F301886

General Info

Members Datasets Scaffolds Average Seq Length
196 146 196 150

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0133076|Ga0439436_0133076_86_637
Length 183
Sequence MHKQNGKGLTGNIFLRLTTMTPLAHVRDGFSWEKRMRAIGIAMLLAGLLVSGCATGKGEWVELGGQRYSVEVADDDEERARGLMFRDQMAADHGMLFIHDREEPQSYWMKNTHIPLDILYFDSNRRLVSQQRDVPPCALGNGCPPYPSNAPARYVLELNAGEAARLKLEDGAELKFGRGIPPP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
35 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
39 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
42 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
43 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
64 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
77 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
78 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
79 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
80 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
81 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
82 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
83 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
84 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
85 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
86 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
87 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
88 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
89 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
90 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
91 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
94 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
95 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
96 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
97 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
102 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
103 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
104 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
105 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
117 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
134 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
135 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
136 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
137 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
138 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
139 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
140 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
141 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
142 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.24
Nodule 0
Rhizoplane 14.29
Rhizosphere 62.76
Stem 0
Stem Tuber 0
Unclassified 10.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2158564 2162886007 Bacteria 1226
2 JGI25150J39212_1000714 3300002774 Bacteria 11902
3 JGI25151J46595_10000105 3300003187 Bacteria 113763
4 JGI25153J46596_10000077 3300003215 Bacteria 113763
5 Ga0055526_1000082 3300003771 Bacteria 87106
6 Ga0055537_1000228 3300003773 Bacteria 41108
7 Ga0055524_1000138 3300003775 Bacteria 87106
8 Ga0055534_1000056 3300003784 Bacteria 87106
9 Ga0055528_1000061 3300003790 Bacteria 87106
10 Ga0055531_10014596 3300003794 Bacteria 3526
