F298282

General Info

Members Datasets Scaffolds Average Seq Length
194 137 194 256

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100066471|Ga0070705_1000664712
Length 290
Sequence VQIARGYDNCDTAATVDAPRTTDYNHPVYRELRVAVVIPAFNERHKIADTVASIPAFVDHILVIDDASHDDTSGRAELAALRRDEPASVEVIRHTANRGVGGAITTGYRRALAIGADVAVVMAGDGQMDPLDLPALLAPLAAGEADYVKGNRFLHPAIWTTMPASRIVGNVVLSTATRVTSGYRHVFDSQCGYTAIHARALAAIELDELFPRYGYPNDLLSRLHVARMRVVDVPVRPIYGAAWKSGIHLGTALHPIPWVLLRSWGHRVAAQLRRRMRARFDAPAVEPDAL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
63 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
81 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
84 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
85 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
128 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
129 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
130 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
131 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
132 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
133 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
134 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
135 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
136 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
137 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.73
Nodule 0
Rhizoplane 2.58
Rhizosphere 85.57
Stem 0
Stem Tuber 0
Unclassified 4.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10045346 3300005327 Bacteria 3555
2 Ga0070690_100051150 3300005330 Bacteria 2636
3 Ga0068869_100056754 3300005334 Bacteria 2856
4 Ga0070680_100286999 3300005336 Archaea 1395
5 Ga0070689_100130414 3300005340 Bacteria 2015
6 Ga0070691_10174309 3300005341 Unclassified 1116
7 Ga0070688_100054456 3300005365 Bacteria 2505
8 Ga0070688_100212512 3300005365 Bacteria 1359
9 Ga0070688_100555076 3300005365 Bacteria 874
10 Ga0070705_100066471 3300005440 Bacteria 2162
11 Ga0070694_100199599 3300005444 Bacteria 1490
12 Ga0070708_100078625 3300005445 Bacteria 2982
13 Ga0070681_10304340 3300005458 Archaea 1503
14 Ga0070698_100000382 3300005471 Bacteria 46452
15 Ga0070679_100011372 3300005530 Bacteria 8478
16 Ga0070679_100012584 3300005530 Bacteria 8089
17 Ga0070679_100035344 3300005530 Bacteria 4957
18 Ga0070684_100025649 3300005535 Unclassified 4958
19 Ga0070684_100089743 3300005535 Bacteria 2732
20 Ga0070684_100476778 3300005535 Bacteria 1154
21 Ga0070684_100566174 3300005535 Bacteria 1055
22 Ga0070697_100219317 3300005536 Bacteria 1621
23 Ga0070695_100267918 3300005545 Bacteria 1250
24 Ga0068857_100136699 3300005577 Bacteria 2213
25 Ga0068857_100491259 3300005577 Bacteria 1151
26 Ga0068856_100098866 3300005614 Bacteria 2909
27 Ga0068856_100178204 3300005614 Bacteria 2138
28 Ga0068852_100704043 3300005616 Bacteria 1020
29 Ga0068859_100106973 3300005617 Bacteria 2857
30 Ga0068859_100206145 3300005617 Bacteria 2051
31 Ga0068864_100076554 3300005618 Bacteria 2924
32 Ga0068864_100401149 3300005618 Bacteria 1303
