F296378

General Info

Members Datasets Scaffolds Average Seq Length
192 151 384 233

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2517572101|2517759873
Length 269
Sequence LPSSALPVPVSGSHTGQVTPPSPTNTSPAAPDSPGDTTDERPRVLVVDDEEAITDLVAMALRYEGFEVDTVQSGQAALTRVALTPPDLLVLDVMLADLDGFAVYERLRSAGHDVPTLFLTARDTTQDKVRGLTLGGDDYVTKPFAVSELVARVRAILRRTGTAAAGEDGPAPLRFADLDLDPRTREVRRAGRLVELTATEYRLLHYLMTNARTVLTRAQLLGHVWGHDFGGDGGVLETYISYLRRKTDNVEPPLIHTVRGVGYVLRLPR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
60 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
61 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
62 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
63 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
72 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
73 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
80 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
81 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
82 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
83 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
84 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
142 2517572101 Frankia sp. DC12 Isolate Nodule
143 2506783011 Frankia datiscae Dg1 Isolate Nodule
144 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
145 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
146 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
147 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
148 2687453737 Frankia sp. BMG5.36 Isolate Nodule
149 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
150 2773857933 Frankia sp. BMG5.30 Isolate Nodule
151 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.27
Metatranscriptomes 0
Isolates 5.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 4.69
Rhizoplane 11.98
Rhizosphere 71.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10068772 3300005327 Bacteria 2896
2 Ga0070683_100003849 3300005329 Bacteria 12264
3 Ga0070670_100036008 3300005331 Bacteria 4260
4 Ga0070680_100434281 3300005336 Bacteria 1121
5 Ga0070669_100128323 3300005353 Bacteria 1943
6 Ga0070667_100399616 3300005367 Bacteria 1251
7 Ga0070701_10100329 3300005438 Bacteria 1602
8 Ga0070711_100023578 3300005439 Bacteria 4005
9 Ga0070694_100046645 3300005444 Bacteria 2910
10 Ga0070678_100199977 3300005456 Bacteria 1649
11 Ga0070698_100019362 3300005471 Bacteria 7149
12 Ga0070679_100092609 3300005530 Bacteria 3010
13 Ga0070684_100009341 3300005535 Bacteria 7719
14 Ga0070686_100260411 3300005544 Bacteria 1271
15 Ga0070696_100177404 3300005546 Bacteria 1579
16 Ga0070664_100134065 3300005564 Bacteria 2177
17 Ga0068864_100030322 3300005618 Bacteria 4583
18 Ga0068864_100081802 3300005618 Bacteria 2832
19 Ga0068861_100209733 3300005719 Bacteria 1640
20 Ga0068870_10140858 3300005840 Bacteria 1411
21 Ga0068858_100275591 3300005842 Bacteria 1601
22 Ga0068862_100308288 3300005844 Bacteria 1458
23 Ga0081539_10000620 3300005985 Bacteria 71882
24 Ga0070715_10018985 3300006163 Bacteria 2629
25 Ga0068871_100251807 3300006358 Bacteria 1539
26 Ga0075428_100861201 3300006844 Bacteria 962
27 Ga0075433_10450816 3300006852 Bacteria 1134
28 Ga0075433_10524913 3300006852 Bacteria 1042
29 Ga0075433_10577310 3300006852 Bacteria 988
30 Ga0075434_100309644 3300006871 Bacteria 1599
31 Ga0075429_100016565 3300006880 Bacteria 6386