11 Ga0058692_1000045 3300003856 Bacteria 115083
12 Ga0065704_10001264 3300005289 Bacteria 8604
13 Ga0065715_10913935 3300005293 Bacteria 570
14 Ga0070670_100006122 3300005331 Bacteria 10172
15 Ga0070670_100471125 3300005331 Bacteria 1114
16 Ga0070670_100492420 3300005331 Bacteria 1089
17 Ga0070668_100026200 3300005347 Bacteria 4422
18 Ga0070671_100063892 3300005355 Bacteria 3066
19 Ga0070673_101326039 3300005364 Bacteria 676
20 Ga0070667_100994347 3300005367 Bacteria 783
21 Ga0070701_10284364 3300005438 Bacteria 1011
22 Ga0070662_100313008 3300005457 Bacteria 1278
23 Ga0068853_100127328 3300005539 Bacteria 2276
24 Ga0068854_100125184 3300005578 Bacteria 1956
25 Ga0068852_100785682 3300005616 Bacteria 966
26 Ga0068864_100311163 3300005618 Bacteria 1477
27 Ga0068861_100490464 3300005719 Bacteria 1109
28 Ga0068851_10290949 3300005834 Bacteria 937
29 Ga0068870_10117101 3300005840 Bacteria 1529
30 Ga0068862_100537367 3300005844 Bacteria 1114
31 Ga0081539_10040072 3300005985 Bacteria 2754
32 Ga0075364_10057856 3300006051 Bacteria 2540
33 Ga0097620_100810967 3300006931 Bacteria 1023
34 Ga0105251_10000350 3300009011 Bacteria 45818
35 Ga0105251_10007580 3300009011 Bacteria 6661
36 Ga0105238_10295850 3300009551 Bacteria 1602
37 Ga0105032_100210 3300009979 Bacteria 6031
38 Ga0157327_1000375 3300012512 Bacteria 2408
39 Ga0157371_10038375 3300013102 Bacteria 3427
40 Ga0157377_11176897 3300014745 Bacteria 592
41 Ga0182005_1032281 3300015265 Bacteria 1425
42 Ga0183360_10003 3300015689 Bacteria 713221
43 Ga0163161_10102176 3300017792 Bacteria 2135
44 Ga0207425_1000045 3300025245 Bacteria 194257
45 Ga0209129_1000057 3300025258 Bacteria 253632
46 Ga0209565_1000002 3300025263 Bacteria 1423083
47 Ga0209565_1014071 3300025263 Bacteria 1850
48 Ga0209673_1000002 3300025273 Bacteria 1423083
49 Ga0209675_1000002 3300025291 Bacteria 1423083
50 Ga0209025_1000013 3300025294 Bacteria 871757
51 Ga0209564_1000004 3300025295 Bacteria 1424639
52 Ga0209758_1000014 3300025297 Bacteria 871757
53 Ga0209256_1000004 3300025299 Bacteria 1424643
54 Ga0209257_1000046 3300025304 Bacteria 477765
55 Ga0207656_10286923 3300025321 Bacteria 813
56 Ga0207713_1001094 3300025735 Bacteria 23219
57 Ga0207713_1007090 3300025735 Bacteria 6705
58 Ga0207650_10004216 3300025925 Bacteria 9819
59 Ga0207650_10419972 3300025925 Bacteria 1110
60 Ga0207650_10827450 3300025925 Bacteria 785
61 Ga0207664_10595870 3300025929 Bacteria 992
62 Ga0207644_10094951 3300025931 Bacteria 2229
63 Ga0207668_10187719 3300025972 Bacteria 1635
64 Ga0207658_10423707 3300025986 Bacteria 1174
65 Ga0207639_10137487 3300026041 Bacteria 2031
66 Ga0207698_11034260 3300026142 Bacteria 833
67 Ga0209371_1000043 3300027312 Bacteria 331009
68 Ga0268266_10399747 3300028379 Bacteria 1299
69 Ga0268265_10527247 3300028380 Bacteria 1117
70 Ga0268256_1000044 3300030500 Bacteria 330997
71 Ga0316182_1037383 3300030745 Bacteria 541
72 Ga0307513_10027272 3300031456 Bacteria 6562
73 Ga0307408_101062356 3300031548 Bacteria 749
74 Ga0307405_10161587 3300031731 Bacteria 1587
75 Ga0307405_10864309 3300031731 Bacteria 762
76 Ga0307410_10254904 3300031852 Bacteria 1366
77 Ga0307412_10095379 3300031911 Bacteria 2091
78 Ga0307412_10477187 3300031911 Bacteria 1033
79 Ga0307412_11012575 3300031911 Bacteria 734
