F305832

General Info

Members Datasets Scaffolds Average Seq Length
199 148 398 367

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10014312|Ga0213872_100143123
Length 407
Sequence MAKCARRDFGVSRLSIAHRFETRYLRLMDETLHPALLPHGLRDILPPDARIEADTVERLMAILGQHGYDRVKPPLVEFESSLLDGPGVAMANETFRLMDPISHRMIAIRADMTLQIARIATARLVKSPRPLRLSYAGQVLRVRGSQLRPERQVGQVGAELIGSAAPEADAEVIALAAEALTAVGVPGLSVDLTLPVLVPSVLXXXXVEGKAAEQLRAALDRKDAAAIAEIGGPSAAILGALMAAAGPXDRAAEAQVAALTEIVRLIRTKAPELMLTIDPVENRGFEYHTGVSFTIFGRNIRGELGRGGRYVAGGHQAETGYARHQPADPQPSTGFTLYTDTLLRSLVFGPQPPRVLLPLGVEPAVGAKLRVEGWVTLAGLEAVADPAAEARRLQCSHVLVDGAPVPV

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
38 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
72 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
73 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
88 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
127 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
128 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
129 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
130 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
131 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
132 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
133 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
134 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
135 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
142 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
143 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
144 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
145 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
146 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
147 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
148 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.98
Metatranscriptomes 0
Isolates 4.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.07
Nodule 0.5
Rhizoplane 1.01
Rhizosphere 77.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10014312 3300021361 Bacteria 3703
2 JGI25151J46595_10000395 3300003187 Bacteria 45318
3 JGI25153J46596_10000105 3300003215 Bacteria 95783
4 JGI25160J50197_1022117 3300003354 Bacteria 1871
5 Ga0070670_100148832 3300005331 Bacteria 2026
6 Ga0070680_100007238 3300005336 Bacteria 8459
7 Ga0070675_100093867 3300005354 Bacteria 2517
8 Ga0070709_10165086 3300005434 Bacteria 1543
9 Ga0070714_100002005 3300005435 Bacteria 14893
10 Ga0070714_100042723 3300005435 Bacteria 3831
11 Ga0070714_100112921 3300005435 Bacteria 2408
12 Ga0070713_100218556 3300005436 Bacteria 1728
13 Ga0070710_10002553 3300005437 Bacteria 8639
14 Ga0070711_100064974 3300005439 Bacteria 2550
15 Ga0070681_10030542 3300005458 Bacteria 5406
16 Ga0070681_10082712 3300005458 Bacteria 3165
17 Ga0070681_10247995 3300005458 Bacteria 1693
18 Ga0070706_100007314 3300005467 Bacteria 10360
19 Ga0070698_100001199 3300005471 Bacteria 28742
20 Ga0070698_100007929 3300005471 Bacteria 11493
21 Ga0070699_100005231 3300005518 Bacteria 11397
22 Ga0070679_100001462 3300005530 Bacteria 20930
23 Ga0070679_100062801 3300005530 Bacteria 3703
24 Ga0070697_100046960 3300005536 Bacteria 3501
25 Ga0070697_100083418 3300005536 Bacteria 2636
