F302136

General Info

Members Datasets Scaffolds Average Seq Length
196 127 392 248

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0037769|Ga0501034_0037769_1353_2327
Length 295
Sequence MADQRDPFLLPGDEPPAGEKLQKFLSAAGVASRRHAEVMIRQGRVTVNGEVATLGMRVVEGDEVRVGGVEVGPQAARFFLLNKPTGVVTTLDDPQGRPTVAGLVPADVRVYPVGRLDVDTSGLLLLTNDGELAHRLMHPSFGVEKTYRVLVEGGVGAATARQLAEGVELEDGMTAPANAKVVDAGARRSVLELTIHEGRNRQVRRMCAAVGHPVLELVRVAYGPLRLAGVAPGEHRVLTDQEVRRLRKAAGLAPARHDEARGGSQELVDGERDRDAEPAAPGGRGRRERPDGKRR

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
36 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
37 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
40 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
43 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
44 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
45 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
46 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
47 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
51 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
54 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
55 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
56 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
57 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
58 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
59 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
64 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
65 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
66 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
67 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
68 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
69 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
72 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
73 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
74 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
75 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
76 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
81 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
82 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
96 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
104 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
105 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
119 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
120 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
121 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
122 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
123 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
127 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.1
Nodule 0
Rhizoplane 2.04
Rhizosphere 84.69
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0037769 3300049571 Bacteria 4891
2 JGI25406J46586_10058964 3300003203 Bacteria 1249
3 Ga0068869_100018798 3300005334 Bacteria 4711
4 Ga0070668_100329785 3300005347 Bacteria 1287
5 Ga0070671_100025585 3300005355 Bacteria 4844
6 Ga0070708_100080677 3300005445 Bacteria 2944
7 Ga0070706_100076524 3300005467 Unclassified 3097
8 Ga0070707_100100017 3300005468 Bacteria 2809
9 Ga0070707_100129022 3300005468 Bacteria 2458
10 Ga0070707_100615198 3300005468 Bacteria 1049
11 Ga0070696_100414419 3300005546 Bacteria 1056
12 Ga0068855_100381376 3300005563 Bacteria 1548
13 Ga0068858_100105283 3300005842 Bacteria 2632
14 Ga0081455_10006732 3300005937 Bacteria 12271
15 Ga0081455_10059730 3300005937 Bacteria 3217
16 Ga0081538_10002497 3300005981 Bacteria 17915
17 Ga0081539_10007117 3300005985 Bacteria 10340
18 Ga0081539_10027613 3300005985 Bacteria 3590
19 Ga0081539_10078959 3300005985 Bacteria 1736
20 Ga0081539_10154713 3300005985 Bacteria 1100
21 Ga0075365_10001553 3300006038 Bacteria 10503
22 Ga0075364_10114476 3300006051 Bacteria 1802
23 Ga0075367_10037545 3300006178 Bacteria 2816
24 Ga0075428_100005086 3300006844 Bacteria 14615
25 Ga0075428_100299172 3300006844 Bacteria 1730
26 Ga0075428_100315049 3300006844 Bacteria 1682
27 Ga0075430_100000524 3300006846 Bacteria 28918
28 Ga0075430_100057984 3300006846 Bacteria 3255
29 Ga0075430_100373072 3300006846 Bacteria 1178
