F300404

General Info

Members Datasets Scaffolds Average Seq Length
195 145 390 150

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0508261|Ga0395898_0508261_498_971
Length 157
Sequence MSEAVRAPALNGRTPVDVAVGVLIERDAQGREGRFLLTSRPLGKVYAGHWEFPGGKLEAGESVEEALRRELHEELGIDIDVATVQRWKEEMFDYPHALVRLHFCKVFAWRGEFEMREAQQMAWQTLPVQVRPVLPGTIPVLEWFAQERGHAGATHVD

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
30 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
47 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
48 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
52 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
53 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
54 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
55 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
56 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
57 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
58 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
59 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
60 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
68 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
69 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
70 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
71 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
72 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
73 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
74 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
75 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
76 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
77 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
78 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
79 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
80 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
93 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
94 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
95 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
96 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
97 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
101 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
102 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
103 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
104 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
105 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
114 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
115 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
116 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
117 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
118 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
119 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
120 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
121 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
122 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
123 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
124 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
125 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
126 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
127 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
128 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
129 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
130 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
131 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
132 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
136 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
137 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
144 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
145 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0
Isolates 1.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.77
Nodule 0.51
Rhizoplane 0.51
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0508261 3300037466 Bacteria 1146
2 JGI24744J21845_10006631 3300002077 Bacteria 2399
3 Ga0055530_10084880 3300003791 Bacteria 659
4 Ga0055531_10000179 3300003794 Bacteria 72059
5 Ga0065707_10612296 3300005295 Bacteria 683
6 Ga0070658_10249403 3300005327 Bacteria 1506
7 Ga0070682_100031892 3300005337 Bacteria 3191
8 Ga0068868_100118129 3300005338 Bacteria 2161
9 Ga0070691_10045580 3300005341 Bacteria 2081
10 Ga0070674_100094896 3300005356 Bacteria 2161