32 Ga0075429_100634296 3300006880 Bacteria 936
33 Ga0075436_100049687 3300006914 Bacteria 2894
34 Ga0111539_10006251 3300009094 Bacteria 15372
35 Ga0111539_10009665 3300009094 Bacteria 12171
36 Ga0114129_10035493 3300009147 Bacteria 7043
37 Ga0114129_10557822 3300009147 Bacteria 1489
38 Ga0105243_10015870 3300009148 Bacteria 5697
39 Ga0105242_11084732 3300009176 Bacteria 814
40 Ga0105248_10000055 3300009177 Bacteria 141968
41 Ga0105249_10250178 3300009553 Bacteria 1757
42 Ga0105239_10229602 3300010375 Bacteria 2082
43 Ga0163162_10132589 3300013306 Bacteria 2601
44 Ga0157375_10792548 3300013308 Bacteria 1097
45 Ga0157376_10251580 3300014969 Bacteria 1651
46 Ga0207663_10038551 3300025916 Bacteria 2890
47 Ga0207660_10306245 3300025917 Bacteria 1266
48 Ga0207644_10201647 3300025931 Bacteria 1570
49 Ga0207709_10045893 3300025935 Bacteria 2649
50 Ga0207670_10421998 3300025936 Bacteria 1070
51 Ga0207669_10211234 3300025937 Bacteria 1417
52 Ga0207704_10055614 3300025938 Bacteria 2419
53 Ga0207711_10000030 3300025941 Bacteria 206250
54 Ga0207689_10677907 3300025942 Bacteria 869
55 Ga0207661_10213339 3300025944 Bacteria 1702
56 Ga0207679_10104574 3300025945 Bacteria 2222
57 Ga0207651_10241392 3300025960 Bacteria 1473
58 Ga0207651_10310334 3300025960 Bacteria 1315
59 Ga0207640_10544920 3300025981 Bacteria 974
60 Ga0207640_10631888 3300025981 Bacteria 910
61 Ga0207703_10157260 3300026035 Bacteria 1987
62 Ga0207676_10011754 3300026095 Bacteria 6260
63 Ga0207676_10028003 3300026095 Bacteria 4204
64 Ga0207675_100381652 3300026118 Bacteria 1386
65 Ga0207683_10077460 3300026121 Bacteria 2945
66 Ga0207428_10030162 3300027907 Bacteria 4486
67 Ga0207428_10038572 3300027907 Bacteria 3883
68 Ga0268265_10223635 3300028380 Bacteria 1649
69 Ga0268265_10561530 3300028380 Bacteria 1085
70 Ga0307517_10100261 3300028786 Bacteria 2288
71 Ga0307509_10114462 3300031507 Bacteria 2692
72 Ga0316579_10015284 3300031691 Bacteria 3330
73 Ga0316576_10022268 3300031727 Bacteria 4399
74 Ga0316576_10069083 3300031727 Bacteria 2604
75 Ga0316578_10035083 3300031728 Bacteria 2882
76 Ga0316578_10043910 3300031728 Bacteria 2598
77 Ga0316578_10090003 3300031728 Bacteria 1832
78 Ga0316578_10161897 3300031728 Bacteria 1349
79 Ga0307405_10043985 3300031731 Bacteria 2729
80 Ga0316577_10038154 3300031733 Bacteria 2686
81 Ga0307407_10325588 3300031903 Bacteria 1080
82 Ga0307409_100362844 3300031995 Bacteria 1371
83 Ga0307414_10085726 3300032004 Bacteria 2322
84 Ga0316583_10000358 3300032133 Bacteria 13115
85 Ga0373956_0080577 3300035119 Bacteria 1494
86 Ga0316574_0007009 3300035398 Bacteria 6142
87 Ga0316582_0117196 3300036647 Bacteria 1779
88 Ga0316582_0553785 3300036647 Bacteria 792
89 Ga0316584_0112986 3300036712 Bacteria 2032
90 Ga0316584_0115596 3300036712 Bacteria 2007
91 Ga0316584_0138020 3300036712 Bacteria 1819
92 Ga0395899_0076928 3300037312 Bacteria 2435
93 Ga0395900_0102653 3300037418 Bacteria 2937
94 Ga0395898_0028034 3300037466 Bacteria 5647
95 Ga0395898_0028324 3300037466 Bacteria 5615
96 Ga0395898_0032962 3300037466 Bacteria 5171
97 Ga0395905_0028344 3300037471 Bacteria 5279
98 Ga0395905_0288052 3300037471 Bacteria 1529
99 Ga0395901_0053130 3300038443 Bacteria 4210
100 Ga0400484_15672 3300038725 Bacteria 21508
101 Ga0400484_26629 3300038725 Bacteria 25427
102 Ga0400484_29295 3300038725 Bacteria 3898
