F296343
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 192 | 125 | 189 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300053119|Ga0500595_086377|Ga0500595_086377_441_761 |
| Length | 106 |
| Sequence | MAKLRKNDNVVVLTGRDKGRQTTILQVIGDDRLLLEGVNVVKRHTKGNPNPSAGQPGGIREKEMPIHHSNVAIFNQATKKADKVGFKLLNDGKKVRIYKSTGEAID |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 3 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 4 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 29 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 30 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 31 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 32 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 33 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 34 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 35 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 42 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 43 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 56 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 58 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 59 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 60 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 61 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 62 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 63 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 64 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 65 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 66 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 67 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 68 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 69 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 70 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 71 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 72 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 73 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 74 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 75 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 76 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 77 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 81 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 82 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 83 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 84 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 85 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 86 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 87 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 88 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 89 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 90 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 91 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 92 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 93 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 94 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 95 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 96 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 97 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 98 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 99 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 101 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 102 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 103 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 105 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 110 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 111 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 112 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 113 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 114 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 115 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 116 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 117 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 118 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.65 |
| Metatranscriptomes | 19.79 |
| Isolates | 1.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.94 |
| Nodule | 1.04 |
| Rhizoplane | 0.52 |
| Rhizosphere | 85.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_FSXC22185_g1 | 2010549000 | Bacteria | 825 |
| 2 | rootL2_10004257 | 3300003322 | Bacteria | 11441 |
| 3 | Ga0055524_1029964 | 3300003775 | Bacteria | 1596 |
| 4 | Ga0055528_1037491 | 3300003790 | Bacteria | 1139 |
| 5 | Ga0055528_1038872 | 3300003790 | Bacteria | 1096 |
| 6 | Ga0055530_10073925 | 3300003791 | Bacteria | 729 |
| 7 | Ga0055540_1011339 | 3300003792 | Bacteria | 2882 |
| 8 | Ga0055531_10021540 | 3300003794 | Bacteria | 2495 |
| 9 | Ga0058861_10032824 | 3300004800 | Bacteria | 1948 |
| 10 | Ga0070683_100451111 | 3300005329 | Bacteria | 1227 |
| 11 | Ga0070692_10178216 | 3300005345 | Bacteria | 1230 |
| 12 | Ga0070705_100003035 | 3300005440 | Bacteria | 8283 |
| 13 | Ga0070700_100023087 | 3300005441 | Bacteria | 3637 |
| 14 | Ga0070694_100022048 | 3300005444 | Bacteria | 4079 |
| 15 | Ga0070681_10188570 | 3300005458 | Bacteria | 1982 |
| 16 | Ga0068867_100118083 | 3300005459 | Bacteria | 2046 |
| 17 | Ga0068867_100159199 | 3300005459 | Bacteria | 1779 |
| 18 | Ga0070706_100467835 | 3300005467 | Bacteria | 1173 |
| 19 | Ga0070707_100809736 | 3300005468 | Bacteria | 901 |
| 20 | Ga0070698_100293080 | 3300005471 | Bacteria | 1558 |
| 21 | Ga0070699_100137776 | 3300005518 | Bacteria | 2153 |
| 22 | Ga0070697_100020637 | 3300005536 | Bacteria | 5214 |
| 23 | Ga0070697_101287411 | 3300005536 | Bacteria | 652 |
| 24 | Ga0068853_101581022 | 3300005539 | Bacteria | 635 |
| 25 | Ga0070695_100001266 | 3300005545 | Bacteria | 13913 |
| 26 | Ga0070695_101867723 | 3300005545 | Bacteria | 505 |
| 27 | Ga0070696_100004428 | 3300005546 | Bacteria | 9371 |
| 28 | Ga0068858_101870745 | 3300005842 | Bacteria | 593 |
| 29 | Ga0075362_10323325 | 3300006177 | Bacteria | 769 |
| 30 | Ga0075366_10026067 | 3300006195 | Bacteria | 3421 |
| 31 | Ga0075370_10953567 | 3300006353 | Bacteria | 525 |
| 32 | Ga0075436_100002331 | 3300006914 | Bacteria | 13096 |
