F303182

General Info

Members Datasets Scaffolds Average Seq Length
197 154 185 209

Family's Representative Sequence

Representative Sequence 3300027543|Ga0209999_1021550|Ga0209999_10215501
Length 237
Sequence MNTSTAARLQVIFVVEAPPPGVLFAVQSGRDGRTWTIAGLLGGVLATSAIAGARDDLSAFTKGLKGLDGQFSQQVYDANGKLKESSSGRVALAAPRLFRWEYVKPYEQLIVADGQRVWVYDPDLQQATRRAQGTEEQNSPLAALIDPSRLDRDYVIKEAGSADGLEWLALSPKKDSDAGFQSARLGFGAHGLATMQVVDALGQKTQIKFSGWQRNPVFATSTFRFTPPKGVDVVGEG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2818991457 Xanthomonas translucens 569 Isolate Unclassified
4 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
5 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
6 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
7 2919513703 Luteimonas sp. 3794 Isolate Unclassified
8 2919675420 Luteimonas terrae 4099 Isolate Unclassified
9 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
10 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
52 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
84 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
85 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
100 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
103 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
104 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
105 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
106 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
107 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
108 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
109 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
112 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
115 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
116 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
122 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
129 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
130 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
131 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
136 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
137 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
138 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
139 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
140 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
141 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
142 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
143 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
144 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
145 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
146 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
150 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
151 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
152 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
153 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
154 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.4
Metatranscriptomes 0.51
Isolates 6.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.14
Nodule 0
Rhizoplane 6.6
Rhizosphere 72.59
Stem 0
Stem Tuber 0
Unclassified 11.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2226090 2162886007 Bacteria 4141