33 Ga0068863_100226949 3300005841 Unclassified 1801
34 Ga0068860_100069644 3300005843 Bacteria 3344
35 Ga0068862_100503331 3300005844 Bacteria 1150
36 Ga0070717_10052071 3300006028 Bacteria 3371
37 Ga0070717_10062771 3300006028 Unclassified 3082
38 Ga0070717_10229692 3300006028 Bacteria 1633
39 Ga0097621_100054417 3300006237 Bacteria 3264
40 Ga0075429_100018171 3300006880 Bacteria 6085
41 Ga0068865_100020583 3300006881 Bacteria 4280
42 Ga0075436_100290275 3300006914 Bacteria 1171
43 Ga0097620_100106971 3300006931 Bacteria 2857
44 Ga0097620_100206143 3300006931 Bacteria 2051
45 Ga0075435_100179149 3300007076 Bacteria 1791
46 Ga0111539_10456228 3300009094 Bacteria 1488
47 Ga0105245_10000061 3300009098 Bacteria 118794
48 Ga0105238_10328819 3300009551 Archaea 1515
49 Ga0105239_10034043 3300010375 Bacteria 5593
50 Ga0157374_10027358 3300013296 Bacteria 5143
51 Ga0157374_10424390 3300013296 Bacteria 1329
52 Ga0157378_10274962 3300013297 Bacteria 1621
53 Ga0157372_10317417 3300013307 Bacteria 1814
54 Ga0163163_10543205 3300014325 Bacteria 1224
55 Ga0157379_10131894 3300014968 Bacteria 2249
56 Ga0157376_10119369 3300014969 Bacteria 2335
57 Ga0207699_10140126 3300025906 Bacteria 1588
58 Ga0207705_10183008 3300025909 Bacteria 1582
59 Ga0207660_10160422 3300025917 Bacteria 1734
60 Ga0207660_10251236 3300025917 Archaea 1396
61 Ga0207660_10306197 3300025917 Bacteria 1266
62 Ga0207652_10045478 3300025921 Bacteria 3743
63 Ga0207652_10085505 3300025921 Bacteria 2764
64 Ga0207652_10207364 3300025921 Bacteria 1764
65 Ga0207652_10298821 3300025921 Archaea 1453
66 Ga0207687_10005975 3300025927 Bacteria 8049
67 Ga0207670_10242958 3300025936 Bacteria 1388
68 Ga0207704_10033773 3300025938 Bacteria 2913
69 Ga0207689_10047993 3300025942 Bacteria 3522
70 Ga0207661_10212969 3300025944 Bacteria 1704
71 Ga0207667_10614636 3300025949 Bacteria 1095
72 Ga0207708_10107381 3300026075 Bacteria 2164
73 Ga0207702_10171061 3300026078 Bacteria 1992
74 Ga0207702_10225090 3300026078 Bacteria 1750
75 Ga0207641_10115436 3300026088 Bacteria 2387
76 Ga0207648_10320355 3300026089 Bacteria 1393
77 Ga0207676_10112332 3300026095 Bacteria 2282
78 Ga0207676_10131466 3300026095 Bacteria 2129
79 Ga0207676_10322959 3300026095 Unclassified 1418
80 Ga0207674_10057575 3300026116 Bacteria 3939
81 Ga0207674_10595577 3300026116 Archaea 1068
82 Ga0207675_100047722 3300026118 Bacteria 3997
83 Ga0268266_10003230 3300028379 Bacteria 16467
84 Ga0268265_10510954 3300028380 Bacteria 1134
85 Ga0268265_10545713 3300028380 Bacteria 1100
86 Ga0268264_10398179 3300028381 Bacteria 1322
87 Ga0265318_10055127 3300028577 Unclassified 1489
88 Ga0307517_10114503 3300028786 Bacteria 2029
89 Ga0307515_10016922 3300028794 Bacteria 13328
90 Ga0265338_10016222 3300028800 Bacteria 8120
91 Ga0265338_10113104 3300028800 Bacteria 2181
92 Ga0265338_10138923 3300028800 Bacteria 1906
93 Ga0265332_10007254 3300031238 Bacteria 5018
94 Ga0265332_10029468 3300031238 Bacteria 2400
95 Ga0265332_10095489 3300031238 Bacteria 1256
96 Ga0265332_10139406 3300031238 Bacteria 1016