103 Ga0400490_12104 3300038726 Bacteria 6607
104 Ga0400490_18882 3300038726 Bacteria 5210
105 Ga0400490_42691 3300038726 Bacteria 8659
106 Ga0400491_19679 3300038727 Bacteria 4763
107 Ga0400488_32642 3300038741 Bacteria 1075
108 Ga0400487_02907 3300039110 Bacteria 94546
109 Ga0400487_62450 3300039110 Bacteria 8111
110 Ga0451789_0674408 3300041443 Bacteria 846
111 Ga0466961_0345342 3300044693 Bacteria 906
112 Ga0466963_0022461 3300044694 Bacteria 3996
113 Ga0466963_0116797 3300044694 Bacteria 1834
114 Ga0466958_0034918 3300045836 Bacteria 3002
115 Ga0466967_0273179 3300045976 Bacteria 1620
116 Ga0466967_0384050 3300045976 Bacteria 1364
117 Ga0495580_0004415 3300046472 Bacteria 11814
118 Ga0495645_0237640 3300046543 Bacteria 1217
119 Ga0495658_0023111 3300046683 Bacteria 3298
120 Ga0495604_0055827 3300047317 Bacteria 3043
121 Ga0495674_0613199 3300047319 Bacteria 861
122 Ga0496100_0315948 3300048903 Bacteria 1172
123 Ga0496101_0429506 3300048904 Bacteria 1041
124 Ga0496102_0027791 3300048905 Bacteria 5052
125 Ga0496102_0183694 3300048905 Bacteria 1970
126 Ga0496103_0183414 3300048906 Bacteria 1345
127 Ga0496103_0258195 3300048906 Bacteria 1121
128 Ga0496103_0357054 3300048906 Bacteria 939
129 Ga0496104_0027053 3300048907 Bacteria 5304
130 Ga0496104_0114348 3300048907 Bacteria 2588
131 Ga0496105_0070452 3300048908 Bacteria 2890
132 Ga0496106_0518814 3300048909 Bacteria 957
133 Ga0496107_0069149 3300048910 Bacteria 2563
134 Ga0496107_0177258 3300048910 Bacteria 1583
135 Ga0496107_0391667 3300048910 Bacteria 1033
136 Ga0496109_0064798 3300048912 Bacteria 3344
137 Ga0496110_0065640 3300048913 Bacteria 3209
138 Ga0496111_0013409 3300048914 Bacteria 5577
139 Ga0496112_0000923 3300048915 Bacteria 21243
140 Ga0496112_0034825 3300048915 Bacteria 4901
141 Ga0496113_0433121 3300048916 Bacteria 1056
142 Ga0496114_0042303 3300048917 Bacteria 3776
143 Ga0496115_0082667 3300048918 Bacteria 2617
144 Ga0496116_0000287 3300048919 Bacteria 85981
145 Ga0496117_0012567 3300048920 Bacteria 7450
146 Ga0496117_0019142 3300048920 Bacteria 5635
147 Ga0496118_0002504 3300048921 Bacteria 24640
148 Ga0496118_0017474 3300048921 Bacteria 6526
149 Ga0496119_0009044 3300048922 Bacteria 8635
150 Ga0496121_0012873 3300048924 Bacteria 9049
151 Ga0501031_0062603 3300049568 Bacteria 2424
152 Ga0501034_0012521 3300049571 Bacteria 8757
153 Ga0501036_0035183 3300049572 Bacteria 4238
154 Ga0501038_0141881 3300049574 Bacteria 1965
155 Ga0501039_0015663 3300049575 Bacteria 5802
156 Ga0501041_0022263 3300049577 Bacteria 3794
157 Ga0501042_0144851 3300049578 Bacteria 1713
158 Ga0501047_0109060 3300049581 Bacteria 2651
159 Ga0501048_0087866 3300049582 Bacteria 2193
160 Ga0501067_0020112 3300049583 Bacteria 3693
161 Ga0501070_0001972 3300049586 Bacteria 18110
162 Ga0501071_0069299 3300049587 Bacteria 2568
163 Ga0501072_0035504 3300049588 Bacteria 3905
164 Ga0501074_0008972 3300049590 Bacteria 7254
165 Ga0501074_0083232 3300049590 Bacteria 2294
166 Ga0501076_0080342 3300049592 Bacteria 2617
167 Ga0501080_0002800 3300049742 Bacteria 15321
168 Ga0501044_0054073 3300049823 Bacteria 4129
169 Ga0501045_0029252 3300049824 Bacteria 3981
170 nmdc:mga05p37_97491_c1 3300050507 Bacteria 3621
171 nmdc:mga09592_15339_c1 3300050508 Bacteria 6257
172 nmdc:mga09592_52087_c1 3300050508 Bacteria 3454