2 MBSR1b_contig_4155204 2162886012 Bacteria 1888
3 JGI25152J39213_1000588 3300002773 Bacteria 19647
4 JGI25150J39212_1000450 3300002774 Bacteria 18199
5 JGI25151J46595_10000176 3300003187 Bacteria 82143
6 JGI25153J46596_10000129 3300003215 Bacteria 82143
7 rootH2_10053184 3300003320 Bacteria 1355
8 rootH1_10240061 3300003323 Bacteria 1206
9 JGI26145J50221_1001923 3300003371 Bacteria 1631
10 Ga0055531_10002284 3300003794 Bacteria 12963
11 Ga0055531_10012426 3300003794 Bacteria 4006
12 Ga0058692_1000029 3300003856 Bacteria 189475
13 Ga0065714_10015838 3300005288 Bacteria 3499
14 Ga0065704_10008027 3300005289 Bacteria 3679
15 Ga0065704_10074950 3300005289 Bacteria 5888
16 Ga0065715_10004951 3300005293 Bacteria 5413
17 Ga0070670_100038421 3300005331 Bacteria 4116
18 Ga0070670_100109000 3300005331 Bacteria 2386
19 Ga0070670_100243560 3300005331 Bacteria 1566
20 Ga0068869_100249888 3300005334 Bacteria 1416
21 Ga0070660_100027949 3300005339 Bacteria 4215
22 Ga0070660_100075805 3300005339 Bacteria 2634
23 Ga0070675_100622052 3300005354 Bacteria 980
24 Ga0070674_100243877 3300005356 Bacteria 1408
25 Ga0070667_100386521 3300005367 Bacteria 1272
26 Ga0070701_10153352 3300005438 Bacteria 1328
27 Ga0070662_100762203 3300005457 Bacteria 821
28 Ga0070681_10201302 3300005458 Bacteria 1909
29 Ga0070679_100181396 3300005530 Bacteria 2077
30 Ga0070679_100274614 3300005530 Bacteria 1639
31 Ga0070672_100003251 3300005543 Bacteria 10519
32 Ga0070672_100197269 3300005543 Bacteria 1682
33 Ga0070665_100218800 3300005548 Bacteria 1905
34 Ga0070665_100974911 3300005548 Bacteria 860
35 Ga0070664_100714630 3300005564 Bacteria 934
36 Ga0105251_10000139 3300009011 Bacteria 74032
37 Ga0105240_10006350 3300009093 Bacteria 17408
38 Ga0105245_10016726 3300009098 Bacteria 6405
39 Ga0105245_10479807 3300009098 Bacteria 1257
40 Ga0105243_10035490 3300009148 Bacteria 3866
41 Ga0105248_10056463 3300009177 Bacteria 4405
42 Ga0105239_10405818 3300010375 Bacteria 1542
43 Ga0157318_1000478 3300012482 Bacteria 1715
44 Ga0157373_10132173 3300013100 Bacteria 1755
45 Ga0157371_10024741 3300013102 Bacteria 4381
46 Ga0157370_10511864 3300013104 Bacteria 1102
47 Ga0157369_10037688 3300013105 Bacteria 5292
48 Ga0157369_10274603 3300013105 Bacteria 1756
49 Ga0157374_10022440 3300013296 Bacteria 5631
50 Ga0157372_10601482 3300013307 Bacteria 1282
51 Ga0157375_10003810 3300013308 Bacteria 13074
52 Ga0157375_11238431 3300013308 Bacteria 876
53 Ga0157375_11772042 3300013308 Bacteria 732
54 Ga0182006_1010907 3300015261 Bacteria 4020
55 Ga0182006_1011377 3300015261 Bacteria 3917
56 Ga0182005_1003331 3300015265 Bacteria 5476
57 Ga0183360_10001 3300015689 Bacteria 3943671
58 Ga0207425_1000011 3300025245 Bacteria 550735
59 Ga0209129_1000044 3300025258 Bacteria 298971
60 Ga0209565_1003336 3300025263 Bacteria 5248
61 Ga0209025_1000012 3300025294 Bacteria 924362
62 Ga0209758_1000018 3300025297 Bacteria 753320
63 Ga0209257_1000121 3300025304 Bacteria 222588
64 Ga0209257_1000145 3300025304 Bacteria 195152
65 Ga0207713_1010202 3300025735 Bacteria 5217
66 Ga0207705_10054997 3300025909 Bacteria 2869
67 Ga0207695_10005278 3300025913 Bacteria 17223