80 Ga0307416_101045588 3300032002 Bacteria 920
81 Ga0307416_102503331 3300032002 Bacteria 615
82 Ga0307414_10003697 3300032004 Bacteria 8199
83 Ga0307414_10047642 3300032004 Bacteria 2951
84 Ga0307414_10172700 3300032004 Bacteria 1730
85 Ga0307414_10603223 3300032004 Bacteria 985
86 Ga0307414_10614381 3300032004 Bacteria 976
87 Ga0307414_11006469 3300032004 Bacteria 767
88 Ga0307414_11080497 3300032004 Bacteria 740
89 Ga0307411_10144126 3300032005 Bacteria 1760
90 Ga0307411_10988326 3300032005 Bacteria 753
91 Ga0373946_0457977 3300035171 Bacteria 650
92 Ga0373927_0617380 3300035695 Bacteria 717
93 Ga0373937_0667663 3300036401 Bacteria 985
94 Ga0237819_00396 3300038705 Bacteria 15189
95 Ga0237816_00156 3300039145 Bacteria 5355
96 Ga0439436_0010556 3300041404 Bacteria 2814
97 Ga0439436_0133076 3300041404 Bacteria 697
98 Ga0439465_0005514 3300041413 Bacteria 4034
99 Ga0439465_0016075 3300041413 Bacteria 2333
100 Ga0439465_0173361 3300041413 Bacteria 778
101 Ga0451789_0062754 3300041443 Bacteria 686
102 Ga0451791_0384135 3300041451 Bacteria 630
103 Ga0451791_1731006 3300041451 Bacteria 763
104 Ga0451793_0092734 3300041452 Bacteria 1117
105 Ga0451797_0376581 3300041453 Bacteria 593
106 Ga0451797_0495402 3300041453 Bacteria 1102
107 Ga0451797_0498899 3300041453 Bacteria 1256
108 Ga0451795_0194647 3300041456 Bacteria 1710
109 Ga0451798_0516489 3300041458 Bacteria 793
110 Ga0451798_0847981 3300041458 Bacteria 1363
111 Ga0451802_1908202 3300041460 Bacteria 1083
112 Ga0451806_164866 3300041462 Bacteria 3715
113 Ga0451804_1174625 3300041463 Bacteria 3132
114 Ga0451807_0357263 3300041486 Bacteria 669
115 Ga0451807_0401420 3300041486 Bacteria 2332
116 Ga0451807_1125715 3300041486 Bacteria 1646
117 Ga0451807_1348214 3300041486 Bacteria 2456
118 Ga0451833_0279133 3300041491 Bacteria 1147
119 Ga0451843_0058792 3300041509 Bacteria 1689
120 Ga0451843_0823667 3300041509 Bacteria 1405
121 Ga0451853_1103180 3300041512 Bacteria 707
122 Ga0451853_3365406 3300041512 Bacteria 1082
123 Ga0439445_0034804 3300042004 Bacteria 1321
124 Ga0439432_015492 3300042006 Bacteria 2572
125 Ga0439432_042030 3300042006 Bacteria 1446
126 Ga0439432_203410 3300042006 Bacteria 574
127 Ga0439449_0000013 3300042007 Bacteria 51317
128 Ga0439449_0008923 3300042007 Bacteria 3804
129 Ga0439449_0011626 3300042007 Bacteria 3311
130 Ga0439449_0235418 3300042007 Bacteria 687
131 Ga0495616_0127572 3300046513 Bacteria 1169
132 Ga0495663_0000689 3300046525 Bacteria 11637
133 Ga0495663_0011017 3300046525 Bacteria 2518
134 Ga0495663_0053799 3300046525 Bacteria 1252
135 Ga0495654_0321538 3300046530 Bacteria 627
136 Ga0495621_0000071 3300046539 Bacteria 20126
137 Ga0495621_0048624 3300046539 Bacteria 1511
138 Ga0495656_0178935 3300046615 Bacteria 1041
139 Ga0495659_0051476 3300046664 Bacteria 1500
140 Ga0495659_0141253 3300046664 Bacteria 961
141 Ga0495670_0041641 3300046691 Bacteria 2292
142 Ga0495671_0004581 3300046692 Bacteria 8228
143 Ga0495636_0198922 3300047318 Bacteria 914
144 Ga0495636_0246384 3300047318 Bacteria 825
145 Ga0495615_0099846 3300048090 Bacteria 819
146 Ga0496100_0696713 3300048903 Bacteria 793
147 Ga0496101_0075421 3300048904 Bacteria 2482
148 Ga0496101_0917667 3300048904 Bacteria 689