97 Ga0265328_10005209 3300031239 Bacteria 5587
98 Ga0265328_10097370 3300031239 Bacteria 1088
99 Ga0265320_10023229 3300031240 Bacteria 3304
100 Ga0265320_10040459 3300031240 Bacteria 2324
101 Ga0265340_10004877 3300031247 Bacteria 7465
102 Ga0265340_10089210 3300031247 Bacteria 1443
103 Ga0265339_10000485 3300031249 Bacteria 31048
104 Ga0265331_10201333 3300031250 Bacteria 897
105 Ga0307513_10011320 3300031456 Bacteria 11094
106 Ga0307509_10000398 3300031507 Bacteria 72894
107 Ga0307509_10018199 3300031507 Bacteria 8059
108 Ga0307509_10038288 3300031507 Bacteria 5234
109 Ga0307509_10195539 3300031507 Bacteria 1867
110 Ga0265314_10006008 3300031711 Bacteria 10822
111 Ga0265342_10000930 3300031712 Bacteria 29120
112 Ga0265342_10041820 3300031712 Bacteria 2771
113 Ga0307516_10107761 3300031730 Bacteria 2594
114 Ga0307405_10069858 3300031731 Bacteria 2253
115 Ga0373949_0000534 3300035090 Bacteria 12534
116 Ga0373936_0000073 3300035113 Bacteria 40236
117 Ga0373939_0071246 3300035114 Bacteria 1132
118 Ga0373945_0280874 3300035116 Bacteria 709
119 Ga0373956_0009303 3300035119 Bacteria 3994
120 Ga0373960_0069665 3300035121 Bacteria 1085
121 Ga0373955_0048081 3300035172 Unclassified 2312
122 Ga0373955_0064326 3300035172 Bacteria 2033
123 Ga0373961_0000029 3300035241 Bacteria 93421
124 Ga0316574_0173871 3300035398 Bacteria 1386
125 Ga0373933_0059096 3300035724 Bacteria 2308
126 Ga0373937_0047737 3300036401 Bacteria 3918
127 Ga0373937_0211556 3300036401 Bacteria 1825
128 Ga0373925_0020646 3300037068 Bacteria 4799
129 Ga0373925_0033427 3300037068 Bacteria 3790
130 Ga0373925_0351390 3300037068 Unclassified 1197
131 Ga0395899_0092188 3300037312 Bacteria 2194
132 Ga0395899_0156521 3300037312 Bacteria 1612
133 Ga0395900_0058012 3300037418 Bacteria 3985
134 Ga0395900_0229247 3300037418 Bacteria 1869
135 Ga0395905_0257966 3300037471 Bacteria 1628
136 Ga0395905_0306912 3300037471 Bacteria 1475
137 Ga0395901_0091325 3300038443 Bacteria 3187
138 Ga0466969_0001100 3300044656 Bacteria 14609
139 Ga0453683_0257510 3300044673 Bacteria 1113
140 Ga0466966_0005055 3300044684 Bacteria 8668
141 Ga0453684_0147424 3300044712 Bacteria 2801
142 Ga0466959_0018917 3300045049 Bacteria 5061
143 Ga0466967_0253209 3300045976 Bacteria 1683
144 Ga0495629_0284228 3300046459 Bacteria 1135
145 Ga0495650_0027602 3300046471 Bacteria 2620
146 Ga0495630_0019090 3300046517 Bacteria 5039
147 Ga0495634_0017981 3300046642 Bacteria 5037
148 Ga0495599_0215016 3300046678 Bacteria 1177
149 Ga0495604_0058658 3300047317 Bacteria 2955
150 Ga0495604_0181323 3300047317 Bacteria 1473
151 Ga0495674_0008055 3300047319 Bacteria 10058
152 Ga0495602_0121932 3300048088 Bacteria 2096
153 Ga0496101_0349928 3300048904 Unclassified 1161
154 Ga0496104_0050125 3300048907 Unclassified 3939
155 Ga0496112_0110714 3300048915 Bacteria 2716
156 Ga0496114_0009297 3300048917 Bacteria 7801
157 Ga0496115_0288384 3300048918 Bacteria 1347
158 Ga0501034_0056328 3300049571 Bacteria 3956
159 Ga0501034_0115741 3300049571 Bacteria 2669