68 Ga0207657_10033066 3300025919 Bacteria 4666
69 Ga0207657_10234648 3300025919 Bacteria 1466
70 Ga0207649_10119910 3300025920 Bacteria 1772
71 Ga0207650_10131329 3300025925 Bacteria 1960
72 Ga0207687_10292128 3300025927 Bacteria 1310
73 Ga0207644_10644719 3300025931 Bacteria 881
74 Ga0207691_10006885 3300025940 Bacteria 10967
75 Ga0207691_10165065 3300025940 Bacteria 1941
76 Ga0207711_10037051 3300025941 Bacteria 4141
77 Ga0207689_10118576 3300025942 Bacteria 2177
78 Ga0207679_10130856 3300025945 Bacteria 2013
79 Ga0207668_10420033 3300025972 Bacteria 1135
80 Ga0207658_10349101 3300025986 Bacteria 1288
81 Ga0209371_1000072 3300027312 Bacteria 199942
82 Ga0209984_1009321 3300027424 Bacteria 1246
83 Ga0210000_1031345 3300027462 Bacteria 832
84 Ga0209995_1042414 3300027471 Bacteria 769
85 Ga0209999_1021550 3300027543 Bacteria 1183
86 Ga0209982_1000708 3300027552 Bacteria 4250
87 Ga0210002_1028131 3300027617 Bacteria 927
88 Ga0209974_10027082 3300027876 Bacteria 1896
89 Ga0268266_10086564 3300028379 Bacteria 2740
90 Ga0307515_10139799 3300028794 Bacteria 2605
91 Ga0268256_1000065 3300030500 Bacteria 199943
92 Ga0316177_1009331 3300030731 Bacteria 5896
93 Ga0314311_1005764 3300030733 Bacteria 11917
94 Ga0307513_10009489 3300031456 Bacteria 12307
95 Ga0307413_10057491 3300031824 Bacteria 2379
96 Ga0307413_10201212 3300031824 Bacteria 1438
97 Ga0307410_10085101 3300031852 Bacteria 2230
98 Ga0307410_10568907 3300031852 Bacteria 941
99 Ga0307407_10186468 3300031903 Bacteria 1379
100 Ga0307409_100147530 3300031995 Bacteria 2036
101 Ga0307416_100461793 3300032002 Bacteria 1325
102 Ga0307416_100559140 3300032002 Bacteria 1218
103 Ga0307414_10004134 3300032004 Bacteria 7837
104 Ga0307414_10006139 3300032004 Bacteria 6674
105 Ga0307414_10021796 3300032004 Bacteria 4030
106 Ga0307414_10029507 3300032004 Bacteria 3571
107 Ga0307414_10052450 3300032004 Bacteria 2838
108 Ga0307414_10122439 3300032004 Bacteria 2002
109 Ga0307414_10211127 3300032004 Bacteria 1587
110 Ga0307414_10508185 3300032004 Bacteria 1067
111 Ga0307414_10631182 3300032004 Bacteria 964
112 Ga0307414_10792951 3300032004 Bacteria 863
113 Ga0307411_10282145 3300032005 Bacteria 1322
114 Ga0307411_10304894 3300032005 Bacteria 1279
115 Ga0307411_10590373 3300032005 Bacteria 953
116 Ga0307411_10903822 3300032005 Bacteria 785
117 Ga0307415_100400251 3300032126 Bacteria 1172
118 Ga0373937_0528422 3300036401 Bacteria 1121
119 Ga0395899_0431076 3300037312 Bacteria 867
120 Ga0395900_0200916 3300037418 Bacteria 2017
121 Ga0395905_0169176 3300037471 Bacteria 2053
122 Ga0237819_00005 3300038705 Bacteria 79509
123 Ga0439436_0011778 3300041404 Bacteria 2654
124 Ga0439436_0052328 3300041404 Bacteria 1152
125 Ga0439465_0007495 3300041413 Bacteria 3470
126 Ga0451789_1244279 3300041443 Bacteria 1050
127 Ga0451791_0343712 3300041451 Bacteria 1121
128 Ga0451791_0752854 3300041451 Bacteria 934
129 Ga0451791_0884506 3300041451 Bacteria 1313
130 Ga0451793_0092813 3300041452 Bacteria 1135
131 Ga0451793_0321361 3300041452 Bacteria 4205
132 Ga0451797_1025149 3300041453 Bacteria 1091
133 Ga0451795_1273630 3300041456 Bacteria 905
134 Ga0451800_0431673 3300041459 Bacteria 5114