26 Ga0068853_100125025 3300005539 Bacteria 2297
27 Ga0070696_100017610 3300005546 Bacteria 4823
28 Ga0068862_100101464 3300005844 Bacteria 2517
29 Ga0081538_10009466 3300005981 Bacteria 8129
30 Ga0081540_1013956 3300005983 Bacteria 5185
31 Ga0070717_10000766 3300006028 Bacteria 21005
32 Ga0070717_10041875 3300006028 Bacteria 3735
33 Ga0070717_10152176 3300006028 Bacteria 2002
34 Ga0070716_100056997 3300006173 Bacteria 2243
35 Ga0070712_100004358 3300006175 Bacteria 8727
36 Ga0070712_100013543 3300006175 Bacteria 5213
37 Ga0070712_100102253 3300006175 Bacteria 2122
38 Ga0099795_10020937 3300007788 Bacteria 2138
39 Ga0105240_10138776 3300009093 Bacteria 2909
40 Ga0111539_10000605 3300009094 Bacteria 46403
41 Ga0114129_10036026 3300009147 Bacteria 6989
42 Ga0105248_10368270 3300009177 Bacteria 1618
43 Ga0105237_10386526 3300009545 Bacteria 1404
44 Ga0099796_10006326 3300010159 Bacteria 3022
45 Ga0157370_10006453 3300013104 Bacteria 12941
46 Ga0157375_10231311 3300013308 Bacteria 2008
47 Ga0213875_10000134 3300021388 Bacteria 82367
48 Ga0213875_10000759 3300021388 Bacteria 24322
49 Ga0213875_10000996 3300021388 Bacteria 20184
50 Ga0213871_10036284 3300021441 Bacteria 1307
51 Ga0209148_1000478 3300025254 Bacteria 42159
52 Ga0209455_1002458 3300025272 Bacteria 7152
53 Ga0209130_1001770 3300025284 Bacteria 12774
54 Ga0209675_1005782 3300025291 Bacteria 5095
55 Ga0209676_1003103 3300025292 Bacteria 10684
56 Ga0209025_1000821 3300025294 Bacteria 49593
57 Ga0209758_1000279 3300025297 Bacteria 101326
58 Ga0209758_1008844 3300025297 Bacteria 6409
59 Ga0207426_1001453 3300025302 Bacteria 19599
60 Ga0209257_1001009 3300025304 Bacteria 38044
61 Ga0207692_10012254 3300025898 Bacteria 3677
62 Ga0207699_10013033 3300025906 Bacteria 4242
63 Ga0207699_10173572 3300025906 Bacteria 1444
64 Ga0207684_10056084 3300025910 Bacteria 3342
65 Ga0207707_10045482 3300025912 Bacteria 3825
66 Ga0207707_10091284 3300025912 Bacteria 2662
67 Ga0207707_10144086 3300025912 Bacteria 2082
68 Ga0207707_10188424 3300025912 Bacteria 1800
69 Ga0207671_10270273 3300025914 Bacteria 1339
70 Ga0207693_10001602 3300025915 Bacteria 20022
71 Ga0207693_10036277 3300025915 Bacteria 3886
72 Ga0207693_10051784 3300025915 Bacteria 3220
73 Ga0207693_10079612 3300025915 Bacteria 2565
74 Ga0207663_10023399 3300025916 Bacteria 3544
75 Ga0207663_10056894 3300025916 Bacteria 2462
76 Ga0207660_10103140 3300025917 Bacteria 2133
77 Ga0207652_10130751 3300025921 Bacteria 2239
78 Ga0207659_10097487 3300025926 Bacteria 2209
79 Ga0207700_10019060 3300025928 Bacteria 4627
80 Ga0207664_10006693 3300025929 Bacteria 7951
81 Ga0207644_10014888 3300025931 Bacteria 5214
82 Ga0207644_10037097 3300025931 Bacteria 3427
83 Ga0207679_10245729 3300025945 Bacteria 1519
84 Ga0207639_10100546 3300026041 Bacteria 2336
85 Ga0207641_10437021 3300026088 Bacteria 1263
86 Ga0209179_1007853 3300027512 Bacteria 1777
87 Ga0207428_10000107 3300027907 Bacteria 115442
88 Ga0265332_10057864 3300031238 Bacteria 1660
89 Ga0265320_10001167 3300031240 Bacteria 19330
90 Ga0265327_10000657 3300031251 Bacteria 55516
91 Ga0265314_10031166 3300031711 Bacteria 3940
92 Ga0265314_10055250 3300031711 Bacteria 2743