| 33 | Ga0075436_100164914 | 3300006914 | Bacteria | 1563 |
| 34 | Ga0099823_1000064 | 3300006944 | Bacteria | 50328 |
| 35 | Ga0075435_100776538 | 3300007076 | Bacteria | 834 |
| 36 | Ga0099794_10176851 | 3300007265 | Bacteria | 1089 |
| 37 | Ga0105243_10341121 | 3300009148 | Bacteria | 1372 |
| 38 | Ga0105248_10350820 | 3300009177 | Bacteria | 1661 |
| 39 | Ga0105237_10169697 | 3300009545 | Bacteria | 2181 |
| 40 | Ga0157378_11562075 | 3300013297 | Bacteria | 705 |
| 41 | Ga0157372_10180877 | 3300013307 | Bacteria | 2441 |
| 42 | Ga0163163_10305665 | 3300014325 | Bacteria | 1643 |
| 43 | Ga0206349_1157331 | 3300020075 | Bacteria | 694 |
| 44 | Ga0206354_10722014 | 3300020081 | Bacteria | 1721 |
| 45 | Ga0209258_105352 | 3300025242 | Bacteria | 2202 |
| 46 | Ga0209050_1008272 | 3300025298 | Bacteria | 5607 |
| 47 | Ga0209051_1000938 | 3300025303 | Bacteria | 28786 |
| 48 | Ga0209257_1019529 | 3300025304 | Bacteria | 2547 |
| 49 | Ga0207671_10269801 | 3300025914 | Bacteria | 1340 |
| 50 | Ga0207693_10636892 | 3300025915 | Bacteria | 829 |
| 51 | Ga0207646_10158398 | 3300025922 | Bacteria | 2043 |
| 52 | Ga0207709_11443517 | 3300025935 | Bacteria | 570 |
| 53 | Ga0207704_10115591 | 3300025938 | Bacteria | 1824 |
| 54 | Ga0207665_10125879 | 3300025939 | Bacteria | 1814 |
| 55 | Ga0207708_10013450 | 3300026075 | Bacteria | 6119 |
| 56 | Ga0207648_10065486 | 3300026089 | Bacteria | 3168 |
| 57 | Ga0207648_11435430 | 3300026089 | Bacteria | 649 |
| 58 | Ga0209389_1000305 | 3300027296 | Bacteria | 30534 |
| 59 | Ga0209981_1039334 | 3300027378 | Bacteria | 705 |
| 60 | Ga0265336_10000618 | 3300028666 | Bacteria | 19547 |
| 61 | Ga0265338_10117192 | 3300028800 | Bacteria | 2132 |
| 62 | Ga0265324_10000002 | 3300029957 | Bacteria | 382754 |
| 63 | Ga0265324_10000500 | 3300029957 | Bacteria | 27131 |
| 64 | Ga0265328_10003225 | 3300031239 | Bacteria | 7230 |
| 65 | Ga0265325_10001662 | 3300031241 | Bacteria | 15453 |
| 66 | Ga0265325_10014526 | 3300031241 | Bacteria | 4446 |
| 67 | Ga0265325_10074612 | 3300031241 | Bacteria | 1696 |
| 68 | Ga0265331_10002744 | 3300031250 | Bacteria | 11718 |
| 69 | Ga0265331_10195800 | 3300031250 | Bacteria | 911 |
| 70 | Ga0265327_10001331 | 3300031251 | Bacteria | 32073 |
| 71 | Ga0265327_10003591 | 3300031251 | Bacteria | 14634 |
| 72 | Ga0265327_10011983 | 3300031251 | Bacteria | 5905 |
| 73 | Ga0265316_10045967 | 3300031344 | Bacteria | 3463 |
| 74 | Ga0265316_10061349 | 3300031344 | Bacteria | 2921 |
| 75 | Ga0265316_10101308 | 3300031344 | Bacteria | 2188 |
| 76 | Ga0307508_10753018 | 3300031616 | Bacteria | 587 |
| 77 | Ga0265314_10001521 | 3300031711 | Bacteria | 25613 |
| 78 | Ga0265314_10055535 | 3300031711 | Bacteria | 2733 |
| 79 | Ga0265314_10121046 | 3300031711 | Bacteria | 1647 |
| 80 | Ga0316576_10012044 | 3300031727 | Bacteria | 5699 |
| 81 | Ga0316576_10016311 | 3300031727 | Bacteria | 5012 |
| 82 | Ga0316578_10000445 | 3300031728 | Bacteria | 13704 |
| 83 | Ga0316578_10001214 | 3300031728 | Bacteria | 10228 |
| 84 | Ga0316578_10088973 | 3300031728 | Bacteria | 1843 |