30 Ga0075431_100013679 3300006847 Bacteria 8202
31 Ga0075429_100048301 3300006880 Bacteria 3701
32 Ga0075429_100073015 3300006880 Bacteria 2988
33 Ga0075429_100291948 3300006880 Bacteria 1428
34 Ga0075436_100019722 3300006914 Bacteria 4623
35 Ga0111539_10001006 3300009094 Bacteria 36927
36 Ga0105245_10150229 3300009098 Bacteria 2202
37 Ga0105245_10178789 3300009098 Bacteria 2025
38 Ga0114129_10053589 3300009147 Bacteria 5657
39 Ga0114129_10115984 3300009147 Bacteria 3690
40 Ga0105243_10582609 3300009148 Bacteria 1074
41 Ga0105242_10066965 3300009176 Bacteria 2968
42 Ga0207684_10002266 3300025910 Bacteria 19597
43 Ga0207684_10357513 3300025910 Bacteria 1257
44 Ga0207646_10240957 3300025922 Bacteria 1634
45 Ga0207687_10033364 3300025927 Bacteria 3492
46 Ga0207687_10203667 3300025927 Bacteria 1548
47 Ga0207686_10051648 3300025934 Bacteria 2562
48 Ga0207667_10070085 3300025949 Bacteria 3650
49 Ga0207677_10252647 3300026023 Bacteria 1433
50 Ga0207703_10084261 3300026035 Bacteria 2658
51 Ga0307515_10000924 3300028794 Bacteria 67427
52 Ga0307515_10055764 3300028794 Bacteria 5764
53 Ga0307515_10087737 3300028794 Bacteria 3943
54 Ga0265338_10043171 3300028800 Bacteria 4186
55 Ga0307512_10041368 3300030522 Bacteria 3831
56 Ga0307512_10120672 3300030522 Bacteria 1686
57 Ga0307513_10018954 3300031456 Bacteria 8205
58 Ga0307509_10217818 3300031507 Bacteria 1725
59 Ga0307408_100344593 3300031548 Bacteria 1262
60 Ga0307508_10054149 3300031616 Bacteria 3558
61 Ga0307508_10251034 3300031616 Bacteria 1365
62 Ga0316576_10014165 3300031727 Bacteria 5322
63 Ga0316576_10076199 3300031727 Bacteria 2482
64 Ga0316576_10138550 3300031727 Bacteria 1831
65 Ga0307516_10000608 3300031730 Bacteria 48564
66 Ga0307516_10020851 3300031730 Bacteria 6763
67 Ga0307516_10042701 3300031730 Bacteria 4496
68 Ga0307516_10093256 3300031730 Bacteria 2836
69 Ga0307405_10034235 3300031731 Bacteria 3021
70 Ga0307413_10422428 3300031824 Bacteria 1050
71 Ga0307410_10101888 3300031852 Bacteria 2059
72 Ga0326468_10001708 3300031889 Bacteria 1893
73 Ga0307406_10115736 3300031901 Bacteria 1854
74 Ga0307406_10140255 3300031901 Bacteria 1710
75 Ga0307407_10271918 3300031903 Bacteria 1170
76 Ga0307412_10467821 3300031911 Bacteria 1043
77 Ga0307414_10546484 3300032004 Bacteria 1032
78 Ga0307415_100543006 3300032126 Bacteria 1024
79 Ga0373930_0005327 3300034816 Bacteria 2134
80 Ga0373928_0000127 3300035084 Bacteria 14369
81 Ga0373929_0001901 3300035085 Bacteria 3913
82 Ga0373951_0000223 3300035091 Bacteria 19695
83 Ga0373932_0000616 3300035112 Bacteria 10790
84 Ga0316574_0040201 3300035398 Bacteria 2879
85 Ga0316574_0159279 3300035398 Bacteria 1454
86 Ga0316574_0187211 3300035398 Bacteria 1331
87 Ga0373931_0000057 3300035691 Bacteria 56670
88 Ga0373925_0646106 3300037068 Bacteria 872
89 Ga0395905_0310631 3300037471 Bacteria 1465
90 Ga0395901_0187664 3300038443 Bacteria 2168
91 Ga0400483_022346 3300039062 Bacteria 7597
92 Ga0400483_238110 3300039062 Bacteria 1832
93 Ga0400483_245520 3300039062 Bacteria 6490
94 Ga0451791_0026340 3300041451 Bacteria 1858
95 Ga0451797_0718671 3300041453 Bacteria 871
96 Ga0439435_0036937 3300042436 Bacteria 1352
97 Ga0439459_0006154 3300042438 Bacteria 1993
98 Ga0439460_0116954 3300042461 Bacteria 869
99 Ga0450918_026845 3300042531 Bacteria 1011
100 Ga0466972_0041729 3300044658 Bacteria 2233
101 Ga0495629_0169341 3300046459 Bacteria 1516
102 Ga0495639_0171815 3300046475 Bacteria 1052
103 Ga0495618_0121772 3300046514 Bacteria 1671
104 Ga0495632_0029542 3300046519 Bacteria 2853
105 Ga0495586_0156908 3300046535 Bacteria 1282
106 Ga0495621_0048695 3300046539 Bacteria 1510
107 Ga0495634_0048339 3300046642 Bacteria 2864
108 Ga0495658_0056563 3300046683 Bacteria 2238
109 Ga0495613_0013014 3300046689 Bacteria 6183
110 Ga0495672_0129891 3300047320 Bacteria 1327
111 Ga0496109_0097240 3300048912 Bacteria 2729
112 Ga0496109_0345615 3300048912 Bacteria 1405
113 Ga0501031_0064368 3300049568 Bacteria 2388
114 Ga0501032_0003660 3300049569 Bacteria 11686
115 Ga0501033_0000777 3300049570 Bacteria 29365
116 Ga0501034_0007553 3300049571 Bacteria 11566
117 Ga0501034_0021134 3300049571 Bacteria 6640
118 Ga0501034_0054162 3300049571 Bacteria 4038
