F305279

General Info

Members Datasets Scaffolds Average Seq Length
199 133 398 202

Family's Representative Sequence

Representative Sequence 3300004798|Ga0058859_11336445|Ga0058859_113364451
Length 226
Sequence MQIGPVTLEGRHVRLETVSLAHVPALWRAGAYEEIWRYIPYAMHSEDEMRAYVESELAKQQAGLVVRFTTVAKAIAEPVGSTSYLNIDRQHRRLEIGGTWITPAWQRSPVNTEAKYLQLRHAFETLGCIRVEFKTDSLNTKSRQALARIGAVEEGTFRNHMVMPSGRIRHSVYFSITSEDWPVVKAHLEQRMTAYTPSLETPSPCVRTSTASAAPGLPPRPSACPD

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
91 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
92 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 3.02
Rhizosphere 94.47
Stem 0
Stem Tuber 0
Unclassified 22.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11336445 3300004798 Bacteria 1266
2 JGI25407J50210_10009357 3300003373 Bacteria 2482
3 JGI25407J50210_10026979 3300003373 Bacteria 1489
4 JGI25407J50210_10098235 3300003373 Bacteria 724
5 Ga0068868_100087765 3300005338 Bacteria 2502
6 Ga0070687_100674493 3300005343 Unclassified 719
7 Ga0070668_100355152 3300005347 Bacteria 1241
8 Ga0070667_100728018 3300005367 Bacteria 919
9 Ga0070714_100000567 3300005435 Bacteria 26632
10 Ga0070713_100170375 3300005436 Unclassified 1950
11 Ga0070694_100171257 3300005444 Bacteria 1600
12 Ga0070708_100323446 3300005445 Bacteria 1453
13 Ga0070662_100212759 3300005457 Bacteria 1539
14 Ga0070706_100064713 3300005467 Unclassified 3380
15 Ga0070706_100110158 3300005467 Bacteria 2562
16 Ga0070706_100338464 3300005467 Bacteria 1403
17 Ga0070707_100060916 3300005468 Bacteria 3619
18 Ga0070707_100090975 3300005468 Bacteria 2954
19 Ga0070698_100001540 3300005471 Bacteria 25588
20 Ga0070698_100028372 3300005471 Bacteria 5814
21 Ga0070698_100064943 3300005471 Bacteria 3676
22 Ga0070698_100157797 3300005471 Bacteria 2214
23 Ga0070699_100005613 3300005518 Bacteria 11004
24 Ga0070697_100271610 3300005536 Bacteria 1453
25 Ga0070695_100483581 3300005545 Bacteria 955
26 Ga0070696_100000588 3300005546 Bacteria 23223
27 Ga0070696_100086192 3300005546 Bacteria 2230
28 Ga0070665_100001070 3300005548 Bacteria 34099
29 Ga0070704_100004044 3300005549 Bacteria 8472
30 Ga0070704_100543958 3300005549 Bacteria 1014
31 Ga0068856_100875562 3300005614 Bacteria 917
32 Ga0068861_100166003 3300005719 Bacteria 1826
33 Ga0068863_100138910 3300005841 Bacteria 2322
34 Ga0068860_100052494 3300005843 Bacteria 3878
35 Ga0068860_100165625 3300005843 Bacteria 2134
36 Ga0068862_100119761 3300005844 Bacteria 2319
37 Ga0068862_100128965 3300005844 Unclassified 2235
38 Ga0081455_10015741 3300005937 Bacteria 7325
39 Ga0081538_10000891 3300005981 Bacteria 32324
40 Ga0081538_10009311 3300005981 Bacteria 8215
41 Ga0081538_10011241 3300005981 Bacteria 7266
42 Ga0081538_10016374 3300005981 Bacteria 5688
43 Ga0081538_10093699 3300005981 Bacteria 1541
44 Ga0070716_100231689 3300006173 Unclassified 1247
45 Ga0075366_10412270 3300006195 Bacteria 832
46 Ga0075428_100001215 3300006844 Bacteria 27555
47 Ga0075428_100030659 3300006844 Bacteria 5946
48 Ga0075428_100070588 3300006844 Unclassified 3818
49 Ga0075428_100210358 3300006844 Unclassified 2102
50 Ga0075430_100126362 3300006846 Unclassified 2131
51 Ga0075431_100022360 3300006847 Bacteria 6464
52 Ga0075431_100090457 3300006847 Unclassified 3159
53 Ga0075433_10162680 3300006852 Unclassified 1986
54 Ga0075429_100085225 3300006880 Unclassified 2754
55 Ga0075429_100099743 3300006880 Unclassified 2534
56 Ga0075429_100336357 3300006880 Unclassified 1321
57 Ga0068865_100704102 3300006881 Bacteria 863
58 Ga0111539_10015867 3300009094 Bacteria 9358
59 Ga0105245_10125454 3300009098 Bacteria 2403
60 Ga0105245_10514678 3300009098 Unclassified 1214
61 Ga0105245_10700461 3300009098 Bacteria 1046
62 Ga0105247_10626637 3300009101 Bacteria 801
63 Ga0114129_10015111 3300009147 Bacteria 10986