135 Ga0451802_0822701 3300041460 Bacteria 803
136 Ga0451804_1078234 3300041463 Bacteria 2288
137 Ga0451807_0431549 3300041486 Bacteria 4072
138 Ga0451807_2676477 3300041486 Bacteria 1362
139 Ga0451839_1525391 3300041496 Bacteria 1234
140 Ga0451843_0804496 3300041509 Bacteria 1271
141 Ga0451853_1873576 3300041512 Bacteria 990
142 Ga0439431_0112981 3300041997 Bacteria 753
143 Ga0439445_0007909 3300042004 Bacteria 2478
144 Ga0439432_044015 3300042006 Bacteria 1407
145 Ga0439449_0001458 3300042007 Bacteria 9259
146 Ga0439449_0004280 3300042007 Bacteria 5513
147 Ga0439449_0054640 3300042007 Bacteria 1475
148 Ga0439455_0099208 3300042012 Bacteria 804
149 Ga0439434_0051317 3300042435 Bacteria 1279
150 Ga0466965_0487659 3300044683 Bacteria 690
151 Ga0495663_0000202 3300046525 Bacteria 23728
152 Ga0495663_0077565 3300046525 Bacteria 1066
153 Ga0495621_0050301 3300046539 Bacteria 1489
154 Ga0495633_0014880 3300046558 Bacteria 4047
155 Ga0495671_0032115 3300046692 Bacteria 2681
156 Ga0495636_0027860 3300047318 Bacteria 2301
157 Ga0496117_0000330 3300048920 Bacteria 83673
158 Ga0496119_0000240 3300048922 Bacteria 77404
159 Ga0496120_0000011 3300048923 Bacteria 365549
160 Ga0496122_0000189 3300048925 Bacteria 142792
161 Ga0496122_0026046 3300048925 Bacteria 5059
162 Ga0496123_0000068 3300048926 Bacteria 208797
163 Ga0496123_0041095 3300048926 Bacteria 3210
164 Ga0496124_0000433 3300048927 Bacteria 74353
165 Ga0496126_0113207 3300048929 Bacteria 2362
166 Ga0501306_038463 3300049127 Bacteria 735
167 Ga0501034_0000923 3300049571 Bacteria 42924
168 Ga0501223_011003 3300049663 Bacteria 1816
169 Ga0501235_067972 3300049669 Bacteria 840
170 Ga0501242_011875 3300049674 Bacteria 1056
171 Ga0501247_032397 3300049677 Bacteria 719
172 Ga0501250_019156 3300049680 Bacteria 873
173 Ga0501251_023297 3300049681 Bacteria 838
174 Ga0501257_043230 3300049686 Bacteria 1110
175 Ga0501225_0001447 3300049705 Bacteria 7427
176 Ga0501266_002338 3300049763 Bacteria 2399
177 Ga0501266_035779 3300049763 Bacteria 723
178 Ga0501268_025754 3300049765 Bacteria 1035
179 Ga0501276_013104 3300049773 Bacteria 723
180 Ga0501212_049819 3300049851 Bacteria 708
181 nmdc:mga00v17_94341_c1 3300050491 Bacteria 1883
182 nmdc:mga00v17_97218_c1 3300050491 Bacteria 1856
183 nmdc:mga0yw44_528685_c1 3300050492 Bacteria 800
184 Ga0500634_0000217 3300053161 Bacteria 18600
185 Ga0500609_024647 3300053731 Bacteria 824

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0487659 Ga0466965_0487659_91_675 194
2 3300041512 Ga0451853_1873576 Ga0451853_1873576_131_757 196
3 3300013308 Ga0157375_11772042 Ga0157375_117720421 200
4 3300003371 JGI26145J50221_1001923 JGI26145J50221_10019231 201
5 3300027471 Ga0209995_1042414 Ga0209995_10424141 201
6 iso_pu_bacteria 2894414249 2894415625 203
7 iso_pu_bacteria 2919513703 2919514709 203
8 iso_pu_bacteria 2919675420 2919676754 203
9 iso_pu_bacteria 8002869464 8002872067 203
10 3300005543 Ga0070672_100197269 Ga0070672_1001972692 204
11 3300025940 Ga0207691_10165065 Ga0207691_101650652 204
12 3300027552 Ga0209982_1000708 Ga0209982_10007082 204
13 iso_pu_bacteria 2818991457 2819663912 204
14 iso_pu_bacteria 2852684882 2852685679 204
