F305710

General Info

Members Datasets Scaffolds Average Seq Length
199 165 398 116

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10121578|Ga0105240_101215782
Length 114
Sequence MTLNGPAKLVRVHFGEDDRWQGKPLYEAIVEEARRHDLAGATVYRGIEGYGASSRIHRRQLLTSSDLPIMVCLIDTAANIERFLPALENMVQEGLVAISDVDVIRYSHPKEPDA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
6 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
22 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
62 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
66 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
75 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
84 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
85 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
108 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
153 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 2508501039 Frankia saprophytica CN3 Isolate Nodule
158 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
159 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
160 2710264753 Frankia sp. KB5 Isolate Nodule
161 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
162 2862574272 Streptomyces sp. AcE210 Isolate Nodule
163 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
164 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
165 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.95
Metatranscriptomes 4.52
Isolates 4.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 1.51
Rhizoplane 1.51
Rhizosphere 86.43
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10121578 3300009093 Bacteria 3143
2 Ga0006562J51391_1183706 3300003578 Bacteria 1070
3 Ga0006562J51391_1183707 3300003578 Bacteria 1060
4 Ga0070683_100045904 3300005329 Bacteria 4034
5 Ga0070714_101079132 3300005435 Bacteria 782
6 Ga0070714_101955241 3300005435 Bacteria 572
7 Ga0070698_100684834 3300005471 Bacteria 967
8 Ga0070679_100046111 3300005530 Bacteria 4344
9 Ga0070684_100170421 3300005535 Bacteria 1977
10 Ga0068853_101057225 3300005539 Bacteria 782
11 Ga0068855_101166841 3300005563 Bacteria 802
12 Ga0068857_101938154 3300005577 Bacteria 577
13 Ga0068859_100001804 3300005617 Bacteria 21793
14 Ga0068863_100001348 3300005841 Bacteria 24422
15 Ga0068858_100008000 3300005842 Bacteria 10188
16 Ga0081455_10590063 3300005937 Bacteria 726
17 Ga0070717_10263154 3300006028 Bacteria 1526
18 Ga0070717_11153054 3300006028 Bacteria 706
19 Ga0070717_11802447 3300006028 Bacteria 553
20 Ga0075430_100013302 3300006846 Bacteria 7015
21 Ga0097620_100001804 3300006931 Bacteria 21793
22 Ga0114129_10000822 3300009147 Bacteria 40015
23 Ga0114129_10100915 3300009147 Bacteria 3993
24 Ga0157379_10387388 3300014968 Bacteria 1283
25 Ga0182007_10000552 3300015262 Bacteria 22108
26 Ga0163161_11166203 3300017792 Bacteria 665
27 Ga0197907_10334059 3300020069 Bacteria 5044
28 Ga0206356_11445834 3300020070 Bacteria 4413
29 Ga0206352_11123231 3300020078 Bacteria 1598
30 Ga0206350_10434387 3300020080 Bacteria 2183
31 Ga0206354_10091147 3300020081 Bacteria 4596
32 Ga0206353_10340037 3300020082 Bacteria 5144
33 Ga0224712_10001760 3300022467 Bacteria 5161
34 Ga0207688_10088408 3300025901 Bacteria 1777
35 Ga0207643_10393605 3300025908 Bacteria 875
36 Ga0207684_10488574 3300025910 Bacteria 1056
37 Ga0207663_10956667 3300025916 Bacteria 686
38 Ga0207662_10133553 3300025918 Bacteria 1567
39 Ga0207652_10188189 3300025921 Bacteria 1856
40 Ga0207650_10025674 3300025925 Bacteria 4198
41 Ga0207659_10012329 3300025926 Bacteria 5435
42 Ga0207687_10070357 3300025927 Bacteria 2498
43 Ga0207690_10093900 3300025932 Bacteria 2127
44 Ga0207706_10102914 3300025933 Bacteria 2512
45 Ga0207704_10746145 3300025938 Unclassified 814
46 Ga0207691_10558407 3300025940 Bacteria 970
47 Ga0207689_10023691 3300025942 Bacteria 5149
48 Ga0207661_10007171 3300025944 Bacteria 7919