64 Ga0114129_10038348 3300009147 Bacteria 6760
65 Ga0114129_10166209 3300009147 Unclassified 3011
66 Ga0114129_10175455 3300009147 Unclassified 2919
67 Ga0114129_10207543 3300009147 Bacteria 2650
68 Ga0105243_10536284 3300009148 Bacteria 1115
69 Ga0105242_11243992 3300009176 Bacteria 766
70 Ga0105248_10470924 3300009177 Bacteria 1416
71 Ga0105237_10023419 3300009545 Bacteria 6328
72 Ga0105249_10272603 3300009553 Bacteria 1686
73 Ga0105246_10029869 3300011119 Bacteria 3594
74 Ga0157378_10030140 3300013297 Bacteria 4793
75 Ga0157375_10137813 3300013308 Bacteria 2565
76 Ga0163163_10498618 3300014325 Bacteria 1279
77 Ga0157380_10449933 3300014326 Bacteria 1237
78 Ga0157379_10083640 3300014968 Bacteria 2860
79 Ga0213875_10016630 3300021388 Bacteria 3564
80 Ga0207645_10037800 3300025907 Unclassified 3098
81 Ga0207684_10136244 3300025910 Bacteria 2108
82 Ga0207671_10831081 3300025914 Unclassified 732
83 Ga0207660_10000001 3300025917 Bacteria 1034169
84 Ga0207646_10013164 3300025922 Bacteria 7917
85 Ga0207646_10314029 3300025922 Bacteria 1416
86 Ga0207650_10175216 3300025925 Bacteria 1707
87 Ga0207687_10064247 3300025927 Bacteria 2602
88 Ga0207700_10142730 3300025928 Unclassified 1970
89 Ga0207706_10188814 3300025933 Bacteria 1809
90 Ga0207658_10822177 3300025986 Bacteria 844
91 Ga0207703_11076842 3300026035 Unclassified 772
92 Ga0207708_10464847 3300026075 Bacteria 1056
93 Ga0207676_10295852 3300026095 Bacteria 1476
94 Ga0207675_100095584 3300026118 Bacteria 2796
95 Ga0209966_1015779 3300027695 Bacteria 1421
96 Ga0209998_10018024 3300027717 Bacteria 1497
97 Ga0209974_10066978 3300027876 Bacteria 1221
98 Ga0268266_10001079 3300028379 Bacteria 34163
99 Ga0268265_10083382 3300028380 Bacteria 2531
100 Ga0268264_10039767 3300028381 Bacteria 3885
101 Ga0268264_10449667 3300028381 Bacteria 1248
102 Ga0265334_10000010 3300028573 Bacteria 188179
103 Ga0265334_10028490 3300028573 Bacteria 2244
104 Ga0265334_10038650 3300028573 Bacteria 1876
105 Ga0265338_10008530 3300028800 Bacteria 12415
106 Ga0265338_10064938 3300028800 Bacteria 3170
107 Ga0265320_10009499 3300031240 Bacteria 5863
108 Ga0265325_10128156 3300031241 Unclassified 1217
109 Ga0265316_10615094 3300031344 Unclassified 770
110 Ga0265313_10000125 3300031595 Bacteria 77022
111 Ga0265313_10006864 3300031595 Bacteria 7935
112 Ga0307405_10235563 3300031731 Bacteria 1352
113 Ga0307410_10019689 3300031852 Bacteria 4110
114 Ga0307406_10018624 3300031901 Bacteria 4060
115 Ga0307407_10037577 3300031903 Bacteria 2676
116 Ga0307409_100018747 3300031995 Bacteria 4663
117 Ga0307409_100112192 3300031995 Bacteria 2289
118 Ga0307409_100815527 3300031995 Bacteria 942
119 Ga0307416_100500216 3300032002 Unclassified 1280
120 Ga0307414_10010899 3300032004 Bacteria 5304
121 Ga0307411_10752626 3300032005 Unclassified 854
122 Ga0307415_100013912 3300032126 Bacteria 4712
123 Ga0373937_0084157 3300036401 Bacteria 2943
124 Ga0395900_0177933 3300037418 Bacteria 2163
125 Ga0436364_1499254 3300037853 Bacteria 33218
126 Ga0451807_1112693 3300041486 Bacteria 1409
127 Ga0439443_050221 3300042003 Unclassified 729
128 Ga0439435_0011462 3300042436 Bacteria 2129
129 Ga0453683_0070929 3300044673 Unclassified 2179
130 Ga0453683_0216694 3300044673 Unclassified 1217
131 Ga0453683_0362378 3300044673 Bacteria 932
132 Ga0453684_0001133 3300044712 Bacteria 83416
133 Ga0453684_0251602 3300044712 Bacteria 2029
134 Ga0453684_0330808 3300044712 Bacteria 1723
135 Ga0451576_0000475 3300045051 Bacteria 90607
136 Ga0451576_0114436 3300045051 Bacteria 2808
137 Ga0451576_0497293 3300045051 Bacteria 1281
138 Ga0495580_0497471 3300046472 Bacteria 814
139 Ga0495686_0000322 3300047472 Bacteria 79695
140 Ga0496102_0249636 3300048905 Bacteria 1673
141 Ga0496103_0421406 3300048906 Bacteria 857