149 Ga0496102_0268939 3300048905 Bacteria 1607
150 Ga0496103_0793210 3300048906 Bacteria 598
151 Ga0496106_0032453 3300048909 Bacteria 3893
152 Ga0496108_0139470 3300048911 Bacteria 2089
153 Ga0496109_2026094 3300048912 Bacteria 507
154 Ga0496110_0019735 3300048913 Bacteria 5678
155 Ga0496113_0744651 3300048916 Bacteria 780
156 Ga0496115_0185006 3300048918 Bacteria 1721
157 Ga0496117_0010036 3300048920 Bacteria 8700
158 Ga0496118_0025694 3300048921 Bacteria 5040
159 Ga0496118_0072578 3300048921 Bacteria 2471
160 Ga0496119_0001338 3300048922 Bacteria 30220
161 Ga0496120_0000320 3300048923 Bacteria 79515
162 Ga0496122_0000315 3300048925 Bacteria 106323
163 Ga0496122_0000710 3300048925 Bacteria 65728
164 Ga0496123_0000104 3300048926 Bacteria 168230
165 Ga0496123_0000149 3300048926 Bacteria 142962
166 Ga0496124_0000403 3300048927 Bacteria 78615
167 Ga0496124_0383946 3300048927 Bacteria 981
168 Ga0496126_0225586 3300048929 Bacteria 1572
169 Ga0496126_0387983 3300048929 Bacteria 1135
170 Ga0501033_0019589 3300049570 Bacteria 5115
171 Ga0501033_0035652 3300049570 Bacteria 3729
172 Ga0501034_0124478 3300049571 Bacteria 2563
173 Ga0501034_0178042 3300049571 Bacteria 2092
174 Ga0501034_0934296 3300049571 Bacteria 754
175 Ga0501036_0557184 3300049572 Bacteria 952
176 Ga0501037_0129537 3300049573 Bacteria 1810
177 Ga0501039_0160777 3300049575 Bacteria 1765
178 Ga0501043_0030156 3300049579 Bacteria 4261
179 Ga0501046_0112039 3300049580 Bacteria 2084
180 Ga0501047_0051751 3300049581 Bacteria 3969
181 Ga0501070_0130265 3300049586 Bacteria 2078
182 Ga0501202_004605 3300049652 Bacteria 2415
183 Ga0501223_003247 3300049663 Bacteria 3551
184 Ga0501239_019964 3300049672 Bacteria 815
185 Ga0501250_016654 3300049680 Bacteria 915
186 Ga0501252_001762 3300049682 Bacteria 2061
187 Ga0501261_043426 3300049690 Bacteria 716
188 Ga0501225_0004364 3300049705 Bacteria 4223
189 Ga0501265_001822 3300049762 Bacteria 2414
190 Ga0501266_025074 3300049763 Bacteria 830
191 Ga0501275_001076 3300049772 Bacteria 2792
192 Ga0501035_0117559 3300049822 Bacteria 2326
193 Ga0501044_0130484 3300049823 Bacteria 2507
194 nmdc:mga00v17_14129_c1 3300050491 Bacteria 4451
195 nmdc:mga00v17_82731_c1 3300050491 Bacteria 2007
196 Ga0500604_0193984 3300053151 Bacteria 698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003771 Ga0055526_1000082 Ga0055526_100008276 146
2 3300003773 Ga0055537_1000228 Ga0055537_100022836 146
3 3300003775 Ga0055524_1000138 Ga0055524_10001382 146
4 3300003784 Ga0055534_1000056 Ga0055534_10000562 146
5 3300003790 Ga0055528_1000061 Ga0055528_10000612 146
6 3300015689 Ga0183360_10003 Ga0183360_100031 146
7 3300025263 Ga0209565_1000002 Ga0209565_10000021 146
8 3300025263 Ga0209565_1014071 Ga0209565_10140713 146
9 3300025273 Ga0209673_1000002 Ga0209673_10000021 146
10 3300025291 Ga0209675_1000002 Ga0209675_10000021 146
11 3300025295 Ga0209564_1000004 Ga0209564_10000042 146
12 3300025299 Ga0209256_1000004 Ga0209256_10000042 146
13 3300050491 nmdc:mga00v17_82731_c1 nmdc:mga00v17_82731_c1_1249_1695 146
14 3300005331 Ga0070670_100471125 Ga0070670_1004711251 147
15 3300005331 Ga0070670_100492420 Ga0070670_1004924201 147
16 3300005355 Ga0070671_100063892 Ga0070671_1000638925 147
17 3300005364 Ga0070673_101326039 Ga0070673_1013260391 147