15 iso_pu_bacteria 2919130084 2919131820 204
16 iso_pu_bacteria 2929195423 2929197809 204
17 iso_pu_bacteria 8021622325 8021625583 204
18 iso_pu_bacteria 8021626552 8021629005 204
19 iso_pu_bacteria 8021648035 8021649943 204
20 3300003794 Ga0055531_10002284 Ga0055531_100022847 205
21 3300005288 Ga0065714_10015838 Ga0065714_100158382 205
22 3300005293 Ga0065715_10004951 Ga0065715_100049512 205
23 3300025304 Ga0209257_1000121 Ga0209257_100012160 205
24 3300027617 Ga0210002_1028131 Ga0210002_10281311 205
25 3300027876 Ga0209974_10027082 Ga0209974_100270822 205
26 3300031824 Ga0307413_10201212 Ga0307413_102012122 205
27 3300031852 Ga0307410_10085101 Ga0307410_100851012 205
28 3300031903 Ga0307407_10186468 Ga0307407_101864681 205
29 3300031995 Ga0307409_100147530 Ga0307409_1001475302 205
30 3300032002 Ga0307416_100559140 Ga0307416_1005591402 205
31 3300032004 Ga0307414_10792951 Ga0307414_107929511 205
32 3300032005 Ga0307411_10282145 Ga0307411_102821452 205
33 3300032126 Ga0307415_100400251 Ga0307415_1004002511 205
34 3300041451 Ga0451791_0884506 Ga0451791_0884506_618_1235 205
35 3300041509 Ga0451843_0804496 Ga0451843_0804496_446_1066 205
36 3300042006 Ga0439432_044015 Ga0439432_044015_606_1226 205
37 3300042007 Ga0439449_0004280 Ga0439449_0004280_1106_1726 205
38 3300047318 Ga0495636_0027860 Ga0495636_0027860_911_1531 205
39 3300049669 Ga0501235_067972 Ga0501235_067972_77_694 205
40 3300049674 Ga0501242_011875 Ga0501242_011875_385_1002 205
41 3300049677 Ga0501247_032397 Ga0501247_032397_36_653 205
42 3300049680 Ga0501250_019156 Ga0501250_019156_210_827 205
43 3300049763 Ga0501266_002338 Ga0501266_002338_319_936 205
44 3300049765 Ga0501268_025754 Ga0501268_025754_244_861 205
45 3300049773 Ga0501276_013104 Ga0501276_013104_71_688 205
46 3300049851 Ga0501212_049819 Ga0501212_049819_81_698 205
47 2162886012 MBSR1b_contig_4155204 MBSR1b_0287.00006160 206
48 3300003794 Ga0055531_10012426 Ga0055531_100124261 206
49 3300005331 Ga0070670_100038421 Ga0070670_1000384212 206
50 3300005339 Ga0070660_100027949 Ga0070660_1000279493 206
51 3300005339 Ga0070660_100075805 Ga0070660_1000758052 206
52 3300005354 Ga0070675_100622052 Ga0070675_1006220522 206
53 3300005356 Ga0070674_100243877 Ga0070674_1002438772 206
54 3300005367 Ga0070667_100386521 Ga0070667_1003865212 206
55 3300005438 Ga0070701_10153352 Ga0070701_101533521 206
56 3300005457 Ga0070662_100762203 Ga0070662_1007622031 206
57 3300005458 Ga0070681_10201302 Ga0070681_102013022 206
58 3300005530 Ga0070679_100181396 Ga0070679_1001813963 206
59 3300005530 Ga0070679_100274614 Ga0070679_1002746142 206
60 3300005543 Ga0070672_100003251 Ga0070672_1000032513 206
61 3300005548 Ga0070665_100218800 Ga0070665_1002188002 206
62 3300005564 Ga0070664_100714630 Ga0070664_1007146302 206
63 3300013100 Ga0157373_10132173 Ga0157373_101321731 206
64 3300013102 Ga0157371_10024741 Ga0157371_100247415 206
65 3300013104 Ga0157370_10511864 Ga0157370_105118642 206
66 3300013105 Ga0157369_10037688 Ga0157369_100376883 206
67 3300025304 Ga0209257_1000145 Ga0209257_1000145140 206
68 3300025909 Ga0207705_10054997 Ga0207705_100549972 206
69 3300025919 Ga0207657_10033066 Ga0207657_100330663 206
