F296378
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 192 | 151 | 384 | 233 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2517572101|2517759873 |
| Length | 269 |
| Sequence | LPSSALPVPVSGSHTGQVTPPSPTNTSPAAPDSPGDTTDERPRVLVVDDEEAITDLVAMALRYEGFEVDTVQSGQAALTRVALTPPDLLVLDVMLADLDGFAVYERLRSAGHDVPTLFLTARDTTQDKVRGLTLGGDDYVTKPFAVSELVARVRAILRRTGTAAAGEDGPAPLRFADLDLDPRTREVRRAGRLVELTATEYRLLHYLMTNARTVLTRAQLLGHVWGHDFGGDGGVLETYISYLRRKTDNVEPPLIHTVRGVGYVLRLPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 18 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 19 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 20 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 21 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 22 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 23 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 25 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 26 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 27 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 28 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 29 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 30 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 58 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 60 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 61 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 62 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 63 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 64 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 65 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 66 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 67 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 68 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 69 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 70 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 71 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 72 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 73 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 74 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 75 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 76 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 77 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 78 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 79 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 80 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 81 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 82 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 83 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 84 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 85 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 86 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 87 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 88 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 89 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 95 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 96 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 97 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 98 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 99 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 100 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 101 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 102 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 103 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 104 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 105 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 106 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 107 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 108 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 109 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 110 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 111 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 112 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 113 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 114 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 121 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 139 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 141 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 142 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 143 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 144 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 145 | 2579778775 | Paenibacillus durus P3L-5 | Isolate | Unclassified |
| 146 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 147 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 148 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 149 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 150 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 151 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.27 |
| Metatranscriptomes | 0 |
| Isolates | 5.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.52 |
| Nodule | 4.69 |
| Rhizoplane | 11.98 |
| Rhizosphere | 71.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10068772 | 3300005327 | Bacteria | 2896 |
| 2 | Ga0070683_100003849 | 3300005329 | Bacteria | 12264 |
| 3 | Ga0070670_100036008 | 3300005331 | Bacteria | 4260 |
| 4 | Ga0070680_100434281 | 3300005336 | Bacteria | 1121 |
| 5 | Ga0070669_100128323 | 3300005353 | Bacteria | 1943 |
| 6 | Ga0070667_100399616 | 3300005367 | Bacteria | 1251 |
| 7 | Ga0070701_10100329 | 3300005438 | Bacteria | 1602 |
| 8 | Ga0070711_100023578 | 3300005439 | Bacteria | 4005 |
| 9 | Ga0070694_100046645 | 3300005444 | Bacteria | 2910 |
| 10 | Ga0070678_100199977 | 3300005456 | Bacteria | 1649 |
| 11 | Ga0070698_100019362 | 3300005471 | Bacteria | 7149 |
| 12 | Ga0070679_100092609 | 3300005530 | Bacteria | 3010 |
| 13 | Ga0070684_100009341 | 3300005535 | Bacteria | 7719 |
| 14 | Ga0070686_100260411 | 3300005544 | Bacteria | 1271 |
| 15 | Ga0070696_100177404 | 3300005546 | Bacteria | 1579 |
| 16 | Ga0070664_100134065 | 3300005564 | Bacteria | 2177 |
| 17 | Ga0068864_100030322 | 3300005618 | Bacteria | 4583 |
| 18 | Ga0068864_100081802 | 3300005618 | Bacteria | 2832 |
| 19 | Ga0068861_100209733 | 3300005719 | Bacteria | 1640 |
| 20 | Ga0068870_10140858 | 3300005840 | Bacteria | 1411 |
| 21 | Ga0068858_100275591 | 3300005842 | Bacteria | 1601 |
| 22 | Ga0068862_100308288 | 3300005844 | Bacteria | 1458 |
| 23 | Ga0081539_10000620 | 3300005985 | Bacteria | 71882 |
| 24 | Ga0070715_10018985 | 3300006163 | Bacteria | 2629 |
| 25 | Ga0068871_100251807 | 3300006358 | Bacteria | 1539 |
| 26 | Ga0075428_100861201 | 3300006844 | Bacteria | 962 |
| 27 | Ga0075433_10450816 | 3300006852 | Bacteria | 1134 |
| 28 | Ga0075433_10524913 | 3300006852 | Bacteria | 1042 |
| 29 | Ga0075433_10577310 | 3300006852 | Bacteria | 988 |
| 30 | Ga0075434_100309644 | 3300006871 | Bacteria | 1599 |