93 Ga0307413_10007260 3300031824 Bacteria 5130
94 Ga0307411_10044540 3300032005 Bacteria 2847
95 Ga0373945_0002921 3300035116 Bacteria 5372
96 Ga0373956_0019265 3300035119 Bacteria 2893
97 Ga0373957_0015757 3300035120 Bacteria 2607
98 Ga0373927_0119581 3300035695 Bacteria 1719
99 Ga0373933_0019043 3300035724 Bacteria 3869
100 Ga0373947_0036274 3300035725 Bacteria 2923
101 Ga0373937_0046257 3300036401 Bacteria 3979
102 Ga0373937_0141709 3300036401 Bacteria 2249
103 Ga0373925_0010030 3300037068 Bacteria 6880
104 Ga0373925_0097847 3300037068 Bacteria 2251
105 Ga0395899_0009543 3300037312 Bacteria 7449
106 Ga0395898_0009455 3300037466 Bacteria 10239
107 Ga0436364_0730168 3300037853 Bacteria 28599
108 Ga0436364_1149423 3300037853 Bacteria 148108
109 Ga0436364_1320883 3300037853 Bacteria 111220
110 Ga0395901_0059656 3300038443 Bacteria 3969
111 Ga0395901_0359771 3300038443 Bacteria 1501
112 Ga0436365_0114190 3300039437 Bacteria 1659
113 Ga0436365_1711468 3300039437 Bacteria 2337
114 Ga0436365_1921978 3300039437 Bacteria 1778
115 Ga0436360_0490339 3300039438 Bacteria 1402
116 Ga0436360_1026760 3300039438 Bacteria 1601
117 Ga0436360_1132142 3300039438 Bacteria 3757
118 Ga0436361_0257664 3300039447 Bacteria 7083
119 Ga0436361_0953635 3300039447 Bacteria 3294
120 Ga0436361_1017687 3300039447 Bacteria 2427
121 Ga0436363_1079365 3300039450 Bacteria 8138
122 Ga0436363_1486733 3300039450 Bacteria 3906
123 Ga0436362_0258673 3300039453 Bacteria 3148
124 Ga0450907_011226 3300042146 Bacteria 1488
125 Ga0451577_0224532 3300042876 Bacteria 1698
126 Ga0453684_0118839 3300044712 Bacteria 3196
127 Ga0451576_0000636 3300045051 Bacteria 72954
128 Ga0451576_0060624 3300045051 Bacteria 3947
129 Ga0495580_0037949 3300046472 Bacteria 3454
130 Ga0495610_0008664 3300046512 Bacteria 6552
131 Ga0495640_0139274 3300046533 Bacteria 1565
132 Ga0495586_0020232 3300046535 Bacteria 3545
133 Ga0495586_0038162 3300046535 Bacteria 2579
134 Ga0495680_0232526 3300047322 Bacteria 1312
135 Ga0495684_0236269 3300047471 Bacteria 1335
136 Ga0496112_0165429 3300048915 Bacteria 2178
137 Ga0496113_0074512 3300048916 Bacteria 2588
138 Ga0501031_0074392 3300049568 Bacteria 2212
139 Ga0501032_0012092 3300049569 Bacteria 6179
140 Ga0501033_0006409 3300049570 Bacteria 9215
141 Ga0501033_0054168 3300049570 Bacteria 2969
142 Ga0501034_0037957 3300049571 Bacteria 4878
143 Ga0501034_0073941 3300049571 Bacteria 3417
144 Ga0501036_0032649 3300049572 Bacteria 4400
145 Ga0501036_0260223 3300049572 Bacteria 1454
146 Ga0501037_0005851 3300049573 Bacteria 8981
147 Ga0501038_0057425 3300049574 Bacteria 3342
148 Ga0501038_0304345 3300049574 Bacteria 1250
149 Ga0501039_0008490 3300049575 Bacteria 7832
150 Ga0501042_0166156 3300049578 Bacteria 1592
151 Ga0501043_0010496 3300049579 Bacteria 7254
152 Ga0501046_0001587 3300049580 Bacteria 21740
153 Ga0501046_0152792 3300049580 Bacteria 1741
154 Ga0501067_0010851 3300049583 Bacteria 5042
155 Ga0501069_0001129 3300049585 Bacteria 12885
156 Ga0501071_0119150 3300049587 Bacteria 1956
157 Ga0501072_0025627 3300049588 Bacteria 4594
158 Ga0501072_0056335 3300049588 Bacteria 3098
159 Ga0501073_0000996 3300049589 Bacteria 20447