142 Ga0496110_0162050 3300048913 Bacteria 2028
143 Ga0496112_0000012 3300048915 Bacteria 243643
144 Ga0496114_0230028 3300048917 Unclassified 1629
145 Ga0501034_0139145 3300049571 Bacteria 2408
146 Ga0501038_0543275 3300049574 Bacteria 884
147 Ga0501039_0001762 3300049575 Bacteria 15979
148 Ga0501040_0003529 3300049576 Bacteria 10107
149 Ga0501040_0389936 3300049576 Unclassified 1000
150 Ga0501040_0657784 3300049576 Unclassified 757
151 Ga0501041_0447057 3300049577 Unclassified 820
152 Ga0501042_0011196 3300049578 Bacteria 6043
153 Ga0501042_0607730 3300049578 Bacteria 795
154 Ga0501043_0068765 3300049579 Bacteria 2781
155 Ga0501048_0017129 3300049582 Bacteria 5341
156 Ga0501048_0258876 3300049582 Bacteria 1236
157 Ga0501068_0009415 3300049584 Bacteria 5465
158 Ga0501069_0044133 3300049585 Unclassified 2468
159 Ga0501070_0066163 3300049586 Bacteria 2993
160 Ga0501071_0136722 3300049587 Unclassified 1824
161 Ga0501071_0355955 3300049587 Bacteria 1114
162 Ga0501072_0001058 3300049588 Bacteria 20393
163 Ga0501072_0292985 3300049588 Bacteria 1294
164 Ga0501072_0571165 3300049588 Bacteria 892
165 Ga0501072_0607097 3300049588 Bacteria 862
166 Ga0501074_0033037 3300049590 Bacteria 3750
167 Ga0501074_0532769 3300049590 Unclassified 832
168 Ga0501075_0090546 3300049591 Bacteria 2321
169 Ga0501076_0013339 3300049592 Bacteria 6161
170 Ga0501076_0253927 3300049592 Unclassified 1439
171 Ga0501077_0004306 3300049593 Bacteria 8616
172 Ga0501079_0004739 3300049741 Bacteria 10074
173 Ga0501079_0288133 3300049741 Bacteria 1284
174 Ga0501080_0190849 3300049742 Unclassified 1883
175 Ga0501081_0009465 3300049743 Bacteria 6351
176 Ga0501081_0427479 3300049743 Bacteria 982
177 Ga0501045_0008623 3300049824 Bacteria 7107
178 nmdc:mga0k408_118620_c1 3300050493 Bacteria 1566
179 nmdc:mga05p37_21811_c1 3300050507 Bacteria 7759
180 nmdc:mga05p37_3291_c1 3300050507 Bacteria 18843
181 nmdc:mga05p37_481326_c1 3300050507 Unclassified 1430
182 nmdc:mga05p37_66812_c1 3300050507 Bacteria 4423
183 nmdc:mga09592_127924_c1 3300050508 Unclassified 2184
184 nmdc:mga09592_26558_c1 3300050508 Unclassified 4798
185 nmdc:mga09592_7822_c1 3300050508 Bacteria 8687
186 nmdc:mga06r32_63683_c1 3300050510 Unclassified 3555
187 nmdc:mga06r32_71455_c1 3300050510 Unclassified 3358
188 nmdc:mga0n895_172815_c1 3300050512 Unclassified 2192
189 nmdc:mga0n895_268677_c1 3300050512 Unclassified 1730
190 nmdc:mga0rr50_143572_c1 3300050513 Bacteria 1922
191 nmdc:mga0a205_115460_c1 3300050515 Bacteria 2583
192 nmdc:mga0a205_299610_c1 3300050515 Unclassified 1481
193 nmdc:mga0a205_311406_c1 3300050515 Bacteria 1446
194 Ga0501084_0006377 3300054114 Bacteria 9691
195 Ga0501084_0559661 3300054114 Bacteria 966
196 Ga0501082_0034018 3300060353 Bacteria 4396
197 Ga0501082_0064728 3300060353 Bacteria 3149
198 Ga0501082_0924876 3300060353 Unclassified 763
199 Ga0530510_0001225 3300061734 Bacteria 17114
200 Ga0058859_11336445
201 JGI25407J50210_10009357
202 JGI25407J50210_10026979
203 JGI25407J50210_10098235
204 Ga0068868_100087765
205 Ga0070687_100674493
206 Ga0070668_100355152
207 Ga0070667_100728018
208 Ga0070714_100000567
209 Ga0070713_100170375
210 Ga0070694_100171257
211 Ga0070708_100323446
212 Ga0070662_100212759
213 Ga0070706_100064713
214 Ga0070706_100110158
215 Ga0070706_100338464
216 Ga0070707_100060916
217 Ga0070707_100090975
218 Ga0070698_100001540
219 Ga0070698_100028372
220 Ga0070698_100064943
221 Ga0070698_100157797
222 Ga0070699_100005613
223 Ga0070697_100271610
224 Ga0070695_100483581
225 Ga0070696_100000588
226 Ga0070696_100086192
227 Ga0070665_100001070
228 Ga0070704_100004044
229 Ga0070704_100543958
230 Ga0068856_100875562
231 Ga0068861_100166003
232 Ga0068863_100138910
233 Ga0068860_100052494
234 Ga0068860_100165625
235 Ga0068862_100119761
236 Ga0068862_100128965