173 nmdc:mga08y16_29997_c1 3300050511 Bacteria 5726
174 nmdc:mga0n895_394468_c1 3300050512 Bacteria 1400
175 nmdc:mga0n895_982131_c1 3300050512 Bacteria 826
176 nmdc:mga0rr50_84943_c1 3300050513 Bacteria 2452
177 nmdc:mga08x19_136737_c1 3300050514 Bacteria 1653
178 Ga0500622_0148166 3300053156 Bacteria 1112
179 Ga0501084_0625367 3300054114 Bacteria 909
180 Ga0466962_0210892 3300061719 Bacteria 950
181 Ga0530510_0058422 3300061734 Bacteria 2789
182 2517759873 2517572101 Bacteria 6884336
183 2506868745 2506783011 Bacteria 5323186
184 2514053620 2513237166 Bacteria 10373764
185 2580931892 2579778775 Bacteria 5360914
186 2621277781 2619619294 Bacteria 5575484
187 2676201935 2675902999 Bacteria 9438463
188 2689963966 2687453737 Bacteria 11203906
189 2774846511 2773857921 Bacteria 9435764
190 2774904578 2773857933 Bacteria 5818019
191 8002788964 8002784119 Bacteria 9788632
192 8002790328 8002784119 Bacteria 9788632
193 Ga0070658_10068772
194 Ga0070683_100003849
195 Ga0070670_100036008
196 Ga0070680_100434281
197 Ga0070669_100128323
198 Ga0070667_100399616
199 Ga0070701_10100329
200 Ga0070711_100023578
201 Ga0070694_100046645
202 Ga0070678_100199977
203 Ga0070698_100019362
204 Ga0070679_100092609
205 Ga0070684_100009341
206 Ga0070686_100260411
207 Ga0070696_100177404
208 Ga0070664_100134065
209 Ga0068864_100030322
210 Ga0068864_100081802
211 Ga0068861_100209733
212 Ga0068870_10140858
213 Ga0068858_100275591
214 Ga0068862_100308288
215 Ga0081539_10000620
216 Ga0070715_10018985
217 Ga0068871_100251807
218 Ga0075428_100861201
219 Ga0075433_10450816
220 Ga0075433_10524913
221 Ga0075433_10577310
222 Ga0075434_100309644
223 Ga0075429_100016565
224 Ga0075429_100634296
225 Ga0075436_100049687
226 Ga0111539_10006251
227 Ga0111539_10009665
228 Ga0114129_10035493
229 Ga0114129_10557822
230 Ga0105243_10015870
231 Ga0105242_11084732
232 Ga0105248_10000055
233 Ga0105249_10250178
234 Ga0105239_10229602
235 Ga0163162_10132589
236 Ga0157375_10792548
237 Ga0157376_10251580
238 Ga0207663_10038551
239 Ga0207660_10306245
240 Ga0207644_10201647
241 Ga0207709_10045893
242 Ga0207670_10421998
243 Ga0207669_10211234
244 Ga0207704_10055614
245 Ga0207711_10000030
246 Ga0207689_10677907
247 Ga0207661_10213339
248 Ga0207679_10104574
249 Ga0207651_10241392
250 Ga0207651_10310334
251 Ga0207640_10544920
252 Ga0207640_10631888
253 Ga0207703_10157260
254 Ga0207676_10011754
255 Ga0207676_10028003
256 Ga0207675_100381652
257 Ga0207683_10077460
258 Ga0207428_10030162
259 Ga0207428_10038572
260 Ga0268265_10223635
261 Ga0268265_10561530
262 Ga0307517_10100261
263 Ga0307509_10114462
264 Ga0316579_10015284
265 Ga0316576_10022268
266 Ga0316576_10069083
267 Ga0316578_10035083
268 Ga0316578_10043910
269 Ga0316578_10090003
270 Ga0316578_10161897
271 Ga0307405_10043985
272 Ga0316577_10038154
273 Ga0307407_10325588
274 Ga0307409_100362844
275 Ga0307414_10085726
276 Ga0316583_10000358
277 Ga0373956_0080577
278 Ga0316574_0007009
279 Ga0316582_0117196
280 Ga0316582_0553785
281 Ga0316584_0112986
282 Ga0316584_0115596
283 Ga0316584_0138020
284 Ga0395899_0076928
285 Ga0395900_0102653
286 Ga0395898_0028034
287 Ga0395898_0028324
288 Ga0395898_0032962
289 Ga0395905_0028344
290 Ga0395905_0288052
291 Ga0395901_0053130
292 Ga0400484_15672
293 Ga0400484_26629
294 Ga0400484_29295
295 Ga0400490_12104
296 Ga0400490_18882