49 Ga0207661_10104248 3300025944 Bacteria 2388
50 Ga0207679_10003783 3300025945 Bacteria 9376
51 Ga0207712_10172310 3300025961 Bacteria 1693
52 Ga0207668_10649975 3300025972 Bacteria 923
53 Ga0207640_10308622 3300025981 Bacteria 1255
54 Ga0207677_10091748 3300026023 Bacteria 2210
55 Ga0207703_10021012 3300026035 Bacteria 5108
56 Ga0207703_12258004 3300026035 Bacteria 520
57 Ga0207708_10032342 3300026075 Bacteria 3973
58 Ga0207702_10114973 3300026078 Bacteria 2399
59 Ga0207641_10013630 3300026088 Bacteria 6668
60 Ga0207648_10433768 3300026089 Bacteria 1194
61 Ga0207674_10001699 3300026116 Bacteria 28201
62 Ga0207675_100516469 3300026118 Bacteria 1190
63 Ga0207698_11029826 3300026142 Bacteria 835
64 Ga0209966_1074859 3300027695 Bacteria 745
65 Ga0207428_10048317 3300027907 Bacteria 3414
66 Ga0268265_10352419 3300028380 Bacteria 1344
67 Ga0268264_10084817 3300028381 Bacteria 2717
68 Ga0307511_10000642 3300030521 Bacteria 37399
69 Ga0307512_10043304 3300030522 Bacteria 3714
70 Ga0307513_10342765 3300031456 Bacteria 1244
71 Ga0307509_10033474 3300031507 Bacteria 5656
72 Ga0307509_10552326 3300031507 Bacteria 829
73 Ga0307508_10119205 3300031616 Bacteria 2241
74 Ga0307516_10020950 3300031730 Bacteria 6746
75 Ga0307405_10713859 3300031731 Bacteria 832
76 Ga0307518_10505674 3300031838 Bacteria 620
77 Ga0307406_10347372 3300031901 Bacteria 1158
78 Ga0307407_10053249 3300031903 Bacteria 2328
79 Ga0307407_10318316 3300031903 Bacteria 1091
80 Ga0307409_100381314 3300031995 Bacteria 1340
81 Ga0307409_100732207 3300031995 Bacteria 991
82 Ga0307416_103151689 3300032002 Bacteria 552
83 Ga0307415_100283749 3300032126 Bacteria 1363
84 Ga0307415_100789416 3300032126 Bacteria 866
85 Ga0307510_10215609 3300033180 Bacteria 1437
86 Ga0307510_10252449 3300033180 Bacteria 1250
87 Ga0373954_0156018 3300035118 Bacteria 1116
88 Ga0373927_0062886 3300035695 Bacteria 2400
89 Ga0373933_0761228 3300035724 Bacteria 637
90 Ga0373937_0784515 3300036401 Bacteria 900
91 Ga0395899_0083825 3300037312 Bacteria 2318
92 Ga0395900_0024340 3300037418 Bacteria 6200
93 Ga0395898_0241645 3300037466 Bacteria 1722
94 Ga0395898_1234469 3300037466 Bacteria 678
95 Ga0395898_1562551 3300037466 Bacteria 585
96 Ga0395901_0065656 3300038443 Bacteria 3779
97 Ga0395901_0139090 3300038443 Bacteria 2552
98 Ga0395901_0839547 3300038443 Bacteria 905
99 Ga0400488_35283 3300038741 Bacteria 1221
100 Ga0400486_11922 3300038742 Bacteria 1575
101 Ga0451797_0164411 3300041453 Bacteria 523
102 Ga0451853_2368048 3300041512 Bacteria 2111
103 Ga0466969_0002086 3300044656 Bacteria 10674
104 Ga0466969_0055577 3300044656 Bacteria 1936
105 Ga0466972_0160194 3300044658 Bacteria 1057
106 Ga0466965_0112822 3300044683 Bacteria 1398
107 Ga0466966_0045945 3300044684 Bacteria 2790
108 Ga0466966_0230623 3300044684 Bacteria 1117
109 Ga0466961_0007286 3300044693 Bacteria 7038
110 Ga0466961_0147979 3300044693 Bacteria 1468
111 Ga0466963_0082656 3300044694 Bacteria 2177
112 Ga0466963_0397756 3300044694 Bacteria 971
113 Ga0466971_0039299 3300044719 Bacteria 2124
114 Ga0466971_0300541 3300044719 Bacteria 771
115 Ga0466970_0001535 3300044765 Bacteria 11120
116 Ga0466957_0063597 3300044842 Bacteria 2268
117 Ga0466959_0014800 3300045049 Bacteria 5678
118 Ga0466958_0028338 3300045836 Bacteria 3320
119 Ga0466958_0179507 3300045836 Bacteria 1343
120 Ga0466958_0827763 3300045836 Bacteria 604
121 Ga0495592_0251122 3300046454 Bacteria 1169
122 Ga0495603_0845949 3300046455 Bacteria 521
123 Ga0495629_0164842 3300046459 Bacteria 1539
124 Ga0495629_0254867 3300046459 Bacteria 1207
125 Ga0495638_0301518 3300046460 Bacteria 863
126 Ga0495653_0192117 3300046463 Bacteria 1392
127 Ga0495582_0137579 3300046473 Bacteria 1383
128 Ga0495594_0078925 3300046499 Bacteria 1837
129 Ga0495594_0879259 3300046499 Bacteria 504
130 Ga0495630_0451406 3300046517 Bacteria 985