160 Ga0501073_0003588 3300049589 Bacteria 11672
161 Ga0501073_0007851 3300049589 Bacteria 7920
162 Ga0501074_0001724 3300049590 Bacteria 14933
163 Ga0501079_0056828 3300049741 Bacteria 3020
164 Ga0501080_0013733 3300049742 Bacteria 7456
165 Ga0501083_0001785 3300049744 Bacteria 14704
166 Ga0501035_0000484 3300049822 Bacteria 44772
167 Ga0501044_0014611 3300049823 Bacteria 8466
168 Ga0501044_0031851 3300049823 Bacteria 5546
169 nmdc:mga05p37_50614_c1 3300050507 Bacteria 5109
170 nmdc:mga08y16_815_c1 3300050511 Bacteria 29853
171 nmdc:mga08x19_35137_c1 3300050514 Bacteria 3170
172 Ga0495601_0003785 3300053077 Bacteria 8709
173 Ga0495619_0006663 3300053085 Bacteria 7307
174 Ga0500578_0118753 3300053086 Bacteria 1663
175 Ga0500646_0010063 3300053090 Bacteria 2423
176 Ga0500566_0049047 3300053094 Bacteria 2419
177 Ga0500641_0000853 3300053096 Bacteria 10918
178 Ga0500595_003219 3300053119 Bacteria 7711
179 Ga0500642_0010595 3300053130 Bacteria 3258
180 Ga0500568_0021080 3300053139 Bacteria 2809
181 Ga0500588_0005878 3300053146 Bacteria 2748
182 Ga0500588_0006081 3300053146 Bacteria 2713
183 Ga0500604_0007714 3300053151 Bacteria 2851
184 Ga0500604_0010028 3300053151 Bacteria 2529
185 Ga0500616_0002139 3300053153 Bacteria 17096
186 Ga0500609_000725 3300053731 Bacteria 4962
187 Ga0501084_0002039 3300054114 Bacteria 16134
188 Ga0501084_0057359 3300054114 Bacteria 3259
189 Ga0590075_003332 3300059424 Bacteria 3827
190 Ga0501082_0001669 3300060353 Bacteria 19564
191 Ga0501082_0006249 3300060353 Bacteria 10339
192 2524611013 2524023250 Bacteria 5457705
193 2821446905 2821443989 Bacteria 7658172
194 2842336394 2842333319 Bacteria 8899485
195 2844538310 2844533157 Bacteria 7517899
196 2883577865 2883577096 Bacteria 4709178
197 2894776586 2894772417 Bacteria 5305674
198 2929205071 2929199973 Bacteria 7260745
199 8055912995 8055909800 Bacteria 7278581
200 Ga0213872_10014312
201 JGI25151J46595_10000395
202 JGI25153J46596_10000105
203 JGI25160J50197_1022117
204 Ga0070670_100148832
205 Ga0070680_100007238
206 Ga0070675_100093867
207 Ga0070709_10165086
208 Ga0070714_100002005
209 Ga0070714_100042723
210 Ga0070714_100112921
211 Ga0070713_100218556
212 Ga0070710_10002553
213 Ga0070711_100064974
214 Ga0070681_10030542
215 Ga0070681_10082712
216 Ga0070681_10247995
217 Ga0070706_100007314
218 Ga0070698_100001199
219 Ga0070698_100007929
220 Ga0070699_100005231
221 Ga0070679_100001462
222 Ga0070679_100062801
223 Ga0070697_100046960
224 Ga0070697_100083418
225 Ga0068853_100125025
226 Ga0070696_100017610
227 Ga0068862_100101464
228 Ga0081538_10009466
229 Ga0081540_1013956
230 Ga0070717_10000766
231 Ga0070717_10041875
232 Ga0070717_10152176
233 Ga0070716_100056997
234 Ga0070712_100004358
235 Ga0070712_100013543
236 Ga0070712_100102253
237 Ga0099795_10020937
238 Ga0105240_10138776
239 Ga0111539_10000605
240 Ga0114129_10036026
241 Ga0105248_10368270
242 Ga0105237_10386526
243 Ga0099796_10006326
244 Ga0157370_10006453
245 Ga0157375_10231311
246 Ga0213875_10000134
247 Ga0213875_10000759
248 Ga0213875_10000996
249 Ga0213871_10036284
250 Ga0209148_1000478
251 Ga0209455_1002458
252 Ga0209130_1001770
253 Ga0209675_1005782
254 Ga0209676_1003103
