | |||
| 222 | Ga0070679_100062801 | |||
| 223 | Ga0070697_100046960 | |||
| 224 | Ga0070697_100083418 | |||
| 225 | Ga0068853_100125025 | |||
| 226 | Ga0070696_100017610 | |||
| 227 | Ga0068862_100101464 | |||
| 228 | Ga0081538_10009466 | |||
| 229 | Ga0081540_1013956 | |||
| 230 | Ga0070717_10000766 | |||
| 231 | Ga0070717_10041875 | |||
| 232 | Ga0070717_10152176 | |||
| 233 | Ga0070716_100056997 | |||
| 234 | Ga0070712_100004358 | |||
| 235 | Ga0070712_100013543 | |||
| 236 | Ga0070712_100102253 | |||
| 237 | Ga0099795_10020937 | |||
| 238 | Ga0105240_10138776 | |||
| 239 | Ga0111539_10000605 | |||
| 240 | Ga0114129_10036026 | |||
| 241 | Ga0105248_10368270 | |||
| 242 | Ga0105237_10386526 | |||
| 243 | Ga0099796_10006326 | |||
| 244 | Ga0157370_10006453 | |||
| 245 | Ga0157375_10231311 | |||
| 246 | Ga0213875_10000134 | |||
| 247 | Ga0213875_10000759 | |||
| 248 | Ga0213875_10000996 | |||
| 249 | Ga0213871_10036284 | |||
| 250 | Ga0209148_1000478 | |||
| 251 | Ga0209455_1002458 | |||
| 252 | Ga0209130_1001770 | |||
| 253 | Ga0209675_1005782 | |||
| 254 | Ga0209676_1003103 | |||
| 255 | Ga0209025_1000821 | |||
| 256 | Ga0209758_1000279 | |||
| 257 | Ga0209758_1008844 | |||
| 258 | Ga0207426_1001453 | |||
| 259 | Ga0209257_1001009 | |||
| 260 | Ga0207692_10012254 | |||
| 261 | Ga0207699_10013033 | |||
| 262 | Ga0207699_10173572 | |||
| 263 | Ga0207684_10056084 | |||
| 264 | Ga0207707_10045482 | |||
| 265 | Ga0207707_10091284 | |||
| 266 | Ga0207707_10144086 | |||
| 267 | Ga0207707_10188424 | |||
| 268 | Ga0207671_10270273 | |||
| 269 | Ga0207693_10001602 | |||
| 270 | Ga0207693_10036277 | |||
| 271 | Ga0207693_10051784 | |||
| 272 | Ga0207693_10079612 | |||
| 273 | Ga0207663_10023399 | |||
| 274 | Ga0207663_10056894 | |||
| 275 | Ga0207660_10103140 | |||
| 276 | Ga0207652_10130751 | |||
| 277 | Ga0207659_10097487 | |||
| 278 | Ga0207700_10019060 | |||
| 279 | Ga0207664_10006693 | |||
| 280 | Ga0207644_10014888 | |||
| 281 | Ga0207644_10037097 | |||
| 282 | Ga0207679_10245729 | |||
| 283 | Ga0207639_10100546 | |||
| 284 | Ga0207641_10437021 | |||
| 285 | Ga0209179_1007853 | |||
| 286 | Ga0207428_10000107 | |||
| 287 | Ga0265332_10057864 | |||
| 288 | Ga0265320_10001167 | |||
| 289 | Ga0265327_10000657 | |||
| 290 | Ga0265314_10031166 | |||
| 291 | Ga0265314_10055250 | |||
| 292 | Ga0307413_10007260 | |||
| 293 | Ga0307411_10044540 | |||
| 294 | Ga0373945_0002921 | |||
| 295 | Ga0373956_0019265 | |||
| 296 | Ga0373957_0015757 | |||
| 297 | Ga0373927_0119581 | |||
| 298 | Ga0373933_0019043 | |||
| 299 | Ga0373947_0036274 | |||
| 300 | Ga0373937_0046257 | |||
| 301 | Ga0373937_0141709 | |||
| 302 | Ga0373925_0010030 | |||
| 303 | Ga0373925_0097847 | |||
| 304 | Ga0395899_0009543 | |||
| 305 | Ga0395898_0009455 | |||
| 306 | Ga0436364_0730168 | |||
| 307 | Ga0436364_1149423 | |||
| 308 | Ga0436364_1320883 | |||
| 309 | Ga0395901_0059656 | |||
| 310 | Ga0395901_0359771 | |||
| 311 | Ga0436365_0114190 | |||
| 312 | Ga0436365_1711468 | |||
| 313 | Ga0436365_1921978 | |||
| 314 | Ga0436360_0490339 | |||
| 315 | Ga0436360_1026760 | |||
| 316 | Ga0436360_1132142 | |||
| 317 | Ga0436361_0257664 | |||
| 318 | Ga0436361_0953635 | |||
| 319 | Ga0436361_1017687 | |||
| 320 | Ga0436363_1079365 | |||
| 321 | Ga0436363_1486733 | |||
| 322 | Ga0436362_0258673 | |||
| 323 | Ga0450907_011226 | |||
| 324 | Ga0451577_0224532 | |||
| 325 | Ga0453684_0118839 | |||
| 326 | Ga0451576_0000636 | |||
| 327 | Ga0451576_0060624 | |||
| 328 | Ga0495580_0037949 | |||
| 329 | Ga0495610_0008664 | |||
| 330 | Ga0495640_0139274 | |||
| 331 | Ga0495586_0020232 | |||
| 332 | Ga0495586_0038162 | |||
| 333 | Ga0495680_0232526 | |||
| 334 | Ga0495684_0236269 | |||
| 335 | Ga0496112_0165429 | |||
| 336 | Ga0496113_0074512 | |||
| 337 | Ga0501031_0074392 | |||
| 338 | Ga0501032_0012092 | |||
| 339 | Ga0501033_0006409 | |||