18 3300005367 Ga0070667_100994347 Ga0070667_1009943471 147
19 3300005438 Ga0070701_10284364 Ga0070701_102843642 147
20 3300005457 Ga0070662_100313008 Ga0070662_1003130082 147
21 3300005618 Ga0068864_100311163 Ga0068864_1003111633 147
22 3300005719 Ga0068861_100490464 Ga0068861_1004904642 147
23 3300005840 Ga0068870_10117101 Ga0068870_101171012 147
24 3300005844 Ga0068862_100537367 Ga0068862_1005373671 147
25 3300005985 Ga0081539_10040072 Ga0081539_100400724 147
26 3300012512 Ga0157327_1000375 Ga0157327_10003752 147
27 3300014745 Ga0157377_11176897 Ga0157377_111768971 147
28 3300025925 Ga0207650_10419972 Ga0207650_104199722 147
29 3300025925 Ga0207650_10827450 Ga0207650_108274501 147
30 3300025931 Ga0207644_10094951 Ga0207644_100949514 147
31 3300025986 Ga0207658_10423707 Ga0207658_104237071 147
32 3300028380 Ga0268265_10527247 Ga0268265_105272472 147
33 3300032002 Ga0307416_102503331 Ga0307416_1025033311 147
34 3300046539 Ga0495621_0000071 Ga0495621_0000071_325_768 147
35 3300046615 Ga0495656_0178935 Ga0495656_0178935_300_743 147
36 3300046664 Ga0495659_0051476 Ga0495659_0051476_296_739 147
37 3300047318 Ga0495636_0246384 Ga0495636_0246384_268_711 147
38 3300048090 Ga0495615_0099846 Ga0495615_0099846_361_804 147
39 3300048903 Ga0496100_0696713 Ga0496100_0696713_173_616 147
40 3300048904 Ga0496101_0075421 Ga0496101_0075421_1574_2017 147
41 3300048905 Ga0496102_0268939 Ga0496102_0268939_273_716 147
42 3300048906 Ga0496103_0793210 Ga0496103_0793210_143_586 147
43 3300048909 Ga0496106_0032453 Ga0496106_0032453_2581_3024 147
44 3300048912 Ga0496109_2026094 Ga0496109_2026094_23_466 147
45 3300048913 Ga0496110_0019735 Ga0496110_0019735_4498_4941 147
46 3300048916 Ga0496113_0744651 Ga0496113_0744651_203_646 147
47 3300048918 Ga0496115_0185006 Ga0496115_0185006_1248_1691 147
48 3300048927 Ga0496124_0383946 Ga0496124_0383946_354_797 147
49 3300049571 Ga0501034_0934296 Ga0501034_0934296_39_500 147
50 3300003794 Ga0055531_10014596 Ga0055531_100145962 148
51 3300005293 Ga0065715_10913935 Ga0065715_109139351 148
52 3300006051 Ga0075364_10057856 Ga0075364_100578562 148
53 3300009979 Ga0105032_100210 Ga0105032_1002108 148
54 3300013102 Ga0157371_10038375 Ga0157371_100383755 148
55 3300017792 Ga0163161_10102176 Ga0163161_101021762 148
56 3300025304 Ga0209257_1000046 Ga0209257_1000046139 148
57 3300025929 Ga0207664_10595870 Ga0207664_105958701 148
58 3300030745 Ga0316182_1037383 Ga0316182_10373831 148
59 3300031456 Ga0307513_10027272 Ga0307513_100272726 148
60 3300031548 Ga0307408_101062356 Ga0307408_1010623561 148
61 3300031731 Ga0307405_10161587 Ga0307405_101615871 148
62 3300031731 Ga0307405_10864309 Ga0307405_108643092 148
63 3300031852 Ga0307410_10254904 Ga0307410_102549043 148
64 3300031911 Ga0307412_10095379 Ga0307412_100953791 148
65 3300031911 Ga0307412_10477187 Ga0307412_104771871 148
66 3300031911 Ga0307412_11012575 Ga0307412_110125751 148
67 3300032002 Ga0307416_101045588 Ga0307416_1010455881 148
68 3300032004 Ga0307414_10003697 Ga0307414_100036975 148
69 3300032004 Ga0307414_10047642 Ga0307414_100476424 148
70 3300032004 Ga0307414_10172700 Ga0307414_101727003 148
71 3300032004 Ga0307414_10603223 Ga0307414_106032231 148
72 3300032004 Ga0307414_10614381 Ga0307414_106143812 148