70 3300025919 Ga0207657_10234648 Ga0207657_102346482 206
71 3300025920 Ga0207649_10119910 Ga0207649_101199102 206
72 3300025940 Ga0207691_10006885 Ga0207691_100068859 206
73 3300025945 Ga0207679_10130856 Ga0207679_101308562 206
74 3300025986 Ga0207658_10349101 Ga0207658_103491012 206
75 3300027424 Ga0209984_1009321 Ga0209984_10093211 206
76 3300027462 Ga0210000_1031345 Ga0210000_10313451 206
77 3300028379 Ga0268266_10086564 Ga0268266_100865642 206
78 3300028794 Ga0307515_10139799 Ga0307515_101397992 206
79 3300030731 Ga0316177_1009331 Ga0316177_10093314 206
80 3300030733 Ga0314311_1005764 Ga0314311_100576410 206
81 3300031456 Ga0307513_10009489 Ga0307513_100094894 206
82 3300031852 Ga0307410_10568907 Ga0307410_105689072 206
83 3300032002 Ga0307416_100461793 Ga0307416_1004617932 206
84 3300032004 Ga0307414_10004134 Ga0307414_100041343 206
85 3300032004 Ga0307414_10006139 Ga0307414_100061397 206
86 3300032004 Ga0307414_10021796 Ga0307414_100217962 206
87 3300032004 Ga0307414_10029507 Ga0307414_100295072 206
88 3300032004 Ga0307414_10052450 Ga0307414_100524502 206
89 3300032004 Ga0307414_10122439 Ga0307414_101224392 206
90 3300032004 Ga0307414_10211127 Ga0307414_102111271 206
91 3300032004 Ga0307414_10508185 Ga0307414_105081852 206
92 3300032005 Ga0307411_10304894 Ga0307411_103048942 206
93 3300032005 Ga0307411_10590373 Ga0307411_105903732 206
94 3300032005 Ga0307411_10903822 Ga0307411_109038221 206
95 3300041404 Ga0439436_0052328 Ga0439436_0052328_45_668 206
96 3300041443 Ga0451789_1244279 Ga0451789_1244279_414_1037 206
97 3300041451 Ga0451791_0752854 Ga0451791_0752854_144_767 206
98 3300041452 Ga0451793_0092813 Ga0451793_0092813_249_872 206
99 3300041453 Ga0451797_1025149 Ga0451797_1025149_299_940 206
100 3300041456 Ga0451795_1273630 Ga0451795_1273630_114_749 206
101 3300041460 Ga0451802_0822701 Ga0451802_0822701_45_668 206
102 3300041486 Ga0451807_2676477 Ga0451807_2676477_481_1116 206
103 3300041997 Ga0439431_0112981 Ga0439431_0112981_76_699 206
104 3300042007 Ga0439449_0054640 Ga0439449_0054640_399_1019 206
105 3300042435 Ga0439434_0051317 Ga0439434_0051317_488_1111 206
106 3300046525 Ga0495663_0000202 Ga0495663_0000202_7540_8178 206
107 3300046539 Ga0495621_0050301 Ga0495621_0050301_126_746 206
108 3300046692 Ga0495671_0032115 Ga0495671_0032115_1828_2466 206
109 3300048925 Ga0496122_0026046 Ga0496122_0026046_1022_1657 206
110 3300048926 Ga0496123_0041095 Ga0496123_0041095_1054_1689 206
111 3300048929 Ga0496126_0113207 Ga0496126_0113207_333_968 206
112 3300049127 Ga0501306_038463 Ga0501306_038463_102_725 206
113 3300049571 Ga0501034_0000923 Ga0501034_0000923_27240_27860 206
114 3300049663 Ga0501223_011003 Ga0501223_011003_280_903 206
115 3300049681 Ga0501251_023297 Ga0501251_023297_132_755 206
116 3300049686 Ga0501257_043230 Ga0501257_043230_134_757 206
117 3300049705 Ga0501225_0001447 Ga0501225_0001447_6509_7129 206
118 3300049763 Ga0501266_035779 Ga0501266_035779_87_710 206
119 3300053731 Ga0500609_024647 Ga0500609_024647_114_752 206
120 iso_pu_bacteria 2995948881 2995951917 206
121 3300002773 JGI25152J39213_1000588 JGI25152J39213_10005887 207
122 3300002774 JGI25150J39212_1000450 JGI25150J39212_100045013 207