255 Ga0209025_1000821
256 Ga0209758_1000279
257 Ga0209758_1008844
258 Ga0207426_1001453
259 Ga0209257_1001009
260 Ga0207692_10012254
261 Ga0207699_10013033
262 Ga0207699_10173572
263 Ga0207684_10056084
264 Ga0207707_10045482
265 Ga0207707_10091284
266 Ga0207707_10144086
267 Ga0207707_10188424
268 Ga0207671_10270273
269 Ga0207693_10001602
270 Ga0207693_10036277
271 Ga0207693_10051784
272 Ga0207693_10079612
273 Ga0207663_10023399
274 Ga0207663_10056894
275 Ga0207660_10103140
276 Ga0207652_10130751
277 Ga0207659_10097487
278 Ga0207700_10019060
279 Ga0207664_10006693
280 Ga0207644_10014888
281 Ga0207644_10037097
282 Ga0207679_10245729
283 Ga0207639_10100546
284 Ga0207641_10437021
285 Ga0209179_1007853
286 Ga0207428_10000107
287 Ga0265332_10057864
288 Ga0265320_10001167
289 Ga0265327_10000657
290 Ga0265314_10031166
291 Ga0265314_10055250
292 Ga0307413_10007260
293 Ga0307411_10044540
294 Ga0373945_0002921
295 Ga0373956_0019265
296 Ga0373957_0015757
297 Ga0373927_0119581
298 Ga0373933_0019043
299 Ga0373947_0036274
300 Ga0373937_0046257
301 Ga0373937_0141709
302 Ga0373925_0010030
303 Ga0373925_0097847
304 Ga0395899_0009543
305 Ga0395898_0009455
306 Ga0436364_0730168
307 Ga0436364_1149423
308 Ga0436364_1320883
309 Ga0395901_0059656
310 Ga0395901_0359771
311 Ga0436365_0114190
312 Ga0436365_1711468
313 Ga0436365_1921978
314 Ga0436360_0490339
315 Ga0436360_1026760
316 Ga0436360_1132142
317 Ga0436361_0257664
318 Ga0436361_0953635
319 Ga0436361_1017687
320 Ga0436363_1079365
321 Ga0436363_1486733
322 Ga0436362_0258673
323 Ga0450907_011226
324 Ga0451577_0224532
325 Ga0453684_0118839
326 Ga0451576_0000636
327 Ga0451576_0060624
328 Ga0495580_0037949
329 Ga0495610_0008664
330 Ga0495640_0139274
331 Ga0495586_0020232
332 Ga0495586_0038162
333 Ga0495680_0232526
334 Ga0495684_0236269
335 Ga0496112_0165429
336 Ga0496113_0074512
337 Ga0501031_0074392
338 Ga0501032_0012092
339 Ga0501033_0006409
340 Ga0501033_0054168
341 Ga0501034_0037957
342 Ga0501034_0073941
343 Ga0501036_0032649
344 Ga0501036_0260223
345 Ga0501037_0005851
346 Ga0501038_0057425
347 Ga0501038_0304345
348 Ga0501039_0008490
349 Ga0501042_0166156
350 Ga0501043_0010496
351 Ga0501046_0001587
352 Ga0501046_0152792
353 Ga0501067_0010851
354 Ga0501069_0001129
355 Ga0501071_0119150
356 Ga0501072_0025627
357 Ga0501072_0056335
358 Ga0501073_0000996
359 Ga0501073_0003588
360 Ga0501073_0007851
361 Ga0501074_0001724
362 Ga0501079_0056828
363 Ga0501080_0013733
364 Ga0501083_0001785
365 Ga0501035_0000484
366 Ga0501044_0014611
367 Ga0501044_0031851
368 nmdc:mga05p37_50614_c1
369 nmdc:mga08y16_815_c1
370 nmdc:mga08x19_35137_c1
371 Ga0495601_0003785
372 Ga0495619_0006663
373 Ga0500578_0118753
374 Ga0500646_0010063
375 Ga0500566_0049047
376 Ga0500641_0000853
377 Ga0500595_003219
378 Ga0500642_0010595
379 Ga0500568_0021080
380 Ga0500588_0005878
381 Ga0500588_0006081
382 Ga0500604_0007714
383 Ga0500604_0010028
384 Ga0500616_0002139
385 Ga0500609_000725
386 Ga0501084_0002039
387 Ga0501084_0057359
388 Ga0590075_003332
389 Ga0501082_0001669
390 Ga0501082_0006249
391 2524611013
392 2821446905
393 2842336394
394 2844538310
395 2883577865
396 2894776586
397 2929205071
398 8055912995