160 Ga0501037_0260326 3300049573 Bacteria 1212
161 Ga0501037_0468492 3300049573 Bacteria 858
162 Ga0501042_0288748 3300049578 Bacteria 1185
163 Ga0501043_0165020 3300049579 Bacteria 1730
164 Ga0501043_0549322 3300049579 Bacteria 858
165 Ga0501047_0004255 3300049581 Bacteria 13478
166 Ga0501047_0111480 3300049581 Bacteria 2618
167 Ga0501069_0046486 3300049585 Bacteria 2408
168 Ga0501070_0014297 3300049586 Bacteria 6680
169 Ga0501070_0063459 3300049586 Bacteria 3060
170 Ga0501070_0120770 3300049586 Bacteria 2166
171 Ga0501070_0166811 3300049586 Bacteria 1814
172 Ga0501072_0111589 3300049588 Bacteria 2177
173 Ga0501074_0071765 3300049590 Bacteria 2489
174 Ga0501044_0031407 3300049823 Bacteria 5591
175 nmdc:mga09592_75424_c1 3300050508 Bacteria 2867
176 nmdc:mga08y16_55762_c1 3300050511 Bacteria 4130
177 nmdc:mga0rr50_241912_c1 3300050513 Bacteria 1496
178 Ga0495601_0197420 3300053077 Bacteria 1315
179 Ga0495601_0331314 3300053077 Unclassified 991
180 Ga0500566_0001743 3300053094 Bacteria 12773
181 Ga0500566_0158273 3300053094 Bacteria 1183
182 Ga0500640_001276 3300053095 Bacteria 7486
183 Ga0500554_000023 3300053102 Bacteria 25577
184 Ga0500595_001133 3300053119 Bacteria 14759
185 Ga0500597_000372 3300053120 Bacteria 9330
186 Ga0500614_000256 3300053123 Bacteria 13894
187 Ga0500614_002670 3300053123 Bacteria 3943
188 Ga0500642_0120229 3300053130 Bacteria 1228
189 Ga0500559_0003726 3300053136 Bacteria 7416
190 Ga0500568_0014728 3300053139 Bacteria 3521
191 Ga0500568_0029881 3300053139 Bacteria 2258
192 Ga0500585_041147 3300053144 Bacteria 1631
193 Ga0500603_002196 3300053150 Bacteria 4308
194 Ga0500603_005286 3300053150 Bacteria 2772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035116 Ga0373945_0280874 Ga0373945_0280874_10_699 201
2 3300048915 Ga0496112_0110714 Ga0496112_0110714_2008_2706 207
3 3300028577 Ga0265318_10055127 Ga0265318_100551272 221
4 3300031238 Ga0265332_10029468 Ga0265332_100294682 221
5 3300035398 Ga0316574_0173871 Ga0316574_0173871_615_1376 222
6 3300049571 Ga0501034_0056328 Ga0501034_0056328_2338_3093 222
7 3300048918 Ga0496115_0288384 Ga0496115_0288384_61_903 223
8 3300014968 Ga0157379_10131894 Ga0157379_101318942 224
9 3300048904 Ga0496101_0349928 Ga0496101_0349928_96_956 224
10 3300048907 Ga0496104_0050125 Ga0496104_0050125_330_1190 224
11 3300048917 Ga0496114_0009297 Ga0496114_0009297_6120_6980 224
12 3300031247 Ga0265340_10089210 Ga0265340_100892102 227
13 3300053130 Ga0500642_0120229 Ga0500642_0120229_57_890 228
14 3300049573 Ga0501037_0468492 Ga0501037_0468492_131_847 230
15 3300031247 Ga0265340_10004877 Ga0265340_100048775 231
16 3300037312 Ga0395899_0092188 Ga0395899_0092188_1280_2035 231
17 3300037418 Ga0395900_0058012 Ga0395900_0058012_2444_3199 231
18 3300038443 Ga0395901_0091325 Ga0395901_0091325_1321_2076 231
19 3300044656 Ga0466969_0001100 Ga0466969_0001100_227_1069 231
20 3300044684 Ga0466966_0005055 Ga0466966_0005055_227_1069 231
21 3300045049 Ga0466959_0018917 Ga0466959_0018917_3272_4114 231