123 3300003187 JGI25151J46595_10000176 JGI25151J46595_1000017613 207
124 3300003215 JGI25153J46596_10000129 JGI25153J46596_1000012913 207
125 3300003320 rootH2_10053184 rootH2_100531841 207
126 3300003323 rootH1_10240061 rootH1_102400611 207
127 3300005289 Ga0065704_10008027 Ga0065704_100080272 207
128 3300005331 Ga0070670_100243560 Ga0070670_1002435602 207
129 3300005334 Ga0068869_100249888 Ga0068869_1002498881 207
130 3300009093 Ga0105240_10006350 Ga0105240_100063503 207
131 3300009098 Ga0105245_10016726 Ga0105245_100167266 207
132 3300009098 Ga0105245_10479807 Ga0105245_104798072 207
133 3300009177 Ga0105248_10056463 Ga0105248_100564635 207
134 3300010375 Ga0105239_10405818 Ga0105239_104058182 207
135 3300012482 Ga0157318_1000478 Ga0157318_10004782 207
136 3300013105 Ga0157369_10274603 Ga0157369_102746032 207
137 3300013296 Ga0157374_10022440 Ga0157374_100224406 207
138 3300013307 Ga0157372_10601482 Ga0157372_106014821 207
139 3300013308 Ga0157375_10003810 Ga0157375_100038107 207
140 3300013308 Ga0157375_11238431 Ga0157375_112384312 207
141 3300015689 Ga0183360_10001 Ga0183360_100011336 207
142 3300025245 Ga0207425_1000011 Ga0207425_1000011109 207
143 3300025258 Ga0209129_1000044 Ga0209129_100004478 207
144 3300025263 Ga0209565_1003336 Ga0209565_10033365 207
145 3300025294 Ga0209025_1000012 Ga0209025_1000012422 207
146 3300025297 Ga0209758_1000018 Ga0209758_1000018235 207
147 3300025913 Ga0207695_10005278 Ga0207695_100052783 207
148 3300025927 Ga0207687_10292128 Ga0207687_102921281 207
149 3300025931 Ga0207644_10644719 Ga0207644_106447191 207
150 3300025941 Ga0207711_10037051 Ga0207711_100370515 207
151 3300025942 Ga0207689_10118576 Ga0207689_101185762 207
152 3300025972 Ga0207668_10420033 Ga0207668_104200332 207
153 3300027543 Ga0209999_1021550 Ga0209999_10215501 207
154 3300031824 Ga0307413_10057491 Ga0307413_100574913 207
155 3300032004 Ga0307414_10631182 Ga0307414_106311821 207
156 3300036401 Ga0373937_0528422 Ga0373937_0528422_352_1050 207
157 3300037312 Ga0395899_0431076 Ga0395899_0431076_208_849 207
158 3300037418 Ga0395900_0200916 Ga0395900_0200916_1298_1939 207
159 3300037471 Ga0395905_0169176 Ga0395905_0169176_1098_1739 207
160 3300038705 Ga0237819_00005 Ga0237819_00005_44083_44706 207
161 3300041404 Ga0439436_0011778 Ga0439436_0011778_872_1534 207
162 3300041413 Ga0439465_0007495 Ga0439465_0007495_2693_3316 207
163 3300042004 Ga0439445_0007909 Ga0439445_0007909_1825_2448 207
164 3300042007 Ga0439449_0001458 Ga0439449_0001458_8510_9133 207
165 3300042012 Ga0439455_0099208 Ga0439455_0099208_85_726 207
166 3300046525 Ga0495663_0077565 Ga0495663_0077565_365_1042 207
167 3300050491 nmdc:mga00v17_94341_c1 nmdc:mga00v17_94341_c1_762_1403 207
168 3300050491 nmdc:mga00v17_97218_c1 nmdc:mga00v17_97218_c1_718_1359 207
169 3300050492 nmdc:mga0yw44_528685_c1 nmdc:mga0yw44_528685_c1_123_764 207
170 2162886007 SwRhRL2b_contig_2226090 SwRhRL2b_0225.00001060 208
171 3300003856 Ga0058692_1000029 Ga0058692_100002991 208
172 3300005289 Ga0065704_10074950 Ga0065704_100749504 208
173 3300005331 Ga0070670_100109000 Ga0070670_1001090002 208
174 3300005548 Ga0070665_100974911 Ga0070665_1009749112 208