297 Ga0400490_42691
298 Ga0400491_19679
299 Ga0400488_32642
300 Ga0400487_02907
301 Ga0400487_62450
302 Ga0451789_0674408
303 Ga0466961_0345342
304 Ga0466963_0022461
305 Ga0466963_0116797
306 Ga0466958_0034918
307 Ga0466967_0273179
308 Ga0466967_0384050
309 Ga0495580_0004415
310 Ga0495645_0237640
311 Ga0495658_0023111
312 Ga0495604_0055827
313 Ga0495674_0613199
314 Ga0496100_0315948
315 Ga0496101_0429506
316 Ga0496102_0027791
317 Ga0496102_0183694
318 Ga0496103_0183414
319 Ga0496103_0258195
320 Ga0496103_0357054
321 Ga0496104_0027053
322 Ga0496104_0114348
323 Ga0496105_0070452
324 Ga0496106_0518814
325 Ga0496107_0069149
326 Ga0496107_0177258
327 Ga0496107_0391667
328 Ga0496109_0064798
329 Ga0496110_0065640
330 Ga0496111_0013409
331 Ga0496112_0000923
332 Ga0496112_0034825
333 Ga0496113_0433121
334 Ga0496114_0042303
335 Ga0496115_0082667
336 Ga0496116_0000287
337 Ga0496117_0012567
338 Ga0496117_0019142
339 Ga0496118_0002504
340 Ga0496118_0017474
341 Ga0496119_0009044
342 Ga0496121_0012873
343 Ga0501031_0062603
344 Ga0501034_0012521
345 Ga0501036_0035183
346 Ga0501038_0141881
347 Ga0501039_0015663
348 Ga0501041_0022263
349 Ga0501042_0144851
350 Ga0501047_0109060
351 Ga0501048_0087866
352 Ga0501067_0020112
353 Ga0501070_0001972
354 Ga0501071_0069299
355 Ga0501072_0035504
356 Ga0501074_0008972
357 Ga0501074_0083232
358 Ga0501076_0080342
359 Ga0501080_0002800
360 Ga0501044_0054073
361 Ga0501045_0029252
362 nmdc:mga05p37_97491_c1
363 nmdc:mga09592_15339_c1
364 nmdc:mga09592_52087_c1
365 nmdc:mga08y16_29997_c1
366 nmdc:mga0n895_394468_c1
367 nmdc:mga0n895_982131_c1
368 nmdc:mga0rr50_84943_c1
369 nmdc:mga08x19_136737_c1
370 Ga0500622_0148166
371 Ga0501084_0625367
372 Ga0466962_0210892
373 Ga0530510_0058422
374 2517759873
375 2506868745
376 2514053620
377 2580931892
378 2621277781
379 2676201935
380 2689963966
381 2774846511
382 2774904578
383 8002788964
384 8002790328

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

44

154

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

191

265

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9721 2 122
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9664 1 120
5uic-assembly1.cif.gz_A structure of the francisella response regulator receiver domain, qseb 0.9659 2 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9644 3 120
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9635 3 120
ID Description Score Start End Superfamily
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9941 3 86 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9883 3 81 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9854 2 79 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9825 3 86 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9795 4 81 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A258N5Y6-F1-model_v4 Two-component system response regulator 0.7882 1 156 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2N8NYX3-F1-model_v4 Transcriptional regulator 0.7664 2 228 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A651E3V3-F1-model_v4 DNA-binding response regulator 0.7663 2 172 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A651E3V3-F1-model_v4 DNA-binding response regulator 0.7622 2 172 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A269XFL2-F1-model_v4 deleted 0.7598 4 164

Map