119 Ga0501036_0100986 3300049572 Bacteria 2440
120 Ga0501036_0223040 3300049572 Bacteria 1583
121 Ga0501037_0004185 3300049573 Bacteria 10461
122 Ga0501037_0045506 3300049573 Bacteria 3222
123 Ga0501038_0077984 3300049574 Bacteria 2796
124 Ga0501038_0206712 3300049574 Bacteria 1573
125 Ga0501039_0186678 3300049575 Bacteria 1631
126 Ga0501040_0012065 3300049576 Bacteria 5655
127 Ga0501040_0032568 3300049576 Bacteria 3527
128 Ga0501041_0039759 3300049577 Bacteria 2854
129 Ga0501041_0055554 3300049577 Bacteria 2418
130 Ga0501041_0109894 3300049577 Bacteria 1710
131 Ga0501042_0009720 3300049578 Bacteria 6425
132 Ga0501042_0040896 3300049578 Bacteria 3295
133 Ga0501043_0047905 3300049579 Bacteria 3360
134 Ga0501047_0070387 3300049581 Bacteria 3369
135 Ga0501047_0166313 3300049581 Bacteria 2076
136 Ga0501048_0190099 3300049582 Bacteria 1455
137 Ga0501068_0033895 3300049584 Bacteria 3043
138 Ga0501069_0001422 3300049585 Bacteria 11738
139 Ga0501069_0054797 3300049585 Bacteria 2221
140 Ga0501070_0001142 3300049586 Bacteria 23828
141 Ga0501070_0073266 3300049586 Bacteria 2833
142 Ga0501070_0119464 3300049586 Bacteria 2179
143 Ga0501071_0004391 3300049587 Bacteria 8946
144 Ga0501071_0022083 3300049587 Bacteria 4435
145 Ga0501071_0039328 3300049587 Bacteria 3384
146 Ga0501071_0172896 3300049587 Bacteria 1617
147 Ga0501072_0029082 3300049588 Bacteria 4314
148 Ga0501072_0047150 3300049588 Bacteria 3393
149 Ga0501073_0000745 3300049589 Bacteria 23013
150 Ga0501073_0008621 3300049589 Bacteria 7555
151 Ga0501074_0028496 3300049590 Bacteria 4047
152 Ga0501074_0277194 3300049590 Bacteria 1192
153 Ga0501075_0009759 3300049591 Bacteria 6727
154 Ga0501075_0084194 3300049591 Bacteria 2408
155 Ga0501076_0100663 3300049592 Bacteria 2328
156 Ga0501076_0207201 3300049592 Bacteria 1602
157 Ga0501077_0000696 3300049593 Bacteria 20354
158 Ga0501077_0057560 3300049593 Bacteria 2468
159 Ga0501079_0037337 3300049741 Bacteria 3744
160 Ga0501080_0001561 3300049742 Bacteria 19367
161 Ga0501080_0067331 3300049742 Bacteria 3330
162 Ga0501080_0117796 3300049742 Bacteria 2462
163 Ga0501080_0169437 3300049742 Bacteria 2014
164 Ga0501081_0073972 3300049743 Bacteria 2377
165 Ga0501083_0003202 3300049744 Bacteria 11402
166 Ga0501083_0053286 3300049744 Bacteria 2716
167 Ga0501083_0335816 3300049744 Bacteria 983
168 Ga0501035_0156638 3300049822 Bacteria 1974
169 Ga0501044_0016270 3300049823 Bacteria 7991
170 Ga0501044_0083449 3300049823 Bacteria 3231
171 Ga0501045_0064825 3300049824 Bacteria 2682
172 nmdc:mga0yw44_1325_c1 3300050492 Bacteria 9779
173 nmdc:mga0yw44_54435_c1 3300050492 Bacteria 2431
174 nmdc:mga09592_210361_c1 3300050508 Bacteria 1685
175 nmdc:mga09592_42299_c1 3300050508 Bacteria 3832
176 nmdc:mga0qj67_190862_c1 3300050509 Bacteria 1665
177 nmdc:mga0qj67_2238_c1 3300050509 Bacteria 13744
178 nmdc:mga0qj67_225000_c1 3300050509 Bacteria 1523
179 nmdc:mga06r32_397112_c1 3300050510 Bacteria 1361
180 nmdc:mga06r32_444008_c1 3300050510 Bacteria 1277
181 nmdc:mga06r32_51245_c1 3300050510 Bacteria 3950
182 nmdc:mga06r32_926583_c1 3300050510 Bacteria 827
183 nmdc:mga08y16_5036_c1 3300050511 Bacteria 13810
184 nmdc:mga08x19_47724_c1 3300050514 Bacteria 2742
185 Ga0495601_0007003 3300053077 Bacteria 6606
186 Ga0500566_0172507 3300053094 Bacteria 1117
187 Ga0500641_0020485 3300053096 Bacteria 2511
188 Ga0500569_006405 3300053109 Bacteria 2584
189 Ga0500652_021942 3300053131 Bacteria 2411
190 Ga0500568_0000069 3300053139 Bacteria 99921
191 Ga0501084_0003260 3300054114 Bacteria 13131
192 Ga0501084_0353560 3300054114 Bacteria 1241
193 Ga0501082_0280545 3300060353 Bacteria 1450
194 Ga0501082_0452126 3300060353 Bacteria 1122
195 Ga0530510_0003641 3300061734 Bacteria 10608
196 2729904789 2728369276 Bacteria 5610032
197 Ga0501034_0037769
198 JGI25406J46586_10058964
199 Ga0068869_100018798
200 Ga0070668_100329785
201 Ga0070671_100025585
202 Ga0070708_100080677
203 Ga0070706_100076524
204 Ga0070707_100100017
205 Ga0070707_100129022
206 Ga0070707_100615198
207 Ga0070696_100414419
208 Ga0068855_100381376
209 Ga0068858_100105283
210 Ga0081455_10006732
211 Ga0081455_10059730
212 Ga0081538_10002497