| 31 | Ga0075429_100016565 | 3300006880 | Bacteria | 6386 |
| 32 | Ga0075429_100634296 | 3300006880 | Bacteria | 936 |
| 33 | Ga0075436_100049687 | 3300006914 | Bacteria | 2894 |
| 34 | Ga0111539_10006251 | 3300009094 | Bacteria | 15372 |
| 35 | Ga0111539_10009665 | 3300009094 | Bacteria | 12171 |
| 36 | Ga0114129_10035493 | 3300009147 | Bacteria | 7043 |
| 37 | Ga0114129_10557822 | 3300009147 | Bacteria | 1489 |
| 38 | Ga0105243_10015870 | 3300009148 | Bacteria | 5697 |
| 39 | Ga0105242_11084732 | 3300009176 | Bacteria | 814 |
| 40 | Ga0105248_10000055 | 3300009177 | Bacteria | 141968 |
| 41 | Ga0105249_10250178 | 3300009553 | Bacteria | 1757 |
| 42 | Ga0105239_10229602 | 3300010375 | Bacteria | 2082 |
| 43 | Ga0163162_10132589 | 3300013306 | Bacteria | 2601 |
| 44 | Ga0157375_10792548 | 3300013308 | Bacteria | 1097 |
| 45 | Ga0157376_10251580 | 3300014969 | Bacteria | 1651 |
| 46 | Ga0207663_10038551 | 3300025916 | Bacteria | 2890 |
| 47 | Ga0207660_10306245 | 3300025917 | Bacteria | 1266 |
| 48 | Ga0207644_10201647 | 3300025931 | Bacteria | 1570 |
| 49 | Ga0207709_10045893 | 3300025935 | Bacteria | 2649 |
| 50 | Ga0207670_10421998 | 3300025936 | Bacteria | 1070 |
| 51 | Ga0207669_10211234 | 3300025937 | Bacteria | 1417 |
| 52 | Ga0207704_10055614 | 3300025938 | Bacteria | 2419 |
| 53 | Ga0207711_10000030 | 3300025941 | Bacteria | 206250 |
| 54 | Ga0207689_10677907 | 3300025942 | Bacteria | 869 |
| 55 | Ga0207661_10213339 | 3300025944 | Bacteria | 1702 |
| 56 | Ga0207679_10104574 | 3300025945 | Bacteria | 2222 |
| 57 | Ga0207651_10241392 | 3300025960 | Bacteria | 1473 |
| 58 | Ga0207651_10310334 | 3300025960 | Bacteria | 1315 |
| 59 | Ga0207640_10544920 | 3300025981 | Bacteria | 974 |
| 60 | Ga0207640_10631888 | 3300025981 | Bacteria | 910 |
| 61 | Ga0207703_10157260 | 3300026035 | Bacteria | 1987 |
| 62 | Ga0207676_10011754 | 3300026095 | Bacteria | 6260 |
| 63 | Ga0207676_10028003 | 3300026095 | Bacteria | 4204 |
| 64 | Ga0207675_100381652 | 3300026118 | Bacteria | 1386 |
| 65 | Ga0207683_10077460 | 3300026121 | Bacteria | 2945 |
| 66 | Ga0207428_10030162 | 3300027907 | Bacteria | 4486 |
| 67 | Ga0207428_10038572 | 3300027907 | Bacteria | 3883 |
| 68 | Ga0268265_10223635 | 3300028380 | Bacteria | 1649 |
| 69 | Ga0268265_10561530 | 3300028380 | Bacteria | 1085 |
| 70 | Ga0307517_10100261 | 3300028786 | Bacteria | 2288 |
| 71 | Ga0307509_10114462 | 3300031507 | Bacteria | 2692 |
| 72 | Ga0316579_10015284 | 3300031691 | Bacteria | 3330 |
| 73 | Ga0316576_10022268 | 3300031727 | Bacteria | 4399 |
| 74 | Ga0316576_10069083 | 3300031727 | Bacteria | 2604 |
| 75 | Ga0316578_10035083 | 3300031728 | Bacteria | 2882 |
| 76 | Ga0316578_10043910 | 3300031728 | Bacteria | 2598 |
| 77 | Ga0316578_10090003 | 3300031728 | Bacteria | 1832 |
| 78 | Ga0316578_10161897 | 3300031728 | Bacteria | 1349 |
| 79 | Ga0307405_10043985 | 3300031731 | Bacteria | 2729 |
| 80 | Ga0316577_10038154 | 3300031733 | Bacteria | 2686 |
| 81 | Ga0307407_10325588 | 3300031903 | Bacteria | 1080 |
| 82 | Ga0307409_100362844 | 3300031995 | Bacteria | 1371 |
| 83 | Ga0307414_10085726 | 3300032004 | Bacteria | 2322 |
| 84 | Ga0316583_10000358 | 3300032133 | Bacteria | 13115 |
| 85 | Ga0373956_0080577 | 3300035119 | Bacteria | 1494 |
| 86 | Ga0316574_0007009 | 3300035398 | Bacteria | 6142 |
| 87 | Ga0316582_0117196 | 3300036647 | Bacteria | 1779 |
| 88 | Ga0316582_0553785 | 3300036647 | Bacteria | 792 |