11 Ga0068867_100005640 3300005459 Bacteria 8872
12 Ga0070679_100031861 3300005530 Bacteria 5212
13 Ga0068855_100010307 3300005563 Bacteria 11273
14 Ga0068857_101306104 3300005577 Bacteria 704
15 Ga0068856_100084723 3300005614 Bacteria 3149
16 Ga0068859_100752314 3300005617 Bacteria 1063
17 Ga0068866_10003257 3300005718 Bacteria 6683
18 Ga0068861_100914465 3300005719 Bacteria 832
19 Ga0068860_100400386 3300005843 Bacteria 1358
20 Ga0068862_100074012 3300005844 Bacteria 2944
21 Ga0081455_10456989 3300005937 Bacteria 871
22 Ga0075366_10081257 3300006195 Bacteria 1936
23 Ga0075366_10446509 3300006195 Bacteria 798
24 Ga0075370_10024082 3300006353 Bacteria 3359
25 Ga0075370_10269838 3300006353 Bacteria 1010
26 Ga0097620_100752331 3300006931 Bacteria 1063
27 Ga0105245_10738044 3300009098 Bacteria 1020
28 Ga0157378_10001703 3300013297 Bacteria 19776
29 Ga0182008_10124596 3300014497 Bacteria 1282
30 Ga0157379_10069128 3300014968 Bacteria 3158
31 Ga0213872_10000007 3300021361 Bacteria 228206
32 Ga0213872_10088041 3300021361 Bacteria 1391
33 Ga0209050_1005184 3300025298 Bacteria 8337
34 Ga0209257_1000047 3300025304 Bacteria 460507
35 Ga0209257_1019426 3300025304 Bacteria 2559
36 Ga0207682_10061868 3300025893 Bacteria 1568
37 Ga0207642_10018424 3300025899 Bacteria 2679
38 Ga0207705_10203130 3300025909 Bacteria 1502
39 Ga0207657_10482449 3300025919 Bacteria 972
40 Ga0207652_10840913 3300025921 Bacteria 813
41 Ga0207669_10083641 3300025937 Bacteria 2053
42 Ga0207691_10968380 3300025940 Bacteria 711
43 Ga0207689_10553980 3300025942 Bacteria 966
44 Ga0207667_10448379 3300025949 Bacteria 1311
45 Ga0207667_10503676 3300025949 Bacteria 1228
46 Ga0207702_10356114 3300026078 Bacteria 1402
47 Ga0207702_10442925 3300026078 Bacteria 1259
48 Ga0207674_10701972 3300026116 Bacteria 977
49 Ga0209968_1000692 3300027526 Bacteria 5178
50 Ga0209974_10117103 3300027876 Bacteria 941
51 Ga0268264_10024923 3300028381 Bacteria 4888
52 Ga0268264_10049094 3300028381 Bacteria 3510
53 Ga0268264_10067211 3300028381 Bacteria 3025
54 Ga0307515_10058194 3300028794 Bacteria 5572
55 Ga0307515_10214332 3300028794 Bacteria 1761
56 Ga0265314_10015650 3300031711 Bacteria 6013
57 Ga0307516_10114003 3300031730 Bacteria 2501
58 Ga0307412_10178111 3300031911 Bacteria 1596
59 Ga0307412_10214130 3300031911 Bacteria 1472
60 Ga0307412_11341703 3300031911 Bacteria 645
61 Ga0307409_100524884 3300031995 Bacteria 1157
62 Ga0307414_10397952 3300032004 Bacteria 1195
63 Ga0307411_10000980 3300032005 Bacteria 10974
64 Ga0373948_0033516 3300034817 Bacteria 1046
65 Ga0373950_0030935 3300034818 Bacteria 990
66 Ga0373958_0030371 3300034819 Bacteria 1056
67 Ga0373939_0000040 3300035114 Bacteria 45617
68 Ga0373960_0000506 3300035121 Bacteria 7775
69 Ga0373961_0005696 3300035241 Bacteria 2992
70 Ga0373931_0000371 3300035691 Bacteria 18458
71 Ga0373931_0358388 3300035691 Bacteria 915
72 Ga0373931_0466280 3300035691 Bacteria 810
73 Ga0373927_0013540 3300035695 Bacteria 5418
74 Ga0373925_0002526 3300037068 Bacteria 14599
75 Ga0395899_0015907 3300037312 Bacteria 5736
76 Ga0395899_0211308 3300037312 Bacteria 1348
77 Ga0395899_0232893 3300037312 Bacteria 1271
78 Ga0395900_0006372 3300037418 Bacteria 12301
79 Ga0395900_0012866 3300037418 Bacteria 8548
80 Ga0395900_0113457 3300037418 Bacteria 2781
81 Ga0395900_0139044 3300037418 Bacteria 2487
82 Ga0395898_0002933 3300037466 Bacteria 19401
83 Ga0395898_0041859 3300037466 Bacteria 4522
84 Ga0395905_0003887 3300037471 Bacteria 15759
85 Ga0395905_0005984 3300037471 Bacteria 12318
86 Ga0395905_0013719 3300037471 Bacteria 7757
87 Ga0395905_0046642 3300037471 Bacteria 4063
88 Ga0395905_0070961 3300037471 Bacteria 3265
89 Ga0395905_0137590 3300037471 Bacteria 2298
90 Ga0395905_0169545 3300037471 Bacteria 2050
91 Ga0395905_0194580 3300037471 Bacteria 1901
92 Ga0395905_0226778 3300037471 Bacteria 1747
93 Ga0395905_0361100 3300037471 Bacteria 1345
94 Ga0395905_0465064 3300037471 Bacteria 1163
95 Ga0395905_0560891 3300037471 Bacteria 1043
96 Ga0395905_0855397 3300037471 Bacteria 812
97 Ga0395901_0089615 3300038443 Bacteria 3219
98 Ga0395901_0157864 3300038443 Bacteria 2382
99 Ga0395901_0171643 3300038443 Bacteria 2275
100 Ga0395901_0608666 3300038443 Bacteria 1101
101 Ga0395901_1048462 3300038443 Bacteria 788
102 Ga0436365_0321579 3300039437 Bacteria 800
103 Ga0436361_0163583 3300039447 Bacteria 173204