| 85 | Ga0316578_10447130 | 3300031728 | Bacteria | 764 |
| 86 | Ga0316577_10070317 | 3300031733 | Bacteria | 1954 |
| 87 | Ga0307413_10324614 | 3300031824 | Bacteria | 1177 |
| 88 | Ga0307413_10395470 | 3300031824 | Bacteria | 1081 |
| 89 | Ga0307416_102155250 | 3300032002 | Bacteria | 659 |
| 90 | Ga0307414_10121151 | 3300032004 | Bacteria | 2011 |
| 91 | Ga0307414_11175532 | 3300032004 | Bacteria | 710 |
| 92 | Ga0316583_10000730 | 3300032133 | Bacteria | 10224 |
| 93 | Ga0316580_10008762 | 3300032139 | Bacteria | 3038 |
| 94 | Ga0316593_10000041 | 3300032168 | Bacteria | 14110 |
| 95 | Ga0316593_10000267 | 3300032168 | Bacteria | 8686 |
| 96 | Ga0316593_10000658 | 3300032168 | Bacteria | 6651 |
| 97 | Ga0316593_10003521 | 3300032168 | Bacteria | 3902 |
| 98 | Ga0316593_10033972 | 3300032168 | Bacteria | 1672 |
| 99 | Ga0316593_10058087 | 3300032168 | Bacteria | 1318 |
| 100 | Ga0316593_10076354 | 3300032168 | Bacteria | 1164 |
| 101 | Ga0316593_10169486 | 3300032168 | Bacteria | 800 |
| 102 | Ga0316593_10172880 | 3300032168 | Bacteria | 792 |
| 103 | Ga0316593_10285838 | 3300032168 | Bacteria | 622 |
| 104 | Ga0316592_1000041 | 3300033524 | Bacteria | 10240 |
| 105 | Ga0316592_1000599 | 3300033524 | Bacteria | 5204 |
| 106 | Ga0316592_1005735 | 3300033524 | Bacteria | 2368 |
| 107 | Ga0316592_1091869 | 3300033524 | Bacteria | 695 |
| 108 | Ga0316588_1001345 | 3300033528 | Bacteria | 3987 |
| 109 | Ga0316587_1000717 | 3300033529 | Bacteria | 3603 |
| 110 | Ga0316596_1000014 | 3300033541 | Bacteria | 16366 |
| 111 | Ga0316596_1000073 | 3300033541 | Bacteria | 11690 |
| 112 | Ga0316596_1000650 | 3300033541 | Bacteria | 6228 |
| 113 | Ga0316596_1000766 | 3300033541 | Bacteria | 5881 |
| 114 | Ga0316596_1031776 | 3300033541 | Bacteria | 1372 |
| 115 | Ga0316596_1061312 | 3300033541 | Bacteria | 1003 |
| 116 | Ga0316596_1088215 | 3300033541 | Bacteria | 835 |
| 117 | Ga0373932_0244923 | 3300035112 | Bacteria | 652 |
| 118 | Ga0373936_0274744 | 3300035113 | Bacteria | 756 |
| 119 | Ga0373943_0664653 | 3300035170 | Bacteria | 616 |
| 120 | Ga0316574_0005612 | 3300035398 | Bacteria | 6707 |
| 121 | Ga0373931_0399093 | 3300035691 | Bacteria | 870 |
| 122 | Ga0373935_0048532 | 3300035692 | Bacteria | 2688 |
| 123 | Ga0373927_0616158 | 3300035695 | Bacteria | 717 |
| 124 | Ga0373933_0234874 | 3300035724 | Bacteria | 1178 |
| 125 | Ga0373947_0082113 | 3300035725 | Bacteria | 1997 |
| 126 | Ga0373937_0228383 | 3300036401 | Bacteria | 1752 |
| 127 | Ga0373937_0304200 | 3300036401 | Bacteria | 1507 |
| 128 | Ga0373937_0840980 | 3300036401 | Bacteria | 866 |
| 129 | Ga0316582_0099996 | 3300036647 | Bacteria | 1920 |
| 130 | Ga0316582_0198826 | 3300036647 | Bacteria | 1367 |
| 131 | Ga0316582_0542207 | 3300036647 | Bacteria | 801 |
| 132 | Ga0316584_0004833 | 3300036712 | Bacteria | 8958 |
| 133 | Ga0373925_0163298 | 3300037068 | Bacteria | 1755 |
| 134 | Ga0451577_0012814 | 3300042876 | Bacteria | 7869 |
| 135 | Ga0451577_0121977 | 3300042876 | Bacteria | 2335 |