213 Ga0081539_10007117
214 Ga0081539_10027613
215 Ga0081539_10078959
216 Ga0081539_10154713
217 Ga0075365_10001553
218 Ga0075364_10114476
219 Ga0075367_10037545
220 Ga0075428_100005086
221 Ga0075428_100299172
222 Ga0075428_100315049
223 Ga0075430_100000524
224 Ga0075430_100057984
225 Ga0075430_100373072
226 Ga0075431_100013679
227 Ga0075429_100048301
228 Ga0075429_100073015
229 Ga0075429_100291948
230 Ga0075436_100019722
231 Ga0111539_10001006
232 Ga0105245_10150229
233 Ga0105245_10178789
234 Ga0114129_10053589
235 Ga0114129_10115984
236 Ga0105243_10582609
237 Ga0105242_10066965
238 Ga0207684_10002266
239 Ga0207684_10357513
240 Ga0207646_10240957
241 Ga0207687_10033364
242 Ga0207687_10203667
243 Ga0207686_10051648
244 Ga0207667_10070085
245 Ga0207677_10252647
246 Ga0207703_10084261
247 Ga0307515_10000924
248 Ga0307515_10055764
249 Ga0307515_10087737
250 Ga0265338_10043171
251 Ga0307512_10041368
252 Ga0307512_10120672
253 Ga0307513_10018954
254 Ga0307509_10217818
255 Ga0307408_100344593
256 Ga0307508_10054149
257 Ga0307508_10251034
258 Ga0316576_10014165
259 Ga0316576_10076199
260 Ga0316576_10138550
261 Ga0307516_10000608
262 Ga0307516_10020851
263 Ga0307516_10042701
264 Ga0307516_10093256
265 Ga0307405_10034235
266 Ga0307413_10422428
267 Ga0307410_10101888
268 Ga0326468_10001708
269 Ga0307406_10115736
270 Ga0307406_10140255
271 Ga0307407_10271918
272 Ga0307412_10467821
273 Ga0307414_10546484
274 Ga0307415_100543006
275 Ga0373930_0005327
276 Ga0373928_0000127
277 Ga0373929_0001901
278 Ga0373951_0000223
279 Ga0373932_0000616
280 Ga0316574_0040201
281 Ga0316574_0159279
282 Ga0316574_0187211
283 Ga0373931_0000057
284 Ga0373925_0646106
285 Ga0395905_0310631
286 Ga0395901_0187664
287 Ga0400483_022346
288 Ga0400483_238110
289 Ga0400483_245520
290 Ga0451791_0026340
291 Ga0451797_0718671
292 Ga0439435_0036937
293 Ga0439459_0006154
294 Ga0439460_0116954
295 Ga0450918_026845
296 Ga0466972_0041729
297 Ga0495629_0169341
298 Ga0495639_0171815
299 Ga0495618_0121772
300 Ga0495632_0029542
301 Ga0495586_0156908
302 Ga0495621_0048695
303 Ga0495634_0048339
304 Ga0495658_0056563
305 Ga0495613_0013014
306 Ga0495672_0129891
307 Ga0496109_0097240
308 Ga0496109_0345615
309 Ga0501031_0064368
310 Ga0501032_0003660
311 Ga0501033_0000777
312 Ga0501034_0007553
313 Ga0501034_0021134
314 Ga0501034_0054162
315 Ga0501036_0100986
316 Ga0501036_0223040
317 Ga0501037_0004185
318 Ga0501037_0045506
319 Ga0501038_0077984
320 Ga0501038_0206712
321 Ga0501039_0186678
322 Ga0501040_0012065
323 Ga0501040_0032568
324 Ga0501041_0039759
325 Ga0501041_0055554
326 Ga0501041_0109894
327 Ga0501042_0009720
328 Ga0501042_0040896
329 Ga0501043_0047905
330 Ga0501047_0070387
331 Ga0501047_0166313
332 Ga0501048_0190099
333 Ga0501068_0033895
334 Ga0501069_0001422
335 Ga0501069_0054797
336 Ga0501070_0001142
337 Ga0501070_0073266
338 Ga0501070_0119464
339 Ga0501071_0004391
340 Ga0501071_0022083
341 Ga0501071_0039328
342 Ga0501071_0172896
343 Ga0501072_0029082
344 Ga0501072_0047150
345 Ga0501073_0000745
346 Ga0501073_0008621
347 Ga0501074_0028496
348 Ga0501074_0277194
349 Ga0501075_0009759
350 Ga0501075_0084194
351 Ga0501076_0100663
352 Ga0501076_0207201
353 Ga0501077_0000696
354 Ga0501077_0057560
355 Ga0501079_0037337
356 Ga0501080_0001561
357 Ga0501080_0067331
358 Ga0501080_0117796
359 Ga0501080_0169437
360 Ga0501081_0073972
361 Ga0501083_0003202
362 Ga0501083_0053286
363 Ga0501083_0335816
364 Ga0501035_0156638
365 Ga0501044_0016270
366 Ga0501044_0083449
367 Ga0501045_0064825
368 nmdc:mga0yw44_1325_c1
369 nmdc:mga0yw44_54435_c1
370 nmdc:mga09592_210361_c1
371 nmdc:mga09592_42299_c1
372 nmdc:mga0qj67_190862_c1
373 nmdc:mga0qj67_2238_c1
374 nmdc:mga0qj67_225000_c1
375 nmdc:mga06r32_397112_c1
376 nmdc:mga06r32_444008_c1
377 nmdc:mga06r32_51245_c1
378 nmdc:mga06r32_926583_c1
379 nmdc:mga08y16_5036_c1
380 nmdc:mga08x19_47724_c1
381 Ga0495601_0007003
382 Ga0500566_0172507
383 Ga0500641_0020485
384 Ga0500569_006405
385 Ga0500652_021942
386 Ga0500568_0000069
387 Ga0501084_0003260
388 Ga0501084_0353560
389 Ga0501082_0280545
390 Ga0501082_0452126
391 Ga0530510_0003641
392 2729904789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