104 Ga0436361_0244800 3300039447 Bacteria 1491
105 Ga0439433_0061244 3300041999 Bacteria 897
106 Ga0439449_0003256 3300042007 Bacteria 6327
107 Ga0439457_019160 3300042014 Bacteria 1520
108 Ga0439462_0000723 3300042015 Bacteria 6806
109 Ga0450917_001392 3300042120 Bacteria 1731
110 Ga0450923_052123 3300042125 Bacteria 881
111 Ga0450890_000746 3300042127 Bacteria 4727
112 Ga0450892_000203 3300042130 Bacteria 7032
113 Ga0450903_034980 3300042138 Bacteria 752
114 Ga0450904_029228 3300042139 Bacteria 574
115 Ga0450889_014497 3300042144 Bacteria 840
116 Ga0439459_0056165 3300042438 Bacteria 878
117 Ga0450893_0038935 3300042532 Bacteria 866
118 Ga0466965_0005843 3300044683 Bacteria 5553
119 Ga0466965_0133896 3300044683 Bacteria 1286
120 Ga0466966_0001013 3300044684 Bacteria 17899
121 Ga0466966_0584539 3300044684 Bacteria 672
122 Ga0466963_0005987 3300044694 Bacteria 7165
123 Ga0466964_0395770 3300044706 Bacteria 720
124 Ga0466970_0001919 3300044765 Bacteria 10053
125 Ga0466957_0043085 3300044842 Bacteria 2731
126 Ga0466957_0302709 3300044842 Bacteria 1075
127 Ga0466960_0089490 3300044901 Bacteria 1566
128 Ga0466959_0000027 3300045049 Bacteria 114262
129 Ga0466959_0123839 3300045049 Bacteria 1836
130 Ga0451576_0039872 3300045051 Bacteria 4972
131 Ga0466958_0140418 3300045836 Bacteria 1520
132 Ga0466967_0848533 3300045976 Bacteria 908
133 Ga0495590_0005559 3300046457 Bacteria 4987
134 Ga0495621_0422543 3300046539 Bacteria 568
135 Ga0495656_0008413 3300046615 Bacteria 3681
136 Ga0495647_0116593 3300046681 Bacteria 1119
137 Ga0495660_0014020 3300046810 Bacteria 4647
138 Ga0495615_0003426 3300048090 Bacteria 2655
139 Ga0496109_0020515 3300048912 Bacteria 5837
140 Ga0496124_0000596 3300048927 Bacteria 60853
141 Ga0496125_0015626 3300048928 Bacteria 7326
142 Ga0501291_001340 3300049514 Bacteria 2845
143 Ga0501296_015018 3300049519 Bacteria 953
144 Ga0501297_045864 3300049520 Bacteria 629
145 Ga0501299_090060 3300049522 Bacteria 696
146 Ga0501300_000362 3300049523 Bacteria 6905
147 Ga0501031_0232058 3300049568 Bacteria 1201
148 Ga0501034_0659348 3300049571 Bacteria 947
149 Ga0501038_0058836 3300049574 Bacteria 3293
150 Ga0501038_0320070 3300049574 Bacteria 1214
151 Ga0501043_0208397 3300049579 Bacteria 1515
152 Ga0501046_0219698 3300049580 Bacteria 1407
153 Ga0501047_0076229 3300049581 Bacteria 3227
154 Ga0501072_0863972 3300049588 Bacteria 707
155 Ga0501201_001035 3300049651 Bacteria 2605
156 Ga0501202_003774 3300049652 Bacteria 2612
157 Ga0501207_001579 3300049654 Bacteria 2863
158 Ga0501210_006157 3300049657 Bacteria 874
159 Ga0501211_006924 3300049658 Bacteria 1117
160 Ga0501217_006180 3300049661 Bacteria 2534
161 Ga0501222_001940 3300049662 Bacteria 2869
162 Ga0501223_022719 3300049663 Bacteria 1224
163 Ga0501227_027678 3300049665 Bacteria 1343
164 Ga0501233_001974 3300049668 Bacteria 3572
165 Ga0501235_007699 3300049669 Bacteria 2347
166 Ga0501235_096119 3300049669 Bacteria 719
167 Ga0501236_103584 3300049670 Bacteria 561
168 Ga0501252_021019 3300049682 Bacteria 853
169 Ga0501255_000610 3300049684 Bacteria 2523
170 Ga0501221_000686 3300049704 Bacteria 5423
171 Ga0501225_0032555 3300049705 Bacteria 1434
172 Ga0501229_000069 3300049706 Bacteria 10281
173 Ga0501262_001914 3300049759 Bacteria 2344
174 Ga0501262_007220 3300049759 Bacteria 1342
175 Ga0501267_003059 3300049764 Bacteria 1507
176 Ga0501274_022607 3300049771 Bacteria 663
177 Ga0501035_0120920 3300049822 Bacteria 2289
178 Ga0501035_0359936 3300049822 Bacteria 1216
179 Ga0501044_0071043 3300049823 Bacteria 3540
180 Ga0501044_0289601 3300049823 Bacteria 1569
181 Ga0501226_002111 3300049853 Bacteria 2468
182 nmdc:mga00v17_226053_c1 3300050491 Bacteria 1212
183 nmdc:mga0yw44_34515_c1 3300050492 Bacteria 2965
184 nmdc:mga0yw44_61154_c1 3300050492 Bacteria 2309
185 nmdc:mga0k408_223138_c1 3300050493 Bacteria 1125
186 nmdc:mga0k408_254650_c1 3300050493 Bacteria 1048
187 nmdc:mga0k408_67777_c1 3300050493 Bacteria 2080
188 nmdc:mga06z11_472818_c1 3300050494 Bacteria 758
189 nmdc:mga07m45_191551_c1 3300050496 Bacteria 1189
190 nmdc:mga07m45_22932_c1 3300050496 Bacteria 3410
191 Ga0500628_035642 3300053129 Bacteria 1108
192 Ga0500559_0379030 3300053136 Bacteria 660
193 Ga0500619_000171 3300053154 Bacteria 15684
194 2643743745 2643221544 Bacteria 5886209
195 2894024316 2894023352 Bacteria 5167372
196 Ga0395898_0508261