237 Ga0081455_10015741
238 Ga0081538_10000891
239 Ga0081538_10009311
240 Ga0081538_10011241
241 Ga0081538_10016374
242 Ga0081538_10093699
243 Ga0070716_100231689
244 Ga0075366_10412270
245 Ga0075428_100001215
246 Ga0075428_100030659
247 Ga0075428_100070588
248 Ga0075428_100210358
249 Ga0075430_100126362
250 Ga0075431_100022360
251 Ga0075431_100090457
252 Ga0075433_10162680
253 Ga0075429_100085225
254 Ga0075429_100099743
255 Ga0075429_100336357
256 Ga0068865_100704102
257 Ga0111539_10015867
258 Ga0105245_10125454
259 Ga0105245_10514678
260 Ga0105245_10700461
261 Ga0105247_10626637
262 Ga0114129_10015111
263 Ga0114129_10038348
264 Ga0114129_10166209
265 Ga0114129_10175455
266 Ga0114129_10207543
267 Ga0105243_10536284
268 Ga0105242_11243992
269 Ga0105248_10470924
270 Ga0105237_10023419
271 Ga0105249_10272603
272 Ga0105246_10029869
273 Ga0157378_10030140
274 Ga0157375_10137813
275 Ga0163163_10498618
276 Ga0157380_10449933
277 Ga0157379_10083640
278 Ga0213875_10016630
279 Ga0207645_10037800
280 Ga0207684_10136244
281 Ga0207671_10831081
282 Ga0207660_10000001
283 Ga0207646_10013164
284 Ga0207646_10314029
285 Ga0207650_10175216
286 Ga0207687_10064247
287 Ga0207700_10142730
288 Ga0207706_10188814
289 Ga0207658_10822177
290 Ga0207703_11076842
291 Ga0207708_10464847
292 Ga0207676_10295852
293 Ga0207675_100095584
294 Ga0209966_1015779
295 Ga0209998_10018024
296 Ga0209974_10066978
297 Ga0268266_10001079
298 Ga0268265_10083382
299 Ga0268264_10039767
300 Ga0268264_10449667
301 Ga0265334_10000010
302 Ga0265334_10028490
303 Ga0265334_10038650
304 Ga0265338_10008530
305 Ga0265338_10064938
306 Ga0265320_10009499
307 Ga0265325_10128156
308 Ga0265316_10615094
309 Ga0265313_10000125
310 Ga0265313_10006864
311 Ga0307405_10235563
312 Ga0307410_10019689
313 Ga0307406_10018624
314 Ga0307407_10037577
315 Ga0307409_100018747
316 Ga0307409_100112192
317 Ga0307409_100815527
318 Ga0307416_100500216
319 Ga0307414_10010899
320 Ga0307411_10752626
321 Ga0307415_100013912
322 Ga0373937_0084157
323 Ga0395900_0177933
324 Ga0436364_1499254
325 Ga0451807_1112693
326 Ga0439443_050221
327 Ga0439435_0011462
328 Ga0453683_0070929
329 Ga0453683_0216694
330 Ga0453683_0362378
331 Ga0453684_0001133
332 Ga0453684_0251602
333 Ga0453684_0330808
334 Ga0451576_0000475
335 Ga0451576_0114436
336 Ga0451576_0497293
337 Ga0495580_0497471
338 Ga0495686_0000322
339 Ga0496102_0249636
340 Ga0496103_0421406
341 Ga0496110_0162050
342 Ga0496112_0000012
343 Ga0496114_0230028
344 Ga0501034_0139145
345 Ga0501038_0543275
346 Ga0501039_0001762
347 Ga0501040_0003529
348 Ga0501040_0389936
349 Ga0501040_0657784
350 Ga0501041_0447057
351 Ga0501042_0011196
352 Ga0501042_0607730
353 Ga0501043_0068765
354 Ga0501048_0017129
355 Ga0501048_0258876
356 Ga0501068_0009415
357 Ga0501069_0044133
358 Ga0501070_0066163
359 Ga0501071_0136722
360 Ga0501071_0355955
361 Ga0501072_0001058
362 Ga0501072_0292985
363 Ga0501072_0571165
364 Ga0501072_0607097
365 Ga0501074_0033037
366 Ga0501074_0532769
367 Ga0501075_0090546
368 Ga0501076_0013339
369 Ga0501076_0253927
370 Ga0501077_0004306
371 Ga0501079_0004739
372 Ga0501079_0288133
373 Ga0501080_0190849
374 Ga0501081_0009465
375 Ga0501081_0427479
376 Ga0501045_0008623
377 nmdc:mga0k408_118620_c1
378 nmdc:mga05p37_21811_c1
379 nmdc:mga05p37_3291_c1
380 nmdc:mga05p37_481326_c1
381 nmdc:mga05p37_66812_c1
382 nmdc:mga09592_127924_c1
383 nmdc:mga09592_26558_c1
384 nmdc:mga09592_7822_c1
385 nmdc:mga06r32_63683_c1
386 nmdc:mga06r32_71455_c1
387 nmdc:mga0n895_172815_c1
388 nmdc:mga0n895_268677_c1
389 nmdc:mga0rr50_143572_c1
390 nmdc:mga0a205_115460_c1
391 nmdc:mga0a205_299610_c1
392 nmdc:mga0a205_311406_c1
393 Ga0501084_0006377
394 Ga0501084_0559661
395 Ga0501082_0034018
396 Ga0501082_0064728
397 Ga0501082_0924876
398 Ga0530510_0001225