19

64

0.97

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

77

209

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d8l-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 3) 0.9132 11 59
2olw-assembly2.cif.gz_B crystal structure of e. coli pseudouridine synthase rlue 0.9106 68 231
5z81-assembly1.cif.gz_C trimeric structure of vibrio cholerae heat shock protein 15 at 2.3 angstrom resolution 0.8862 9 56
4v47-assembly1.cif.gz_BD real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the ef-g.gtp state of e. coli 70s ribosome 0.8802 11 58
7nhk-assembly1.cif.gz_e lsaa, an antibiotic resistance abcf, in complex with 70s ribosome from enterococcus faecalis 0.8782 11 59
ID Description Score Start End Superfamily
af_P9WHQ1_10_70_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9613 10 63 3.10.290.10
af_A0A1D6JNZ0_152_214_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9606 9 65 3.10.290.10
3dh3A01 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9394 8 62 3.10.290.10
af_P37765_1_61_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9392 9 62 3.10.290.10
af_P02355_88_184_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9381 11 45 3.10.290.10
ID Description Score Start End GO Terms
AF-D6YA67-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9755 10 245 GO:0000455
GO:0003723
GO:0120159
AF-A0A5M3VTS0-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9744 10 245 GO:0000455
GO:0003723
GO:0120159
AF-A0A1V0AKF6-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9731 10 245 GO:0000455
GO:0003723
GO:0120159
AF-A0A3D4X2Q0-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9663 50 245 GO:0001522
GO:0003723
GO:0006364
GO:0009982
GO:0140098
AF-A0A7Y5KJW5-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9661 30 245 GO:0001522
GO:0003723
GO:0006364
GO:0009982
GO:0140098

Map