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13393

tRNA-synt_His

Histidyl-tRNA synthetase

40

342

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dsq-assembly1.cif.gz_A structure of desulfitobacterium hafniense pylsc, a pyrrolysyl trna synthetase 0.8109 26 160
3vqx-assembly1.cif.gz_A crystal structure of the catalytic domain of pyrrolysyl-trna synthetase in triclinic crystal form 0.794 25 159
3dsq-assembly1.cif.gz_B structure of desulfitobacterium hafniense pylsc, a pyrrolysyl trna synthetase 0.7917 26 160
2q7g-assembly1.cif.gz_A-2 pyrrolysine trna synthetase bound to a pyrrolysine analogue (cyc) and atp 0.7893 25 159
8dqj-assembly1.cif.gz_A crystal structure of pyrrolysyl-trna synthetase from methanomethylophilus alvus engineered for acridone amino acid (ast) bound to atp and acridone 0.7835 25 155
ID Description Score Start End Superfamily
1httD01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.7998 8 241 3.30.930.10
3dsqB02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.7917 26 160 3.30.930.10
af_Q58508_361_548_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.7901 24 159 3.30.930.10
2j3mA02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.7896 10 165 3.30.930.10
3pcoD05 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.7871 29 131 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A836QNK0-F1-model_v4 ATP phosphoribosyltransferase regulatory subunit 0.9225 8 124 GO:0004821
GO:0005737
GO:0006427
GO:0016757
AF-A0A4Q5T3E3-F1-model_v4 ATP phosphoribosyltransferase regulatory subunit 0.9213 9 171 GO:0004821
GO:0005737
GO:0006427
GO:0016757
AF-A0A357LYV3-F1-model_v4 ATP phosphoribosyltransferase regulatory subunit 0.9181 9 161 GO:0004821
GO:0005737
GO:0006427
GO:0016757
AF-A0A537D0F5-F1-model_v4 Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain-containing protein 0.9135 7 118 GO:0004821
GO:0005737
GO:0006427
AF-A0A356PJ25-F1-model_v4 deleted 0.9084 9 180

Map