| 89 | Ga0316584_0112986 | 3300036712 | Bacteria | 2032 |
| 90 | Ga0316584_0115596 | 3300036712 | Bacteria | 2007 |
| 91 | Ga0316584_0138020 | 3300036712 | Bacteria | 1819 |
| 92 | Ga0395899_0076928 | 3300037312 | Bacteria | 2435 |
| 93 | Ga0395900_0102653 | 3300037418 | Bacteria | 2937 |
| 94 | Ga0395898_0028034 | 3300037466 | Bacteria | 5647 |
| 95 | Ga0395898_0028324 | 3300037466 | Bacteria | 5615 |
| 96 | Ga0395898_0032962 | 3300037466 | Bacteria | 5171 |
| 97 | Ga0395905_0028344 | 3300037471 | Bacteria | 5279 |
| 98 | Ga0395905_0288052 | 3300037471 | Bacteria | 1529 |
| 99 | Ga0395901_0053130 | 3300038443 | Bacteria | 4210 |
| 100 | Ga0400484_15672 | 3300038725 | Bacteria | 21508 |
| 101 | Ga0400484_26629 | 3300038725 | Bacteria | 25427 |
| 102 | Ga0400484_29295 | 3300038725 | Bacteria | 3898 |
| 103 | Ga0400490_12104 | 3300038726 | Bacteria | 6607 |
| 104 | Ga0400490_18882 | 3300038726 | Bacteria | 5210 |
| 105 | Ga0400490_42691 | 3300038726 | Bacteria | 8659 |
| 106 | Ga0400491_19679 | 3300038727 | Bacteria | 4763 |
| 107 | Ga0400488_32642 | 3300038741 | Bacteria | 1075 |
| 108 | Ga0400487_02907 | 3300039110 | Bacteria | 94546 |
| 109 | Ga0400487_62450 | 3300039110 | Bacteria | 8111 |
| 110 | Ga0451789_0674408 | 3300041443 | Bacteria | 846 |
| 111 | Ga0466961_0345342 | 3300044693 | Bacteria | 906 |
| 112 | Ga0466963_0022461 | 3300044694 | Bacteria | 3996 |
| 113 | Ga0466963_0116797 | 3300044694 | Bacteria | 1834 |
| 114 | Ga0466958_0034918 | 3300045836 | Bacteria | 3002 |
| 115 | Ga0466967_0273179 | 3300045976 | Bacteria | 1620 |
| 116 | Ga0466967_0384050 | 3300045976 | Bacteria | 1364 |
| 117 | Ga0495580_0004415 | 3300046472 | Bacteria | 11814 |
| 118 | Ga0495645_0237640 | 3300046543 | Bacteria | 1217 |
| 119 | Ga0495658_0023111 | 3300046683 | Bacteria | 3298 |
| 120 | Ga0495604_0055827 | 3300047317 | Bacteria | 3043 |
| 121 | Ga0495674_0613199 | 3300047319 | Bacteria | 861 |
| 122 | Ga0496100_0315948 | 3300048903 | Bacteria | 1172 |
| 123 | Ga0496101_0429506 | 3300048904 | Bacteria | 1041 |
| 124 | Ga0496102_0027791 | 3300048905 | Bacteria | 5052 |
| 125 | Ga0496102_0183694 | 3300048905 | Bacteria | 1970 |
| 126 | Ga0496103_0183414 | 3300048906 | Bacteria | 1345 |
| 127 | Ga0496103_0258195 | 3300048906 | Bacteria | 1121 |
| 128 | Ga0496103_0357054 | 3300048906 | Bacteria | 939 |
| 129 | Ga0496104_0027053 | 3300048907 | Bacteria | 5304 |
| 130 | Ga0496104_0114348 | 3300048907 | Bacteria | 2588 |
| 131 | Ga0496105_0070452 | 3300048908 | Bacteria | 2890 |
| 132 | Ga0496106_0518814 | 3300048909 | Bacteria | 957 |
| 133 | Ga0496107_0069149 | 3300048910 | Bacteria | 2563 |
| 134 | Ga0496107_0177258 | 3300048910 | Bacteria | 1583 |
| 135 | Ga0496107_0391667 | 3300048910 | Bacteria | 1033 |
| 136 | Ga0496109_0064798 | 3300048912 | Bacteria | 3344 |
| 137 | Ga0496110_0065640 | 3300048913 | Bacteria | 3209 |
| 138 | Ga0496111_0013409 | 3300048914 | Bacteria | 5577 |
| 139 | Ga0496112_0000923 | 3300048915 | Bacteria | 21243 |
| 140 | Ga0496112_0034825 | 3300048915 | Bacteria | 4901 |
| 141 | Ga0496113_0433121 | 3300048916 | Bacteria | 1056 |
| 142 | Ga0496114_0042303 | 3300048917 | Bacteria | 3776 |
| 143 | Ga0496115_0082667 | 3300048918 | Bacteria | 2617 |
| 144 | Ga0496116_0000287 | 3300048919 | Bacteria | 85981 |
| 145 | Ga0496117_0012567 | 3300048920 | Bacteria | 7450 |
| 146 | Ga0496117_0019142 | 3300048920 | Bacteria | 5635 |
| 147 | Ga0496118_0002504 | 3300048921 | Bacteria | 24640 |