73 3300032004 Ga0307414_11080497 Ga0307414_110804972 148
74 3300032005 Ga0307411_10144126 Ga0307411_101441261 148
75 3300032005 Ga0307411_10988326 Ga0307411_109883262 148
76 3300039145 Ga0237816_00156 Ga0237816_00156_1224_1673 148
77 3300041404 Ga0439436_0010556 Ga0439436_0010556_1534_1983 148
78 3300041404 Ga0439436_0133076 Ga0439436_0133076_86_637 148
79 3300041413 Ga0439465_0005514 Ga0439465_0005514_2050_2496 148
80 3300041413 Ga0439465_0173361 Ga0439465_0173361_193_639 148
81 3300041443 Ga0451789_0062754 Ga0451789_0062754_73_519 148
82 3300041453 Ga0451797_0495402 Ga0451797_0495402_297_743 148
83 3300041453 Ga0451797_0498899 Ga0451797_0498899_559_1005 148
84 3300041458 Ga0451798_0516489 Ga0451798_0516489_90_536 148
85 3300041458 Ga0451798_0847981 Ga0451798_0847981_134_580 148
86 3300041460 Ga0451802_1908202 Ga0451802_1908202_442_888 148
87 3300041486 Ga0451807_0357263 Ga0451807_0357263_120_566 148
88 3300041486 Ga0451807_1348214 Ga0451807_1348214_749_1195 148
89 3300041491 Ga0451833_0279133 Ga0451833_0279133_684_1130 148
90 3300041509 Ga0451843_0058792 Ga0451843_0058792_146_592 148
91 3300041509 Ga0451843_0823667 Ga0451843_0823667_898_1344 148
92 3300041512 Ga0451853_1103180 Ga0451853_1103180_125_571 148
93 3300041512 Ga0451853_3365406 Ga0451853_3365406_331_777 148
94 3300042004 Ga0439445_0034804 Ga0439445_0034804_584_1033 148
95 3300042006 Ga0439432_015492 Ga0439432_015492_1947_2396 148
96 3300042006 Ga0439432_042030 Ga0439432_042030_465_914 148
97 3300042007 Ga0439449_0000013 Ga0439449_0000013_30119_30568 148
98 3300042007 Ga0439449_0235418 Ga0439449_0235418_99_548 148
99 3300046513 Ga0495616_0127572 Ga0495616_0127572_207_653 148
100 3300046525 Ga0495663_0000689 Ga0495663_0000689_4817_5263 148
101 3300046525 Ga0495663_0011017 Ga0495663_0011017_1531_2025 148
102 3300046530 Ga0495654_0321538 Ga0495654_0321538_106_552 148
103 3300046539 Ga0495621_0048624 Ga0495621_0048624_202_696 148
104 3300046664 Ga0495659_0141253 Ga0495659_0141253_64_558 148
105 3300046691 Ga0495670_0041641 Ga0495670_0041641_1658_2152 148
106 3300046692 Ga0495671_0004581 Ga0495671_0004581_5653_6099 148
107 3300047318 Ga0495636_0198922 Ga0495636_0198922_224_748 148
108 3300048911 Ga0496108_0139470 Ga0496108_0139470_1623_2069 148
109 3300049570 Ga0501033_0019589 Ga0501033_0019589_357_803 148
110 3300049570 Ga0501033_0035652 Ga0501033_0035652_2502_2960 148
111 3300049571 Ga0501034_0124478 Ga0501034_0124478_1529_1987 148
112 3300049571 Ga0501034_0178042 Ga0501034_0178042_289_735 148
113 3300049572 Ga0501036_0557184 Ga0501036_0557184_140_598 148
114 3300049573 Ga0501037_0129537 Ga0501037_0129537_1068_1526 148
115 3300049575 Ga0501039_0160777 Ga0501039_0160777_210_668 148
116 3300049579 Ga0501043_0030156 Ga0501043_0030156_576_1034 148
117 3300049580 Ga0501046_0112039 Ga0501046_0112039_519_977 148
118 3300049581 Ga0501047_0051751 Ga0501047_0051751_3262_3720 148
119 3300049586 Ga0501070_0130265 Ga0501070_0130265_214_672 148
120 3300049652 Ga0501202_004605 Ga0501202_004605_898_1344 148
121 3300049663 Ga0501223_003247 Ga0501223_003247_1155_1601 148
122 3300049672 Ga0501239_019964 Ga0501239_019964_59_505 148
123 3300049680 Ga0501250_016654 Ga0501250_016654_291_737 148