| 136 | Ga0451577_0288955 | 3300042876 | Bacteria | 1486 |
| 137 | Ga0451577_0435040 | 3300042876 | Bacteria | 1191 |
| 138 | Ga0451577_0466260 | 3300042876 | Bacteria | 1147 |
| 139 | Ga0453683_0003443 | 3300044673 | Bacteria | 11656 |
| 140 | Ga0453683_0363900 | 3300044673 | Bacteria | 930 |
| 141 | Ga0453683_0708707 | 3300044673 | Bacteria | 660 |
| 142 | Ga0453683_0941179 | 3300044673 | Bacteria | 572 |
| 143 | Ga0466963_1343676 | 3300044694 | Bacteria | 501 |
| 144 | Ga0453684_0000014 | 3300044712 | Bacteria | 993311 |
| 145 | Ga0453684_0000682 | 3300044712 | Bacteria | 121090 |
| 146 | Ga0453684_0001268 | 3300044712 | Bacteria | 75704 |
| 147 | Ga0453684_0003526 | 3300044712 | Bacteria | 35001 |
| 148 | Ga0453684_0026453 | 3300044712 | Bacteria | 8377 |
| 149 | Ga0453684_0035225 | 3300044712 | Bacteria | 6924 |
| 150 | Ga0453684_0052275 | 3300044712 | Bacteria | 5345 |
| 151 | Ga0453684_0145970 | 3300044712 | Bacteria | 2818 |
| 152 | Ga0453684_0436833 | 3300044712 | Bacteria | 1459 |
| 153 | Ga0453684_0537871 | 3300044712 | Bacteria | 1289 |
| 154 | Ga0453684_1151341 | 3300044712 | Bacteria | 817 |
| 155 | Ga0451576_0000096 | 3300045051 | Bacteria | 221078 |
| 156 | Ga0451576_0000909 | 3300045051 | Bacteria | 56035 |
| 157 | Ga0451576_0044061 | 3300045051 | Bacteria | 4705 |
| 158 | Ga0451576_0419975 | 3300045051 | Bacteria | 1403 |
| 159 | Ga0451576_0774187 | 3300045051 | Bacteria | 1008 |
| 160 | Ga0451576_0886009 | 3300045051 | Bacteria | 936 |
| 161 | Ga0466967_0988843 | 3300045976 | Bacteria | 838 |
| 162 | Ga0495681_0027011 | 3300047470 | Bacteria | 2977 |
| 163 | Ga0496102_1529823 | 3300048905 | Bacteria | 586 |
| 164 | Ga0496124_0030272 | 3300048927 | Bacteria | 4807 |
| 165 | Ga0496126_0094581 | 3300048929 | Bacteria | 2622 |
| 166 | Ga0501306_002779 | 3300049127 | Bacteria | 1827 |
| 167 | Ga0501290_001582 | 3300049513 | Bacteria | 3072 |
| 168 | Ga0501320_008553 | 3300049536 | Bacteria | 1009 |
| 169 | Ga0501335_011291 | 3300049551 | Bacteria | 872 |
| 170 | Ga0501337_000866 | 3300049553 | Bacteria | 1621 |
| 171 | Ga0501071_0836955 | 3300049587 | Bacteria | 710 |
| 172 | Ga0501209_000329 | 3300049656 | Bacteria | 5742 |
| 173 | nmdc:mga0k408_78109_c2 | 3300050493 | Bacteria | 822 |
| 174 | nmdc:mga08x19_141689_c1 | 3300050514 | Bacteria | 1624 |
| 175 | nmdc:mga08x19_15449_c1 | 3300050514 | Bacteria | 4646 |
| 176 | Ga0500595_086377 | 3300053119 | Unclassified | 913 |
| 177 | Ga0500607_007545 | 3300053121 | Bacteria | 6708 |
| 178 | Ga0500622_0000002 | 3300053156 | Bacteria | 646442 |
| 179 | Ga0500636_0017061 | 3300053177 | Bacteria | 4282 |
| 180 | Ga0500637_0015290 | 3300053178 | Bacteria | 4066 |
| 181 | Ga0500625_174794 | 3300053729 | Bacteria | 764 |
| 182 | Ga0587070_044780 | 3300059491 | Bacteria | 861 |
| 183 | Ga0587077_036405 | 3300059493 | Bacteria | 966 |
| 184 | Ga0587083_0079963 | 3300059505 | Bacteria | 777 |
| 185 | Ga0587085_006077 | 3300059506 | Bacteria | 1453 |
| 186 | Ga0587090_068651 | 3300059510 | Bacteria | 688 |
| 187 | Ga0587109_006245 | 3300059624 | Bacteria | 1751 |