| 148 | Ga0496118_0017474 | 3300048921 | Bacteria | 6526 |
| 149 | Ga0496119_0009044 | 3300048922 | Bacteria | 8635 |
| 150 | Ga0496121_0012873 | 3300048924 | Bacteria | 9049 |
| 151 | Ga0501031_0062603 | 3300049568 | Bacteria | 2424 |
| 152 | Ga0501034_0012521 | 3300049571 | Bacteria | 8757 |
| 153 | Ga0501036_0035183 | 3300049572 | Bacteria | 4238 |
| 154 | Ga0501038_0141881 | 3300049574 | Bacteria | 1965 |
| 155 | Ga0501039_0015663 | 3300049575 | Bacteria | 5802 |
| 156 | Ga0501041_0022263 | 3300049577 | Bacteria | 3794 |
| 157 | Ga0501042_0144851 | 3300049578 | Bacteria | 1713 |
| 158 | Ga0501047_0109060 | 3300049581 | Bacteria | 2651 |
| 159 | Ga0501048_0087866 | 3300049582 | Bacteria | 2193 |
| 160 | Ga0501067_0020112 | 3300049583 | Bacteria | 3693 |
| 161 | Ga0501070_0001972 | 3300049586 | Bacteria | 18110 |
| 162 | Ga0501071_0069299 | 3300049587 | Bacteria | 2568 |
| 163 | Ga0501072_0035504 | 3300049588 | Bacteria | 3905 |
| 164 | Ga0501074_0008972 | 3300049590 | Bacteria | 7254 |
| 165 | Ga0501074_0083232 | 3300049590 | Bacteria | 2294 |
| 166 | Ga0501076_0080342 | 3300049592 | Bacteria | 2617 |
| 167 | Ga0501080_0002800 | 3300049742 | Bacteria | 15321 |
| 168 | Ga0501044_0054073 | 3300049823 | Bacteria | 4129 |
| 169 | Ga0501045_0029252 | 3300049824 | Bacteria | 3981 |
| 170 | nmdc:mga05p37_97491_c1 | 3300050507 | Bacteria | 3621 |
| 171 | nmdc:mga09592_15339_c1 | 3300050508 | Bacteria | 6257 |
| 172 | nmdc:mga09592_52087_c1 | 3300050508 | Bacteria | 3454 |
| 173 | nmdc:mga08y16_29997_c1 | 3300050511 | Bacteria | 5726 |
| 174 | nmdc:mga0n895_394468_c1 | 3300050512 | Bacteria | 1400 |
| 175 | nmdc:mga0n895_982131_c1 | 3300050512 | Bacteria | 826 |
| 176 | nmdc:mga0rr50_84943_c1 | 3300050513 | Bacteria | 2452 |
| 177 | nmdc:mga08x19_136737_c1 | 3300050514 | Bacteria | 1653 |
| 178 | Ga0500622_0148166 | 3300053156 | Bacteria | 1112 |
| 179 | Ga0501084_0625367 | 3300054114 | Bacteria | 909 |
| 180 | Ga0466962_0210892 | 3300061719 | Bacteria | 950 |
| 181 | Ga0530510_0058422 | 3300061734 | Bacteria | 2789 |
| 182 | 2517759873 | 2517572101 | Bacteria | 6884336 |
| 183 | 2506868745 | 2506783011 | Bacteria | 5323186 |
| 184 | 2514053620 | 2513237166 | Bacteria | 10373764 |
| 185 | 2580931892 | 2579778775 | Bacteria | 5360914 |
| 186 | 2621277781 | 2619619294 | Bacteria | 5575484 |
| 187 | 2676201935 | 2675902999 | Bacteria | 9438463 |
| 188 | 2689963966 | 2687453737 | Bacteria | 11203906 |
| 189 | 2774846511 | 2773857921 | Bacteria | 9435764 |
| 190 | 2774904578 | 2773857933 | Bacteria | 5818019 |
| 191 | 8002788964 | 8002784119 | Bacteria | 9788632 |
| 192 | 8002790328 | 8002784119 | Bacteria | 9788632 |
| 193 | Ga0070658_10068772 | |||
| 194 | Ga0070683_100003849 | |||
| 195 | Ga0070670_100036008 | |||
| 196 | Ga0070680_100434281 | |||
| 197 | Ga0070669_100128323 | |||
| 198 | Ga0070667_100399616 | |||
| 199 | Ga0070701_10100329 | |||
| 200 | Ga0070711_100023578 | |||
| 201 | Ga0070694_100046645 | |||
| 202 | Ga0070678_100199977 | |||
| 203 | Ga0070698_100019362 | |||
| 204 | Ga0070679_100092609 | |||
| 205 | Ga0070684_100009341 | |||
| 206 | Ga0070686_100260411 | |||
| 207 | Ga0070696_100177404 | |||
| 208 | Ga0070664_100134065 | |||
| 209 | Ga0068864_100030322 | |||
| 210 | Ga0068864_100081802 | |||
| 211 | Ga0068861_100209733 | |||
| 212 | Ga0068870_10140858 | |||
| 213 | Ga0068858_100275591 | |||
| 214 | Ga0068862_100308288 | |||
| 215 | Ga0081539_10000620 | |||