124 3300049682 Ga0501252_001762 Ga0501252_001762_1056_1502 148
125 3300049690 Ga0501261_043426 Ga0501261_043426_229_675 148
126 3300049705 Ga0501225_0004364 Ga0501225_0004364_1887_2336 148
127 3300049763 Ga0501266_025074 Ga0501266_025074_20_466 148
128 3300049822 Ga0501035_0117559 Ga0501035_0117559_740_1198 148
129 3300049823 Ga0501044_0130484 Ga0501044_0130484_1991_2449 148
130 3300050491 nmdc:mga00v17_14129_c1 nmdc:mga00v17_14129_c1_842_1291 148
131 3300053151 Ga0500604_0193984 Ga0500604_0193984_146_592 148
132 2162886007 SwRhRL2b_contig_2158564 SwRhRL2b_0536.00005180 149
133 3300002774 JGI25150J39212_1000714 JGI25150J39212_10007149 149
134 3300003187 JGI25151J46595_10000105 JGI25151J46595_1000010589 149
135 3300003215 JGI25153J46596_10000077 JGI25153J46596_100000777 149
136 3300003856 Ga0058692_1000045 Ga0058692_100004571 149
137 3300005289 Ga0065704_10001264 Ga0065704_100012647 149
138 3300005331 Ga0070670_100006122 Ga0070670_1000061221 149
139 3300005347 Ga0070668_100026200 Ga0070668_1000262005 149
140 3300005539 Ga0068853_100127328 Ga0068853_1001273283 149
141 3300005578 Ga0068854_100125184 Ga0068854_1001251844 149
142 3300005616 Ga0068852_100785682 Ga0068852_1007856822 149
143 3300005834 Ga0068851_10290949 Ga0068851_102909491 149
144 3300006931 Ga0097620_100810967 Ga0097620_1008109672 149
145 3300009011 Ga0105251_10000350 Ga0105251_1000035031 149
146 3300009011 Ga0105251_10007580 Ga0105251_100075808 149
147 3300009551 Ga0105238_10295850 Ga0105238_102958502 149
148 3300015265 Ga0182005_1032281 Ga0182005_10322812 149
149 3300025245 Ga0207425_1000045 Ga0207425_100004589 149
150 3300025258 Ga0209129_1000057 Ga0209129_100005740 149
151 3300025294 Ga0209025_1000013 Ga0209025_1000013107 149
152 3300025297 Ga0209758_1000014 Ga0209758_1000014107 149
153 3300025321 Ga0207656_10286923 Ga0207656_102869232 149
154 3300025735 Ga0207713_1001094 Ga0207713_100109410 149
155 3300025735 Ga0207713_1007090 Ga0207713_10070908 149
156 3300025925 Ga0207650_10004216 Ga0207650_100042161 149
157 3300025972 Ga0207668_10187719 Ga0207668_101877192 149
158 3300026041 Ga0207639_10137487 Ga0207639_101374874 149
159 3300026142 Ga0207698_11034260 Ga0207698_110342601 149
160 3300027312 Ga0209371_1000043 Ga0209371_1000043156 149
161 3300028379 Ga0268266_10399747 Ga0268266_103997472 149
162 3300030500 Ga0268256_1000044 Ga0268256_1000044156 149
163 3300032004 Ga0307414_11006469 Ga0307414_110064691 149
164 3300035171 Ga0373946_0457977 Ga0373946_0457977_85_546 149
165 3300035695 Ga0373927_0617380 Ga0373927_0617380_209_670 149
166 3300036401 Ga0373937_0667663 Ga0373937_0667663_229_687 149
167 3300038705 Ga0237819_00396 Ga0237819_00396_13619_14068 149
168 3300041413 Ga0439465_0016075 Ga0439465_0016075_1685_2146 149
169 3300041451 Ga0451791_0384135 Ga0451791_0384135_144_593 149
170 3300041451 Ga0451791_1731006 Ga0451791_1731006_182_631 149
171 3300041452 Ga0451793_0092734 Ga0451793_0092734_512_961 149
172 3300041453 Ga0451797_0376581 Ga0451797_0376581_92_541 149
173 3300041456 Ga0451795_0194647 Ga0451795_0194647_46_504 149
174 3300041462 Ga0451806_164866 Ga0451806_164866_1701_2192 149
175 3300041463 Ga0451804_1174625 Ga0451804_1174625_1717_2208 149
176 3300041486 Ga0451807_0401420 Ga0451807_0401420_723_1214 149