| 188 | Ga0587076_020602 | 3300059645 | Bacteria | 1084 |
| 189 | Ga0587100_021546 | 3300059648 | Bacteria | 632 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031344 | Ga0265316_10045967 | Ga0265316_100459679 | 88 |
| 2 | 3300042876 | Ga0451577_0121977 | Ga0451577_0121977_1013_1333 | 93 |
| 3 | 3300044712 | Ga0453684_0026453 | Ga0453684_0026453_5312_5632 | 93 |
| 4 | iso_pu_bacteria | 2547132103 | 2547375770 | 100 |
| 5 | iso_pu_bacteria | 2843690924 | 2843691333 | 100 |
| 6 | iso_pu_bacteria | 2894414249 | 2894414505 | 100 |
| 7 | 3300005440 | Ga0070705_100003035 | Ga0070705_1000030352 | 104 |
| 8 | 3300005444 | Ga0070694_100022048 | Ga0070694_1000220489 | 104 |
| 9 | 3300005536 | Ga0070697_100020637 | Ga0070697_1000206379 | 104 |
| 10 | 3300005545 | Ga0070695_100001266 | Ga0070695_10000126614 | 104 |
| 11 | 3300005546 | Ga0070696_100004428 | Ga0070696_10000442810 | 104 |
| 12 | 3300006914 | Ga0075436_100002331 | Ga0075436_10000233115 | 104 |
| 13 | 3300025915 | Ga0207693_10636892 | Ga0207693_106368922 | 104 |
| 14 | 3300025939 | Ga0207665_10125879 | Ga0207665_101258794 | 104 |
| 15 | 3300028666 | Ga0265336_10000618 | Ga0265336_1000061814 | 104 |
| 16 | 3300028800 | Ga0265338_10117192 | Ga0265338_101171922 | 104 |
| 17 | 3300029957 | Ga0265324_10000002 | Ga0265324_1000000277 | 104 |
| 18 | 3300029957 | Ga0265324_10000500 | Ga0265324_1000050032 | 104 |
| 19 | 3300031241 | Ga0265325_10001662 | Ga0265325_100016629 | 104 |
| 20 | 3300031344 | Ga0265316_10061349 | Ga0265316_100613496 | 104 |
| 21 | 3300031711 | Ga0265314_10001521 | Ga0265314_1000152114 | 104 |
| 22 | 3300031711 | Ga0265314_10055535 | Ga0265314_100555356 | 104 |
| 23 | 3300031711 | Ga0265314_10121046 | Ga0265314_101210461 | 104 |
| 24 | 3300050514 | nmdc:mga08x19_15449_c1 | nmdc:mga08x19_15449_c1_419_733 | 104 |
| 25 | 3300053119 | Ga0500595_086377 | Ga0500595_086377_441_761 | 104 |
| 26 | 2010549000 | RicEn_FSXC22185_g1 | RicEn_296650 | 105 |
| 27 | 3300003322 | rootL2_10004257 | rootL2_100042576 | 105 |
| 28 | 3300003775 | Ga0055524_1029964 | Ga0055524_10299642 | 105 |
| 29 | 3300003790 | Ga0055528_1037491 | Ga0055528_10374912 | 105 |
| 30 | 3300003790 | Ga0055528_1038872 | Ga0055528_10388722 | 105 |
| 31 | 3300003791 | Ga0055530_10073925 | Ga0055530_100739252 | 105 |
| 32 | 3300003792 | Ga0055540_1011339 | Ga0055540_10113394 | 105 |
| 33 | 3300003794 | Ga0055531_10021540 | Ga0055531_100215405 | 105 |
| 34 | 3300004800 | Ga0058861_10032824 | Ga0058861_100328243 | 105 |
| 35 | 3300005329 | Ga0070683_100451111 | Ga0070683_1004511111 | 105 |
| 36 | 3300005345 | Ga0070692_10178216 | Ga0070692_101782161 | 105 |
| 37 | 3300005441 | Ga0070700_100023087 | Ga0070700_1000230878 | 105 |
| 38 | 3300005458 | Ga0070681_10188570 | Ga0070681_101885702 | 105 |
| 39 | 3300005459 | Ga0068867_100118083 | Ga0068867_1001180835 | 105 |
| 40 | 3300005459 | Ga0068867_100159199 | Ga0068867_1001591994 | 105 |
| 41 | 3300005467 | Ga0070706_100467835 | Ga0070706_1004678352 | 105 |
| 42 | 3300005468 | Ga0070707_100809736 | Ga0070707_1008097362 | 105 |