| 216 | Ga0070715_10018985 | |||
| 217 | Ga0068871_100251807 | |||
| 218 | Ga0075428_100861201 | |||
| 219 | Ga0075433_10450816 | |||
| 220 | Ga0075433_10524913 | |||
| 221 | Ga0075433_10577310 | |||
| 222 | Ga0075434_100309644 | |||
| 223 | Ga0075429_100016565 | |||
| 224 | Ga0075429_100634296 | |||
| 225 | Ga0075436_100049687 | |||
| 226 | Ga0111539_10006251 | |||
| 227 | Ga0111539_10009665 | |||
| 228 | Ga0114129_10035493 | |||
| 229 | Ga0114129_10557822 | |||
| 230 | Ga0105243_10015870 | |||
| 231 | Ga0105242_11084732 | |||
| 232 | Ga0105248_10000055 | |||
| 233 | Ga0105249_10250178 | |||
| 234 | Ga0105239_10229602 | |||
| 235 | Ga0163162_10132589 | |||
| 236 | Ga0157375_10792548 | |||
| 237 | Ga0157376_10251580 | |||
| 238 | Ga0207663_10038551 | |||
| 239 | Ga0207660_10306245 | |||
| 240 | Ga0207644_10201647 | |||
| 241 | Ga0207709_10045893 | |||
| 242 | Ga0207670_10421998 | |||
| 243 | Ga0207669_10211234 | |||
| 244 | Ga0207704_10055614 | |||
| 245 | Ga0207711_10000030 | |||
| 246 | Ga0207689_10677907 | |||
| 247 | Ga0207661_10213339 | |||
| 248 | Ga0207679_10104574 | |||
| 249 | Ga0207651_10241392 | |||
| 250 | Ga0207651_10310334 | |||
| 251 | Ga0207640_10544920 | |||
| 252 | Ga0207640_10631888 | |||
| 253 | Ga0207703_10157260 | |||
| 254 | Ga0207676_10011754 | |||
| 255 | Ga0207676_10028003 | |||
| 256 | Ga0207675_100381652 | |||
| 257 | Ga0207683_10077460 | |||
| 258 | Ga0207428_10030162 | |||
| 259 | Ga0207428_10038572 | |||
| 260 | Ga0268265_10223635 | |||
| 261 | Ga0268265_10561530 | |||
| 262 | Ga0307517_10100261 | |||
| 263 | Ga0307509_10114462 | |||
| 264 | Ga0316579_10015284 | |||
| 265 | Ga0316576_10022268 | |||
| 266 | Ga0316576_10069083 | |||
| 267 | Ga0316578_10035083 | |||
| 268 | Ga0316578_10043910 | |||
| 269 | Ga0316578_10090003 | |||
| 270 | Ga0316578_10161897 | |||
| 271 | Ga0307405_10043985 | |||
| 272 | Ga0316577_10038154 | |||
| 273 | Ga0307407_10325588 | |||
| 274 | Ga0307409_100362844 | |||
| 275 | Ga0307414_10085726 | |||
| 276 | Ga0316583_10000358 | |||
| 277 | Ga0373956_0080577 | |||
| 278 | Ga0316574_0007009 | |||
| 279 | Ga0316582_0117196 | |||
| 280 | Ga0316582_0553785 | |||
| 281 | Ga0316584_0112986 | |||
| 282 | Ga0316584_0115596 | |||
| 283 | Ga0316584_0138020 | |||
| 284 | Ga0395899_0076928 | |||
| 285 | Ga0395900_0102653 | |||
| 286 | Ga0395898_0028034 | |||
| 287 | Ga0395898_0028324 | |||
| 288 | Ga0395898_0032962 | |||
| 289 | Ga0395905_0028344 | |||
| 290 | Ga0395905_0288052 | |||
| 291 | Ga0395901_0053130 | |||
| 292 | Ga0400484_15672 | |||
| 293 | Ga0400484_26629 | |||
| 294 | Ga0400484_29295 | |||
| 295 | Ga0400490_12104 | |||
| 296 | Ga0400490_18882 | |||
| 297 | Ga0400490_42691 | |||
| 298 | Ga0400491_19679 | |||
| 299 | Ga0400488_32642 | |||
| 300 | Ga0400487_02907 | |||
| 301 | Ga0400487_62450 | |||
| 302 | Ga0451789_0674408 | |||
| 303 | Ga0466961_0345342 | |||
| 304 | Ga0466963_0022461 | |||
| 305 | Ga0466963_0116797 | |||
| 306 | Ga0466958_0034918 | |||
| 307 | Ga0466967_0273179 | |||
| 308 | Ga0466967_0384050 | |||
| 309 | Ga0495580_0004415 | |||
| 310 | Ga0495645_0237640 | |||
| 311 | Ga0495658_0023111 | |||
| 312 | Ga0495604_0055827 | |||
| 313 | Ga0495674_0613199 | |||
| 314 | Ga0496100_0315948 | |||
| 315 | Ga0496101_0429506 | |||
| 316 | Ga0496102_0027791 | |||
| 317 | Ga0496102_0183694 | |||
| 318 | Ga0496103_0183414 | |||
| 319 | Ga0496103_0258195 | |||
| 320 | Ga0496103_0357054 | |||
| 321 | Ga0496104_0027053 | |||