131 Ga0495631_0258303 3300046518 Bacteria 742
132 Ga0495644_0205470 3300046523 Bacteria 760
133 Ga0495663_0250362 3300046525 Bacteria 629
134 Ga0495667_0450866 3300046559 Bacteria 808
135 Ga0495656_0032503 3300046615 Bacteria 2124
136 Ga0495623_0119605 3300046679 Bacteria 1587
137 Ga0495613_0703044 3300046689 Bacteria 665
138 Ga0495671_0121925 3300046692 Bacteria 1272
139 Ga0495660_0445788 3300046810 Bacteria 560
140 Ga0495676_0021943 3300047321 Bacteria 5565
141 Ga0495687_001703 3300047443 Bacteria 19545
142 Ga0495687_002788 3300047443 Bacteria 13493
143 Ga0495677_0198996 3300047445 Bacteria 779
144 Ga0495677_0255475 3300047445 Bacteria 686
145 Ga0495684_0387205 3300047471 Bacteria 985
146 Ga0495593_0431926 3300047673 Unclassified 659
147 Ga0495614_0219844 3300048089 Bacteria 863
148 Ga0496100_0028809 3300048903 Bacteria 3429
149 Ga0496102_1793673 3300048905 Bacteria 531
150 Ga0496121_0124914 3300048924 Bacteria 1936
151 Ga0501031_0017007 3300049568 Bacteria 4724
152 Ga0501031_0411180 3300049568 Bacteria 875
153 Ga0501032_0182264 3300049569 Bacteria 1375
154 Ga0501033_0003583 3300049570 Bacteria 12697
155 Ga0501033_0859336 3300049570 Bacteria 611
156 Ga0501036_0059587 3300049572 Bacteria 3234
157 Ga0501036_0303184 3300049572 Bacteria 1336
158 Ga0501039_0009636 3300049575 Bacteria 7363
159 Ga0501040_0009803 3300049576 Bacteria 6252
160 Ga0501041_0005792 3300049577 Bacteria 7221
161 Ga0501042_0038664 3300049578 Bacteria 3388
162 Ga0501043_0768238 3300049579 Bacteria 699
163 Ga0501046_0486397 3300049580 Bacteria 885
164 Ga0501048_0806364 3300049582 Bacteria 674
165 Ga0501068_0107957 3300049584 Bacteria 1729
166 Ga0501069_0373410 3300049585 Bacteria 842
167 Ga0501071_0031805 3300049587 Bacteria 3743
168 Ga0501074_0320188 3300049590 Bacteria 1101
169 Ga0501075_0015045 3300049591 Bacteria 5551
170 Ga0501077_0106311 3300049593 Bacteria 1778
171 Ga0501261_094124 3300049690 Bacteria 561
172 Ga0501079_0084709 3300049741 Bacteria 2452
173 Ga0501080_0295137 3300049742 Bacteria 1471
174 Ga0501081_0342250 3300049743 Bacteria 1101
175 Ga0501035_0107432 3300049822 Bacteria 2446
176 Ga0501035_0163621 3300049822 Bacteria 1925
177 Ga0501045_0003457 3300049824 Bacteria 10813
178 nmdc:mga05p37_164928_c1 3300050507 Bacteria 2704
179 nmdc:mga09592_1057523_c1 3300050508 Bacteria 676
180 nmdc:mga08y16_4166_c1 3300050511 Bacteria 15097
181 Ga0495601_0221724 3300053077 Bacteria 1235
182 Ga0495619_0008758 3300053085 Bacteria 6397
183 Ga0500566_0033585 3300053094 Bacteria 2988
184 Ga0500553_035785 3300053101 Bacteria 2459
185 Ga0501084_0013223 3300054114 Bacteria 6830
186 Ga0501084_0613587 3300054114 Bacteria 919
187 Ga0466962_0048757 3300061719 Bacteria 2024
188 Ga0466962_0164986 3300061719 Bacteria 1077
189 Ga0530510_0003251 3300061734 Bacteria 11165
190 Ga0530510_0931675 3300061734 Bacteria 664
191 2508674038 2508501039 Bacteria 9978592
192 2616697262 2616644814 Bacteria 11555299
193 2644441939 2643221678 Bacteria 9540101
194 2710605875 2710264753 Bacteria 5455564
195 2862180640 2862178590 Bacteria 8583590
196 2862575259 2862574272 Bacteria 10567477
197 2873319904 2873314349 Bacteria 8512634
198 2891404004 2891395885 Bacteria 9251614
199 3006323453 3006321560 Bacteria 8247479
200 Ga0105240_10121578
201 Ga0006562J51391_1183706
202 Ga0006562J51391_1183707
203 Ga0070683_100045904
204 Ga0070714_101079132
205 Ga0070714_101955241
206 Ga0070698_100684834
207 Ga0070679_100046111
208 Ga0070684_100170421
209 Ga0068853_101057225
210 Ga0068855_101166841
211 Ga0068857_101938154
212 Ga0068859_100001804
213 Ga0068863_100001348
214 Ga0068858_100008000
215 Ga0081455_10590063
216 Ga0070717_10263154
217 Ga0070717_11153054
218 Ga0070717_11802447
219 Ga0075430_100013302
220 Ga0097620_100001804
221 Ga0114129_10000822
222 Ga0114129_10100915
223 Ga0157379_10387388
224 Ga0182007_10000552
225 Ga0163161_11166203