177 3300041486 Ga0451807_1125715 Ga0451807_1125715_102_551 149
178 3300042006 Ga0439432_203410 Ga0439432_203410_35_496 149
179 3300042007 Ga0439449_0008923 Ga0439449_0008923_2499_2954 149
180 3300042007 Ga0439449_0011626 Ga0439449_0011626_2297_2758 149
181 3300046525 Ga0495663_0053799 Ga0495663_0053799_567_1019 149
182 3300048904 Ga0496101_0917667 Ga0496101_0917667_70_528 149
183 3300048920 Ga0496117_0010036 Ga0496117_0010036_6890_7339 149
184 3300048921 Ga0496118_0025694 Ga0496118_0025694_3244_3693 149
185 3300048921 Ga0496118_0072578 Ga0496118_0072578_664_1113 149
186 3300048922 Ga0496119_0001338 Ga0496119_0001338_10910_11359 149
187 3300048923 Ga0496120_0000320 Ga0496120_0000320_50614_51063 149
188 3300048925 Ga0496122_0000315 Ga0496122_0000315_50606_51055 149
189 3300048925 Ga0496122_0000710 Ga0496122_0000710_31374_31826 149
190 3300048926 Ga0496123_0000104 Ga0496123_0000104_136398_136850 149
191 3300048926 Ga0496123_0000149 Ga0496123_0000149_87028_87477 149
192 3300048927 Ga0496124_0000403 Ga0496124_0000403_33371_33820 149
193 3300048929 Ga0496126_0225586 Ga0496126_0225586_1055_1507 149
194 3300048929 Ga0496126_0387983 Ga0496126_0387983_495_944 149
195 3300049762 Ga0501265_001822 Ga0501265_001822_1913_2362 149
196 3300049772 Ga0501275_001076 Ga0501275_001076_78_527 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02643

DUF192

Uncharacterized ACR, COG1430

68

176

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pjy-assembly1.cif.gz_A crystal structure of a putative transcription regulator (r01717) from sinorhizobium meliloti 1021 at 1.55 a resolution 0.8586 17 141
3m7a-assembly2.cif.gz_B crystal structure of saro_0823 (yp_496102.1) a protein of unknown function from novosphingobium aromaticivorans dsm 12444 at 1.22 a resolution 0.8313 18 139
3pjy-assembly1.cif.gz_A crystal structure of a putative transcription regulator (r01717) from sinorhizobium meliloti 1021 at 1.55 a resolution 0.8271 17 141
3m7a-assembly2.cif.gz_B crystal structure of saro_0823 (yp_496102.1) a protein of unknown function from novosphingobium aromaticivorans dsm 12444 at 1.22 a resolution 0.7278 18 139
3rj2-assembly1.cif.gz_X structural and functional characterization of a novel histone h3 binding protein orf158l from the singapore grouper iridovirus (sgiv) 0.6374 79 129
ID Description Score Start End Superfamily
3pjyA00 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.8357 17 141 2.60.120.1140
af_Q58891_1_113_2.60.120.1140 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.8191 18 142 2.60.120.1140
af_Q58891_1_113_2.60.120.1140 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.8126 18 142 2.60.120.1140
3m7aB01 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.8106 18 139 2.60.120.1140
3pjyA00 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.8099 17 141 2.60.120.1140
ID Description Score Start End GO Terms
AF-A0A354YAF6-F1-model_v4 ACR family protein 0.9714 52 146
AF-A0A0D0S5L7-F1-model_v4 ACR 0.9704 27 147
AF-A0A1G4AKT7-F1-model_v4 deleted 0.9641 29 149
AF-A0A0S2FL13-F1-model_v4 deleted 0.9561 13 146
AF-A0A514BP26-F1-model_v4 DUF192 domain-containing protein 0.9561 15 143

Feature Viewer

pLDDT pTM Quality
85.04 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map