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

12

152

0.86

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

28

151

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z0z-assembly1.cif.gz_A-2 crystal structure of putative acetyltransferase 0.945 10 196
8gxf-assembly2.cif.gz_C pseudomonas flexibilis gcn5 family acetyltransferase 0.9444 9 196
2z10-assembly1.cif.gz_A crystal structure of putative acetyltransferase 0.9407 10 196
2zxv-assembly6.cif.gz_D crystal structure of putative acetyltransferase from t. thermophilus hb8 0.9387 10 196
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.9354 8 194
ID Description Score Start End Superfamily
2zxvD00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9387 10 196 3.40.630.30
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9354 8 194 3.40.630.30
1yreD00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9262 8 196 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9248 132 181 3.40.630.30
af_Q869N8_82_281_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9187 1 196 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A3D4ULC3-F1-model_v4 GNAT family N-acetyltransferase 0.9924 132 197 GO:0016740
AF-A0A3A4NWG9-F1-model_v4 N-acetyltransferase 0.9849 8 199 GO:0016747
AF-A0A7V9DGS3-F1-model_v4 GNAT family N-acetyltransferase 0.9846 9 199 GO:0016747
AF-A0A7Y5CTX9-F1-model_v4 GNAT family N-acetyltransferase 0.9844 8 198 GO:0016747
AF-A0A7W9E0R2-F1-model_v4 RimJ/RimL family protein N-acetyltransferase 0.9842 75 194 GO:0016747

Map