226 Ga0197907_10334059
227 Ga0206356_11445834
228 Ga0206352_11123231
229 Ga0206350_10434387
230 Ga0206354_10091147
231 Ga0206353_10340037
232 Ga0224712_10001760
233 Ga0207688_10088408
234 Ga0207643_10393605
235 Ga0207684_10488574
236 Ga0207663_10956667
237 Ga0207662_10133553
238 Ga0207652_10188189
239 Ga0207650_10025674
240 Ga0207659_10012329
241 Ga0207687_10070357
242 Ga0207690_10093900
243 Ga0207706_10102914
244 Ga0207704_10746145
245 Ga0207691_10558407
246 Ga0207689_10023691
247 Ga0207661_10007171
248 Ga0207661_10104248
249 Ga0207679_10003783
250 Ga0207712_10172310
251 Ga0207668_10649975
252 Ga0207640_10308622
253 Ga0207677_10091748
254 Ga0207703_10021012
255 Ga0207703_12258004
256 Ga0207708_10032342
257 Ga0207702_10114973
258 Ga0207641_10013630
259 Ga0207648_10433768
260 Ga0207674_10001699
261 Ga0207675_100516469
262 Ga0207698_11029826
263 Ga0209966_1074859
264 Ga0207428_10048317
265 Ga0268265_10352419
266 Ga0268264_10084817
267 Ga0307511_10000642
268 Ga0307512_10043304
269 Ga0307513_10342765
270 Ga0307509_10033474
271 Ga0307509_10552326
272 Ga0307508_10119205
273 Ga0307516_10020950
274 Ga0307405_10713859
275 Ga0307518_10505674
276 Ga0307406_10347372
277 Ga0307407_10053249
278 Ga0307407_10318316
279 Ga0307409_100381314
280 Ga0307409_100732207
281 Ga0307416_103151689
282 Ga0307415_100283749
283 Ga0307415_100789416
284 Ga0307510_10215609
285 Ga0307510_10252449
286 Ga0373954_0156018
287 Ga0373927_0062886
288 Ga0373933_0761228
289 Ga0373937_0784515
290 Ga0395899_0083825
291 Ga0395900_0024340
292 Ga0395898_0241645
293 Ga0395898_1234469
294 Ga0395898_1562551
295 Ga0395901_0065656
296 Ga0395901_0139090
297 Ga0395901_0839547
298 Ga0400488_35283
299 Ga0400486_11922
300 Ga0451797_0164411
301 Ga0451853_2368048
302 Ga0466969_0002086
303 Ga0466969_0055577
304 Ga0466972_0160194
305 Ga0466965_0112822
306 Ga0466966_0045945
307 Ga0466966_0230623
308 Ga0466961_0007286
309 Ga0466961_0147979
310 Ga0466963_0082656
311 Ga0466963_0397756
312 Ga0466971_0039299
313 Ga0466971_0300541
314 Ga0466970_0001535
315 Ga0466957_0063597
316 Ga0466959_0014800
317 Ga0466958_0028338
318 Ga0466958_0179507
319 Ga0466958_0827763
320 Ga0495592_0251122
321 Ga0495603_0845949
322 Ga0495629_0164842
323 Ga0495629_0254867
324 Ga0495638_0301518
325 Ga0495653_0192117
326 Ga0495582_0137579
327 Ga0495594_0078925
328 Ga0495594_0879259
329 Ga0495630_0451406
330 Ga0495631_0258303
331 Ga0495644_0205470
332 Ga0495663_0250362
333 Ga0495667_0450866
334 Ga0495656_0032503
335 Ga0495623_0119605
336 Ga0495613_0703044
337 Ga0495671_0121925
338 Ga0495660_0445788
339 Ga0495676_0021943
340 Ga0495687_001703
341 Ga0495687_002788
342 Ga0495677_0198996
343 Ga0495677_0255475
344 Ga0495684_0387205
345 Ga0495593_0431926
346 Ga0495614_0219844
347 Ga0496100_0028809
348 Ga0496102_1793673
349 Ga0496121_0124914
350 Ga0501031_0017007
351 Ga0501031_0411180
352 Ga0501032_0182264
353 Ga0501033_0003583
354 Ga0501033_0859336
355 Ga0501036_0059587
356 Ga0501036_0303184
357 Ga0501039_0009636
358 Ga0501040_0009803
359 Ga0501041_0005792
360 Ga0501042_0038664
361 Ga0501043_0768238
362 Ga0501046_0486397
363 Ga0501048_0806364
364 Ga0501068_0107957
365 Ga0501069_0373410
366 Ga0501071_0031805
367 Ga0501074_0320188
368 Ga0501075_0015045
369 Ga0501077_0106311
370 Ga0501261_094124
371 Ga0501079_0084709
372 Ga0501080_0295137
373 Ga0501081_0342250
374 Ga0501035_0107432
375 Ga0501035_0163621
376 Ga0501045_0003457
377 nmdc:mga05p37_164928_c1
378 nmdc:mga09592_1057523_c1
379 nmdc:mga08y16_4166_c1
380 Ga0495601_0221724
381 Ga0495619_0008758
382 Ga0500566_0033585
383 Ga0500553_035785
384 Ga0501084_0013223
385 Ga0501084_0613587
386 Ga0466962_0048757
387 Ga0466962_0164986
388 Ga0530510_0003251
389 Ga0530510_0931675
390 2508674038
391 2616697262
392 2644441939
393 2710605875
394 2862180640
395 2862575259
396 2873319904
397 2891404004
398 3006323453