175 3300009011 Ga0105251_10000139 Ga0105251_1000013957 208
176 3300009148 Ga0105243_10035490 Ga0105243_100354903 208
177 3300015261 Ga0182006_1010907 Ga0182006_10109072 208
178 3300015261 Ga0182006_1011377 Ga0182006_10113772 208
179 3300015265 Ga0182005_1003331 Ga0182005_10033313 208
180 3300025735 Ga0207713_1010202 Ga0207713_10102023 208
181 3300025925 Ga0207650_10131329 Ga0207650_101313292 208
182 3300027312 Ga0209371_1000072 Ga0209371_100007275 208
183 3300030500 Ga0268256_1000065 Ga0268256_100006575 208
184 3300041451 Ga0451791_0343712 Ga0451791_0343712_89_715 208
185 3300041452 Ga0451793_0321361 Ga0451793_0321361_909_1535 208
186 3300041459 Ga0451800_0431673 Ga0451800_0431673_1904_2530 208
187 3300041463 Ga0451804_1078234 Ga0451804_1078234_504_1130 208
188 3300041486 Ga0451807_0431549 Ga0451807_0431549_1693_2319 208
189 3300041496 Ga0451839_1525391 Ga0451839_1525391_222_848 208
190 3300046558 Ga0495633_0014880 Ga0495633_0014880_3031_3660 208
191 3300048920 Ga0496117_0000330 Ga0496117_0000330_1696_2322 208
192 3300048922 Ga0496119_0000240 Ga0496119_0000240_74303_74929 208
193 3300048923 Ga0496120_0000011 Ga0496120_0000011_362360_362986 208
194 3300048925 Ga0496122_0000189 Ga0496122_0000189_2795_3421 208
195 3300048926 Ga0496123_0000068 Ga0496123_0000068_68774_69400 208
196 3300048927 Ga0496124_0000433 Ga0496124_0000433_71094_71720 208
197 3300053161 Ga0500634_0000217 Ga0500634_0000217_2018_2647 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03548

LolA

Outer membrane lipoprotein carrier protein LolA

62

226

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8orn-assembly2.cif.gz_C crystal structure of xanthomonas campestris pv. campestris lola-lolb complex 0.9518 22 208
8orn-assembly2.cif.gz_C crystal structure of xanthomonas campestris pv. campestris lola-lolb complex 0.9419 22 208
8v1k-assembly2.cif.gz_B crystal structure of outer membrane lipoprotein carrier protein (lola) from francisella tularensis 0.8262 26 207
8chx-assembly1.cif.gz_B structure and function of lola from vibrio cholerae 0.8221 26 206
7z6x-assembly1.cif.gz_A complex of e. coli lola r43l mutant and lipoprotein 0.8215 23 206
ID Description Score Start End Superfamily
af_Q95QW3_19_102_2.10.60.10 Mainly Beta;Ribbon;CD59;CD59 0.8621 38 59 2.10.60.10
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.8054 23 208 2.50.20.10
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7974 23 208 2.50.20.10
2w7qB00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7767 23 207 2.50.20.10
2w7qB00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7656 23 207 2.50.20.10
ID Description Score Start End GO Terms
AF-A0A1B2N440-F1-model_v4 deleted 0.9 1 207
AF-A0A3B9PLS1-F1-model_v4 Outer-membrane lipoprotein carrier protein 0.8964 22 208 GO:0042597
GO:0042953
AF-A0A0S8DXW6-F1-model_v4 Outer-membrane lipoprotein carrier protein 0.8961 23 207 GO:0042597
GO:0042953
GO:0044874
AF-A0A1F4BUG3-F1-model_v4 deleted 0.8955 37 207
AF-A0A1E4L6Y9-F1-model_v4 Outer-membrane lipoprotein carrier protein 0.892 19 207 GO:0030288
GO:0042953
GO:0044874

Feature Viewer

pLDDT pTM Quality
85.92 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map