22 3300006028 Ga0070717_10062771 Ga0070717_100627713 233
23 3300035172 Ga0373955_0064326 Ga0373955_0064326_625_1416 234
24 3300037068 Ga0373925_0033427 Ga0373925_0033427_1426_2217 234
25 3300046517 Ga0495630_0019090 Ga0495630_0019090_666_1457 234
26 3300046642 Ga0495634_0017981 Ga0495634_0017981_3714_4505 234
27 3300047319 Ga0495674_0008055 Ga0495674_0008055_6461_7252 234
28 3300053077 Ga0495601_0197420 Ga0495601_0197420_282_1073 234
29 3300009094 Ga0111539_10456228 Ga0111539_104562281 236
30 3300049586 Ga0501070_0063459 Ga0501070_0063459_1948_2703 236
31 3300005530 Ga0070679_100011372 Ga0070679_1000113725 238
32 3300025921 Ga0207652_10045478 Ga0207652_100454782 238
33 3300050511 nmdc:mga08y16_55762_c1 nmdc:mga08y16_55762_c1_740_1528 238
34 3300049585 Ga0501069_0046486 Ga0501069_0046486_1478_2221 239
35 3300049586 Ga0501070_0014297 Ga0501070_0014297_4473_5216 239
36 3300049586 Ga0501070_0166811 Ga0501070_0166811_1007_1750 239
37 3300049588 Ga0501072_0111589 Ga0501072_0111589_838_1581 239
38 3300049590 Ga0501074_0071765 Ga0501074_0071765_186_929 239
39 3300005336 Ga0070680_100286999 Ga0070680_1002869992 240
40 3300005341 Ga0070691_10174309 Ga0070691_101743092 240
41 3300005365 Ga0070688_100212512 Ga0070688_1002125122 240
42 3300005444 Ga0070694_100199599 Ga0070694_1001995992 240
43 3300005458 Ga0070681_10304340 Ga0070681_103043402 240
44 3300005530 Ga0070679_100035344 Ga0070679_1000353444 240
45 3300005535 Ga0070684_100025649 Ga0070684_1000256494 240
46 3300005535 Ga0070684_100476778 Ga0070684_1004767781 240
47 3300005535 Ga0070684_100566174 Ga0070684_1005661742 240
48 3300005536 Ga0070697_100219317 Ga0070697_1002193172 240
49 3300005577 Ga0068857_100136699 Ga0068857_1001366992 240
50 3300005614 Ga0068856_100098866 Ga0068856_1000988662 240
51 3300005614 Ga0068856_100178204 Ga0068856_1001782043 240
52 3300005616 Ga0068852_100704043 Ga0068852_1007040432 240
53 3300005617 Ga0068859_100106973 Ga0068859_1001069733 240
54 3300005617 Ga0068859_100206145 Ga0068859_1002061452 240
55 3300005618 Ga0068864_100076554 Ga0068864_1000765543 240
56 3300005618 Ga0068864_100401149 Ga0068864_1004011491 240
57 3300005841 Ga0068863_100226949 Ga0068863_1002269492 240
58 3300005843 Ga0068860_100069644 Ga0068860_1000696444 240
59 3300005844 Ga0068862_100503331 Ga0068862_1005033312 240
60 3300006237 Ga0097621_100054417 Ga0097621_1000544174 240
61 3300006914 Ga0075436_100290275 Ga0075436_1002902752 240
62 3300006931 Ga0097620_100106971 Ga0097620_1001069712 240
63 3300006931 Ga0097620_100206143 Ga0097620_1002061432 240
64 3300007076 Ga0075435_100179149 Ga0075435_1001791492 240
65 3300009551 Ga0105238_10328819 Ga0105238_103288192 240
66 3300010375 Ga0105239_10034043 Ga0105239_100340435 240
67 3300013296 Ga0157374_10424390 Ga0157374_104243902 240
68 3300013307 Ga0157372_10317417 Ga0157372_103174173 240
69 3300025909 Ga0207705_10183008 Ga0207705_101830082 240
70 3300025917 Ga0207660_10160422 Ga0207660_101604223 240
71 3300025917 Ga0207660_10251236 Ga0207660_102512362 240