| 322 | Ga0496104_0114348 | |||
| 323 | Ga0496105_0070452 | |||
| 324 | Ga0496106_0518814 | |||
| 325 | Ga0496107_0069149 | |||
| 326 | Ga0496107_0177258 | |||
| 327 | Ga0496107_0391667 | |||
| 328 | Ga0496109_0064798 | |||
| 329 | Ga0496110_0065640 | |||
| 330 | Ga0496111_0013409 | |||
| 331 | Ga0496112_0000923 | |||
| 332 | Ga0496112_0034825 | |||
| 333 | Ga0496113_0433121 | |||
| 334 | Ga0496114_0042303 | |||
| 335 | Ga0496115_0082667 | |||
| 336 | Ga0496116_0000287 | |||
| 337 | Ga0496117_0012567 | |||
| 338 | Ga0496117_0019142 | |||
| 339 | Ga0496118_0002504 | |||
| 340 | Ga0496118_0017474 | |||
| 341 | Ga0496119_0009044 | |||
| 342 | Ga0496121_0012873 | |||
| 343 | Ga0501031_0062603 | |||
| 344 | Ga0501034_0012521 | |||
| 345 | Ga0501036_0035183 | |||
| 346 | Ga0501038_0141881 | |||
| 347 | Ga0501039_0015663 | |||
| 348 | Ga0501041_0022263 | |||
| 349 | Ga0501042_0144851 | |||
| 350 | Ga0501047_0109060 | |||
| 351 | Ga0501048_0087866 | |||
| 352 | Ga0501067_0020112 | |||
| 353 | Ga0501070_0001972 | |||
| 354 | Ga0501071_0069299 | |||
| 355 | Ga0501072_0035504 | |||
| 356 | Ga0501074_0008972 | |||
| 357 | Ga0501074_0083232 | |||
| 358 | Ga0501076_0080342 | |||
| 359 | Ga0501080_0002800 | |||
| 360 | Ga0501044_0054073 | |||
| 361 | Ga0501045_0029252 | |||
| 362 | nmdc:mga05p37_97491_c1 | |||
| 363 | nmdc:mga09592_15339_c1 | |||
| 364 | nmdc:mga09592_52087_c1 | |||
| 365 | nmdc:mga08y16_29997_c1 | |||
| 366 | nmdc:mga0n895_394468_c1 | |||
| 367 | nmdc:mga0n895_982131_c1 | |||
| 368 | nmdc:mga0rr50_84943_c1 | |||
| 369 | nmdc:mga08x19_136737_c1 | |||
| 370 | Ga0500622_0148166 | |||
| 371 | Ga0501084_0625367 | |||
| 372 | Ga0466962_0210892 | |||
| 373 | Ga0530510_0058422 | |||
| 374 | 2517759873 | |||
| 375 | 2506868745 | |||
| 376 | 2514053620 | |||
| 377 | 2580931892 | |||
| 378 | 2621277781 | |||
| 379 | 2676201935 | |||
| 380 | 2689963966 | |||
| 381 | 2774846511 | |||
| 382 | 2774904578 | |||
| 383 | 8002788964 | |||
| 384 | 8002790328 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9721 | 2 | 122 |
| 6is2-assembly1.cif.gz_A | crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg | 0.9664 | 1 | 120 |
| 5uic-assembly1.cif.gz_A | structure of the francisella response regulator receiver domain, qseb | 0.9659 | 2 | 120 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9644 | 3 | 120 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9635 | 3 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9941 | 3 | 86 | 3.40.50.2300 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9883 | 3 | 81 | 3.40.50.2300 |
| af_Q9KJN4_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9854 | 2 | 79 | 3.40.50.2300 |
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9825 | 3 | 86 | 3.40.50.2300 |
| af_P52076_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9795 | 4 | 81 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258N5Y6-F1-model_v4 | Two-component system response regulator | 0.7882 | 1 | 156 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A2N8NYX3-F1-model_v4 | Transcriptional regulator | 0.7664 | 2 | 228 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A651E3V3-F1-model_v4 | DNA-binding response regulator | 0.7663 | 2 | 172 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A651E3V3-F1-model_v4 | DNA-binding response regulator | 0.7622 | 2 | 172 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A269XFL2-F1-model_v4 | deleted | 0.7598 | 4 | 164 |
|