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02641

DUF190

Uncharacterized ACR, COG1993

8

103

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o51-assembly1.cif.gz_A crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution 0.9542 6 107
2dcl-assembly1.cif.gz_A-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.9489 8 111
1o51-assembly1.cif.gz_A crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution 0.944 6 107
2dcl-assembly1.cif.gz_B-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.9373 8 110
2dcl-assembly1.cif.gz_C-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.8884 1 105
ID Description Score Start End Superfamily
1o51A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9463 8 107 3.30.70.120
1o51A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9255 8 107 3.30.70.120
2dclC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8884 1 105 3.30.70.120
af_Q58919_1_108_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8784 7 112 3.30.70.120
2dclC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8712 1 105 3.30.70.120
ID Description Score Start End GO Terms
AF-Q2JPX2-F1-model_v4 Uncharacterized protein 0.9667 7 112
AF-A0A3D5SMG4-F1-model_v4 Uncharacterized protein 0.9655 15 110
AF-A0A4R4S9W5-F1-model_v4 DUF190 domain-containing protein 0.9639 6 105
AF-A0A810NKC7-F1-model_v4 UPF0166 protein 0.9631 1 107
AF-A0A7C2Z6Q3-F1-model_v4 DUF190 domain-containing protein 0.9621 7 108

Map