72 3300025917 Ga0207660_10306197 Ga0207660_103061972 240
73 3300025921 Ga0207652_10085505 Ga0207652_100855052 240
74 3300025921 Ga0207652_10298821 Ga0207652_102988212 240
75 3300025944 Ga0207661_10212969 Ga0207661_102129692 240
76 3300026078 Ga0207702_10171061 Ga0207702_101710613 240
77 3300026078 Ga0207702_10225090 Ga0207702_102250902 240
78 3300026088 Ga0207641_10115436 Ga0207641_101154362 240
79 3300026095 Ga0207676_10112332 Ga0207676_101123322 240
80 3300026095 Ga0207676_10131466 Ga0207676_101314662 240
81 3300026116 Ga0207674_10057575 Ga0207674_100575753 240
82 3300026118 Ga0207675_100047722 Ga0207675_1000477224 240
83 3300028380 Ga0268265_10510954 Ga0268265_105109542 240
84 3300028381 Ga0268264_10398179 Ga0268264_103981792 240
85 3300031250 Ga0265331_10201333 Ga0265331_102013331 240
86 3300031507 Ga0307509_10018199 Ga0307509_100181995 240
87 3300031731 Ga0307405_10069858 Ga0307405_100698582 240
88 3300035119 Ga0373956_0009303 Ga0373956_0009303_1430_2266 240
89 3300035172 Ga0373955_0048081 Ga0373955_0048081_244_1080 240
90 3300035724 Ga0373933_0059096 Ga0373933_0059096_770_1606 240
91 3300036401 Ga0373937_0047737 Ga0373937_0047737_577_1413 240
92 3300037068 Ga0373925_0020646 Ga0373925_0020646_3627_4421 240
93 3300046459 Ga0495629_0284228 Ga0495629_0284228_295_1098 240
94 3300046471 Ga0495650_0027602 Ga0495650_0027602_1801_2526 240
95 3300046678 Ga0495599_0215016 Ga0495599_0215016_294_1076 240
96 3300047317 Ga0495604_0058658 Ga0495604_0058658_1799_2581 240
97 3300047317 Ga0495604_0181323 Ga0495604_0181323_202_1005 240
98 3300048088 Ga0495602_0121932 Ga0495602_0121932_1298_2080 240
99 3300050513 nmdc:mga0rr50_241912_c1 nmdc:mga0rr50_241912_c1_301_1029 240
100 3300005330 Ga0070690_100051150 Ga0070690_1000511503 241
101 3300005334 Ga0068869_100056754 Ga0068869_1000567544 241
102 3300005340 Ga0070689_100130414 Ga0070689_1001304142 241
103 3300005365 Ga0070688_100054456 Ga0070688_1000544563 241
104 3300005365 Ga0070688_100555076 Ga0070688_1005550761 241
105 3300005440 Ga0070705_100066471 Ga0070705_1000664712 241
106 3300005445 Ga0070708_100078625 Ga0070708_1000786254 241
107 3300005471 Ga0070698_100000382 Ga0070698_10000038218 241
108 3300005530 Ga0070679_100012584 Ga0070679_1000125843 241
109 3300005535 Ga0070684_100089743 Ga0070684_1000897432 241
110 3300005545 Ga0070695_100267918 Ga0070695_1002679182 241
111 3300005577 Ga0068857_100491259 Ga0068857_1004912592 241
112 3300006028 Ga0070717_10052071 Ga0070717_100520712 241
113 3300006028 Ga0070717_10229692 Ga0070717_102296922 241
114 3300006880 Ga0075429_100018171 Ga0075429_1000181716 241
115 3300006881 Ga0068865_100020583 Ga0068865_1000205833 241
116 3300009098 Ga0105245_10000061 Ga0105245_1000006120 241
117 3300013296 Ga0157374_10027358 Ga0157374_100273585 241
118 3300013297 Ga0157378_10274962 Ga0157378_102749622 241
119 3300014325 Ga0163163_10543205 Ga0163163_105432052 241
120 3300014969 Ga0157376_10119369 Ga0157376_101193694 241
121 3300025906 Ga0207699_10140126 Ga0207699_101401262 241
122 3300025921 Ga0207652_10207364 Ga0207652_102073642 241