197 JGI24744J21845_10006631
198 Ga0055530_10084880
199 Ga0055531_10000179
200 Ga0065707_10612296
201 Ga0070658_10249403
202 Ga0070682_100031892
203 Ga0068868_100118129
204 Ga0070691_10045580
205 Ga0070674_100094896
206 Ga0068867_100005640
207 Ga0070679_100031861
208 Ga0068855_100010307
209 Ga0068857_101306104
210 Ga0068856_100084723
211 Ga0068859_100752314
212 Ga0068866_10003257
213 Ga0068861_100914465
214 Ga0068860_100400386
215 Ga0068862_100074012
216 Ga0081455_10456989
217 Ga0075366_10081257
218 Ga0075366_10446509
219 Ga0075370_10024082
220 Ga0075370_10269838
221 Ga0097620_100752331
222 Ga0105245_10738044
223 Ga0157378_10001703
224 Ga0182008_10124596
225 Ga0157379_10069128
226 Ga0213872_10000007
227 Ga0213872_10088041
228 Ga0209050_1005184
229 Ga0209257_1000047
230 Ga0209257_1019426
231 Ga0207682_10061868
232 Ga0207642_10018424
233 Ga0207705_10203130
234 Ga0207657_10482449
235 Ga0207652_10840913
236 Ga0207669_10083641
237 Ga0207691_10968380
238 Ga0207689_10553980
239 Ga0207667_10448379
240 Ga0207667_10503676
241 Ga0207702_10356114
242 Ga0207702_10442925
243 Ga0207674_10701972
244 Ga0209968_1000692
245 Ga0209974_10117103
246 Ga0268264_10024923
247 Ga0268264_10049094
248 Ga0268264_10067211
249 Ga0307515_10058194
250 Ga0307515_10214332
251 Ga0265314_10015650
252 Ga0307516_10114003
253 Ga0307412_10178111
254 Ga0307412_10214130
255 Ga0307412_11341703
256 Ga0307409_100524884
257 Ga0307414_10397952
258 Ga0307411_10000980
259 Ga0373948_0033516
260 Ga0373950_0030935
261 Ga0373958_0030371
262 Ga0373939_0000040
263 Ga0373960_0000506
264 Ga0373961_0005696
265 Ga0373931_0000371
266 Ga0373931_0358388
267 Ga0373931_0466280
268 Ga0373927_0013540
269 Ga0373925_0002526
270 Ga0395899_0015907
271 Ga0395899_0211308
272 Ga0395899_0232893
273 Ga0395900_0006372
274 Ga0395900_0012866
275 Ga0395900_0113457
276 Ga0395900_0139044
277 Ga0395898_0002933
278 Ga0395898_0041859
279 Ga0395905_0003887
280 Ga0395905_0005984
281 Ga0395905_0013719
282 Ga0395905_0046642
283 Ga0395905_0070961
284 Ga0395905_0137590
285 Ga0395905_0169545
286 Ga0395905_0194580
287 Ga0395905_0226778
288 Ga0395905_0361100
289 Ga0395905_0465064
290 Ga0395905_0560891
291 Ga0395905_0855397
292 Ga0395901_0089615
293 Ga0395901_0157864
294 Ga0395901_0171643
295 Ga0395901_0608666
296 Ga0395901_1048462
297 Ga0436365_0321579
298 Ga0436361_0163583
299 Ga0436361_0244800
300 Ga0439433_0061244
301 Ga0439449_0003256
302 Ga0439457_019160
303 Ga0439462_0000723
304 Ga0450917_001392
305 Ga0450923_052123
306 Ga0450890_000746
307 Ga0450892_000203
308 Ga0450903_034980
309 Ga0450904_029228
310 Ga0450889_014497
311 Ga0439459_0056165
312 Ga0450893_0038935
313 Ga0466965_0005843
314 Ga0466965_0133896
315 Ga0466966_0001013
316 Ga0466966_0584539
317 Ga0466963_0005987
318 Ga0466964_0395770
319 Ga0466970_0001919
320 Ga0466957_0043085
321 Ga0466957_0302709
322 Ga0466960_0089490
323 Ga0466959_0000027
324 Ga0466959_0123839
325 Ga0451576_0039872
326 Ga0466958_0140418
327 Ga0466967_0848533
328 Ga0495590_0005559
329 Ga0495621_0422543
330 Ga0495656_0008413
331 Ga0495647_0116593
332 Ga0495660_0014020
333 Ga0495615_0003426
334 Ga0496109_0020515
335 Ga0496124_0000596
336 Ga0496125_0015626
337 Ga0501291_001340
338 Ga0501296_015018
339 Ga0501297_045864
340 Ga0501299_090060
341 Ga0501300_000362
342 Ga0501031_0232058
343 Ga0501034_0659348
344 Ga0501038_0058836
345 Ga0501038_0320070
346 Ga0501043_0208397
347 Ga0501046_0219698
348 Ga0501047_0076229
349 Ga0501072_0863972
350 Ga0501201_001035
351 Ga0501202_003774
352 Ga0501207_001579
353 Ga0501210_006157
354 Ga0501211_006924
355 Ga0501217_006180
356 Ga0501222_001940
357 Ga0501223_022719
358 Ga0501227_027678
359 Ga0501233_001974
360 Ga0501235_007699
361 Ga0501235_096119
362 Ga0501236_103584
363 Ga0501252_021019
364 Ga0501255_000610
365 Ga0501221_000686
366 Ga0501225_0032555
367 Ga0501229_000069
368 Ga0501262_001914
369 Ga0501262_007220
370 Ga0501267_003059
371 Ga0501274_022607
372 Ga0501035_0120920
373 Ga0501035_0359936
374 Ga0501044_0071043
375 Ga0501044_0289601
376 Ga0501226_002111
377 nmdc:mga00v17_226053_c1
378 nmdc:mga0yw44_34515_c1
379 nmdc:mga0yw44_61154_c1
380 nmdc:mga0k408_223138_c1
381 nmdc:mga0k408_254650_c1
382 nmdc:mga0k408_67777_c1
383 nmdc:mga06z11_472818_c1
384 nmdc:mga07m45_191551_c1
385 nmdc:mga07m45_22932_c1
386 Ga0500628_035642
387 Ga0500559_0379030
388 Ga0500619_000171
389 2643743745
390 2894024316