| 340 | Ga0501033_0054168 | |||
| 341 | Ga0501034_0037957 | |||
| 342 | Ga0501034_0073941 | |||
| 343 | Ga0501036_0032649 | |||
| 344 | Ga0501036_0260223 | |||
| 345 | Ga0501037_0005851 | |||
| 346 | Ga0501038_0057425 | |||
| 347 | Ga0501038_0304345 | |||
| 348 | Ga0501039_0008490 | |||
| 349 | Ga0501042_0166156 | |||
| 350 | Ga0501043_0010496 | |||
| 351 | Ga0501046_0001587 | |||
| 352 | Ga0501046_0152792 | |||
| 353 | Ga0501067_0010851 | |||
| 354 | Ga0501069_0001129 | |||
| 355 | Ga0501071_0119150 | |||
| 356 | Ga0501072_0025627 | |||
| 357 | Ga0501072_0056335 | |||
| 358 | Ga0501073_0000996 | |||
| 359 | Ga0501073_0003588 | |||
| 360 | Ga0501073_0007851 | |||
| 361 | Ga0501074_0001724 | |||
| 362 | Ga0501079_0056828 | |||
| 363 | Ga0501080_0013733 | |||
| 364 | Ga0501083_0001785 | |||
| 365 | Ga0501035_0000484 | |||
| 366 | Ga0501044_0014611 | |||
| 367 | Ga0501044_0031851 | |||
| 368 | nmdc:mga05p37_50614_c1 | |||
| 369 | nmdc:mga08y16_815_c1 | |||
| 370 | nmdc:mga08x19_35137_c1 | |||
| 371 | Ga0495601_0003785 | |||
| 372 | Ga0495619_0006663 | |||
| 373 | Ga0500578_0118753 | |||
| 374 | Ga0500646_0010063 | |||
| 375 | Ga0500566_0049047 | |||
| 376 | Ga0500641_0000853 | |||
| 377 | Ga0500595_003219 | |||
| 378 | Ga0500642_0010595 | |||
| 379 | Ga0500568_0021080 | |||
| 380 | Ga0500588_0005878 | |||
| 381 | Ga0500588_0006081 | |||
| 382 | Ga0500604_0007714 | |||
| 383 | Ga0500604_0010028 | |||
| 384 | Ga0500616_0002139 | |||
| 385 | Ga0500609_000725 | |||
| 386 | Ga0501084_0002039 | |||
| 387 | Ga0501084_0057359 | |||
| 388 | Ga0590075_003332 | |||
| 389 | Ga0501082_0001669 | |||
| 390 | Ga0501082_0006249 | |||
| 391 | 2524611013 | |||
| 392 | 2821446905 | |||
| 393 | 2842336394 | |||
| 394 | 2844538310 | |||
| 395 | 2883577865 | |||
| 396 | 2894776586 | |||
| 397 | 2929205071 | |||
| 398 | 8055912995 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dsq-assembly1.cif.gz_A | structure of desulfitobacterium hafniense pylsc, a pyrrolysyl trna synthetase | 0.8109 | 26 | 160 |
| 3vqx-assembly1.cif.gz_A | crystal structure of the catalytic domain of pyrrolysyl-trna synthetase in triclinic crystal form | 0.794 | 25 | 159 |
| 3dsq-assembly1.cif.gz_B | structure of desulfitobacterium hafniense pylsc, a pyrrolysyl trna synthetase | 0.7917 | 26 | 160 |
| 2q7g-assembly1.cif.gz_A-2 | pyrrolysine trna synthetase bound to a pyrrolysine analogue (cyc) and atp | 0.7893 | 25 | 159 |
| 8dqj-assembly1.cif.gz_A | crystal structure of pyrrolysyl-trna synthetase from methanomethylophilus alvus engineered for acridone amino acid (ast) bound to atp and acridone | 0.7835 | 25 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1httD01 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.7998 | 8 | 241 | 3.30.930.10 |
| 3dsqB02 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.7917 | 26 | 160 | 3.30.930.10 |
| af_Q58508_361_548_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.7901 | 24 | 159 | 3.30.930.10 |
| 2j3mA02 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.7896 | 10 | 165 | 3.30.930.10 |
| 3pcoD05 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.7871 | 29 | 131 | 3.30.930.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A836QNK0-F1-model_v4 | ATP phosphoribosyltransferase regulatory subunit | 0.9225 | 8 | 124 |
GO:0004821
GO:0005737 GO:0006427 GO:0016757 |
| AF-A0A4Q5T3E3-F1-model_v4 | ATP phosphoribosyltransferase regulatory subunit | 0.9213 | 9 | 171 |
GO:0004821
GO:0005737 GO:0006427 GO:0016757 |
| AF-A0A357LYV3-F1-model_v4 | ATP phosphoribosyltransferase regulatory subunit | 0.9181 | 9 | 161 |
GO:0004821
GO:0005737 GO:0006427 GO:0016757 |
| AF-A0A537D0F5-F1-model_v4 | Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain-containing protein | 0.9135 | 7 | 118 |
GO:0004821
GO:0005737 GO:0006427 |
| AF-A0A356PJ25-F1-model_v4 | deleted | 0.9084 | 9 | 180 |
|