123 3300025927 Ga0207687_10005975 Ga0207687_100059755 241
124 3300025936 Ga0207670_10242958 Ga0207670_102429581 241
125 3300025938 Ga0207704_10033773 Ga0207704_100337733 241
126 3300025942 Ga0207689_10047993 Ga0207689_100479932 241
127 3300025949 Ga0207667_10614636 Ga0207667_106146362 241
128 3300026075 Ga0207708_10107381 Ga0207708_101073812 241
129 3300026089 Ga0207648_10320355 Ga0207648_103203552 241
130 3300026095 Ga0207676_10322959 Ga0207676_103229592 241
131 3300026116 Ga0207674_10595577 Ga0207674_105955771 241
132 3300028379 Ga0268266_10003230 Ga0268266_100032303 241
133 3300028380 Ga0268265_10545713 Ga0268265_105457132 241
134 3300028786 Ga0307517_10114503 Ga0307517_101145032 241
135 3300028794 Ga0307515_10016922 Ga0307515_100169226 241
136 3300028800 Ga0265338_10016222 Ga0265338_100162226 241
137 3300028800 Ga0265338_10138923 Ga0265338_101389233 241
138 3300031238 Ga0265332_10007254 Ga0265332_100072545 241
139 3300031238 Ga0265332_10095489 Ga0265332_100954892 241
140 3300031238 Ga0265332_10139406 Ga0265332_101394062 241
141 3300031239 Ga0265328_10005209 Ga0265328_100052095 241
142 3300031239 Ga0265328_10097370 Ga0265328_100973702 241
143 3300031240 Ga0265320_10023229 Ga0265320_100232291 241
144 3300031240 Ga0265320_10040459 Ga0265320_100404592 241
145 3300031249 Ga0265339_10000485 Ga0265339_100004859 241
146 3300031456 Ga0307513_10011320 Ga0307513_100113208 241
147 3300031507 Ga0307509_10000398 Ga0307509_1000039816 241
148 3300031507 Ga0307509_10038288 Ga0307509_100382884 241
149 3300031711 Ga0265314_10006008 Ga0265314_100060088 241
150 3300031712 Ga0265342_10000930 Ga0265342_1000093010 241
151 3300031712 Ga0265342_10041820 Ga0265342_100418203 241
152 3300031730 Ga0307516_10107761 Ga0307516_101077613 241
153 3300035090 Ga0373949_0000534 Ga0373949_0000534_10690_11478 241
154 3300035113 Ga0373936_0000073 Ga0373936_0000073_6294_7133 241
155 3300035114 Ga0373939_0071246 Ga0373939_0071246_146_973 241
156 3300035121 Ga0373960_0069665 Ga0373960_0069665_131_985 241
157 3300035241 Ga0373961_0000029 Ga0373961_0000029_5441_6241 241
158 3300036401 Ga0373937_0211556 Ga0373937_0211556_974_1789 241
159 3300037068 Ga0373925_0351390 Ga0373925_0351390_359_1174 241
160 3300037312 Ga0395899_0156521 Ga0395899_0156521_282_1037 241
161 3300037418 Ga0395900_0229247 Ga0395900_0229247_373_1128 241
162 3300037471 Ga0395905_0257966 Ga0395905_0257966_534_1274 241
163 3300037471 Ga0395905_0306912 Ga0395905_0306912_321_1076 241
164 3300044673 Ga0453683_0257510 Ga0453683_0257510_177_956 241
165 3300044712 Ga0453684_0147424 Ga0453684_0147424_1220_1999 241
166 3300045976 Ga0466967_0253209 Ga0466967_0253209_151_906 241
167 3300049571 Ga0501034_0115741 Ga0501034_0115741_257_1012 241
168 3300049573 Ga0501037_0260326 Ga0501037_0260326_353_1108 241
169 3300049578 Ga0501042_0288748 Ga0501042_0288748_51_806 241
170 3300049579 Ga0501043_0165020 Ga0501043_0165020_581_1336 241
171 3300049581 Ga0501047_0004255 Ga0501047_0004255_3140_3895 241