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14815

NUDIX_4

NUDIX domain

22

134

0.78

PF00293

NUDIX

NUDIX domain

15

144

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ef5-assembly1.cif.gz_B structure of the rna pyrophosphohydrolase bdrpph in complex with dgtp 0.9235 39 141
7ww5-assembly1.cif.gz_A crystal structure of mutt-8-oxo-dgtp complex 0.8902 40 164
3r03-assembly1.cif.gz_A the crystal structure of nudix hydrolase from rhodospirillum rubrum 0.8826 39 158
4v14-assembly2.cif.gz_B structure and function analysis of mutt from the psychrofile fish pathogen aliivibrio salmonicida and the mesophile vibrio cholerae 0.8792 41 143
4dyw-assembly1.cif.gz_A crystal structure of mutt nudix hydrolase from burkholderia pseudomallei 0.872 38 160
ID Description Score Start End Superfamily
3r03B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9174 36 141 3.90.79.10
3a6uA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8892 41 158 3.90.79.10
4v14B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8792 41 143 3.90.79.10
3grnB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8752 36 143 3.90.79.10
4dywB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.875 38 160 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A258R7N0-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9991 42 175 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-V4YJB4-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9866 35 162 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A258R7N0-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9844 42 175 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A415CI57-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) (7,8-dihydro-8-oxoguanine-triphosphatase) (Mutator protein MutT) (dGTP pyrophosphohydrolase) 0.9834 38 141 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716
AF-A0A1J5QWY7-F1-model_v4 8-oxo-dGTP diphosphatase (EC 3.6.1.55) 0.9774 35 172 GO:0006260
GO:0006281
GO:0008413
GO:0035539
GO:0044715
GO:0044716

Map