172 3300049581 Ga0501047_0111480 Ga0501047_0111480_1011_1766 241
173 3300049823 Ga0501044_0031407 Ga0501044_0031407_1102_1857 241
174 3300050508 nmdc:mga09592_75424_c1 nmdc:mga09592_75424_c1_64_840 241
175 3300053077 Ga0495601_0331314 Ga0495601_0331314_130_945 241
176 3300053094 Ga0500566_0001743 Ga0500566_0001743_506_1297 241
177 3300053094 Ga0500566_0158273 Ga0500566_0158273_252_1037 241
178 3300053095 Ga0500640_001276 Ga0500640_001276_813_1604 241
179 3300053102 Ga0500554_000023 Ga0500554_000023_13942_14733 241
180 3300053119 Ga0500595_001133 Ga0500595_001133_12932_13723 241
181 3300053120 Ga0500597_000372 Ga0500597_000372_3689_4480 241
182 3300053123 Ga0500614_000256 Ga0500614_000256_12593_13384 241
183 3300053123 Ga0500614_002670 Ga0500614_002670_2801_3592 241
184 3300053136 Ga0500559_0003726 Ga0500559_0003726_5978_6769 241
185 3300053139 Ga0500568_0014728 Ga0500568_0014728_252_989 241
186 3300053144 Ga0500585_041147 Ga0500585_041147_476_1318 241
187 3300053150 Ga0500603_002196 Ga0500603_002196_2420_3250 241
188 3300053150 Ga0500603_005286 Ga0500603_005286_749_1540 241
189 3300005327 Ga0070658_10045346 Ga0070658_100453464 242
190 3300028800 Ga0265338_10113104 Ga0265338_101131042 242
191 3300031507 Ga0307509_10195539 Ga0307509_101955392 242
192 3300049579 Ga0501043_0549322 Ga0501043_0549322_20_772 242
193 3300049586 Ga0501070_0120770 Ga0501070_0120770_311_1063 242
194 3300053139 Ga0500568_0029881 Ga0500568_0029881_1196_1957 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

35

204

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7msn-assembly1.cif.gz_B suns glycosin s-glycosyltransferase 0.8491 5 90
7msn-assembly1.cif.gz_A suns glycosin s-glycosyltransferase 0.8416 5 89
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.7656 6 237
6bwh-assembly3.cif.gz_C crystal structure of mycoibacterium tuberculosis rv2983 in complex with pep 0.7608 6 113
5jsx-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+ and uridine-diphosphate-glucose (udp-glc) 0.7577 4 230
ID Description Score Start End Superfamily
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8908 1 228 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8409 1 228 3.90.550.10
af_O06376_3_236_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8378 1 206 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8221 3 236 3.90.550.10
af_Q9VLQ1_42_326_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.822 4 236 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A538F1I9-F1-model_v4 Glycosyltransferase family 2 protein 0.9626 1 240 GO:0016020
GO:0016740
AF-A0A832X3P4-F1-model_v4 Glycosyltransferase family 2 protein 0.9612 1 235 GO:0016020
GO:0016740
AF-A0A0F9B1C7-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9584 1 237 GO:0006487
AF-A0A521JM96-F1-model_v4 Glycosyltransferase family 2 protein 0.9564 1 240 GO:0016740
AF-A0A6B0GK90-F1-model_v4 Glycosyltransferase 0.9514 1 236 GO:0016020
GO:0016740

Feature Viewer

pLDDT pTM Quality
86.98 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map