| 43 | 3300005471 | Ga0070698_100293080 | Ga0070698_1002930803 | 105 |
| 44 | 3300005518 | Ga0070699_100137776 | Ga0070699_1001377766 | 105 |
| 45 | 3300005536 | Ga0070697_101287411 | Ga0070697_1012874111 | 105 |
| 46 | 3300005539 | Ga0068853_101581022 | Ga0068853_1015810222 | 105 |
| 47 | 3300005545 | Ga0070695_101867723 | Ga0070695_1018677231 | 105 |
| 48 | 3300005842 | Ga0068858_101870745 | Ga0068858_1018707452 | 105 |
| 49 | 3300006177 | Ga0075362_10323325 | Ga0075362_103233252 | 105 |
| 50 | 3300006195 | Ga0075366_10026067 | Ga0075366_100260678 | 105 |
| 51 | 3300006353 | Ga0075370_10953567 | Ga0075370_109535672 | 105 |
| 52 | 3300006914 | Ga0075436_100164914 | Ga0075436_1001649142 | 105 |
| 53 | 3300006944 | Ga0099823_1000064 | Ga0099823_100006415 | 105 |
| 54 | 3300007076 | Ga0075435_100776538 | Ga0075435_1007765382 | 105 |
| 55 | 3300007265 | Ga0099794_10176851 | Ga0099794_101768512 | 105 |
| 56 | 3300009148 | Ga0105243_10341121 | Ga0105243_103411212 | 105 |
| 57 | 3300009177 | Ga0105248_10350820 | Ga0105248_103508202 | 105 |
| 58 | 3300009545 | Ga0105237_10169697 | Ga0105237_101696972 | 105 |
| 59 | 3300013297 | Ga0157378_11562075 | Ga0157378_115620752 | 105 |
| 60 | 3300013307 | Ga0157372_10180877 | Ga0157372_101808772 | 105 |
| 61 | 3300014325 | Ga0163163_10305665 | Ga0163163_103056654 | 105 |
| 62 | 3300020075 | Ga0206349_1157331 | Ga0206349_11573312 | 105 |
| 63 | 3300020081 | Ga0206354_10722014 | Ga0206354_107220143 | 105 |
| 64 | 3300025242 | Ga0209258_105352 | Ga0209258_1053524 | 105 |
| 65 | 3300025298 | Ga0209050_1008272 | Ga0209050_10082723 | 105 |
| 66 | 3300025303 | Ga0209051_1000938 | Ga0209051_100093837 | 105 |
| 67 | 3300025304 | Ga0209257_1019529 | Ga0209257_10195295 | 105 |
| 68 | 3300025914 | Ga0207671_10269801 | Ga0207671_102698013 | 105 |
| 69 | 3300025922 | Ga0207646_10158398 | Ga0207646_101583986 | 105 |
| 70 | 3300025935 | Ga0207709_11443517 | Ga0207709_114435172 | 105 |
| 71 | 3300025938 | Ga0207704_10115591 | Ga0207704_101155913 | 105 |
| 72 | 3300026075 | Ga0207708_10013450 | Ga0207708_1001345013 | 105 |
| 73 | 3300026089 | Ga0207648_10065486 | Ga0207648_100654865 | 105 |
| 74 | 3300026089 | Ga0207648_11435430 | Ga0207648_114354302 | 105 |
| 75 | 3300027296 | Ga0209389_1000305 | Ga0209389_100030533 | 105 |
| 76 | 3300027378 | Ga0209981_1039334 | Ga0209981_10393342 | 105 |
| 77 | 3300031239 | Ga0265328_10003225 | Ga0265328_100032255 | 105 |
| 78 | 3300031241 | Ga0265325_10014526 | Ga0265325_100145263 | 105 |
| 79 | 3300031241 | Ga0265325_10074612 | Ga0265325_100746122 | 105 |
| 80 | 3300031250 | Ga0265331_10002744 | Ga0265331_1000274414 | 105 |
| 81 | 3300031250 | Ga0265331_10195800 | Ga0265331_101958001 | 105 |
| 82 | 3300031251 | Ga0265327_10001331 | Ga0265327_1000133116 | 105 |
| 83 | 3300031251 | Ga0265327_10003591 | Ga0265327_1000359118 | 105 |
| 84 | 3300031251 | Ga0265327_10011983 | Ga0265327_1001198310 | 105 |
| 85 | 3300031344 | Ga0265316_10101308 | Ga0265316_101013086 | 105 |
| 86 | 3300031616 | Ga0307508_10753018 | Ga0307508_107530182 | 105 |
| 87 | 3300031727 | Ga0316576_10012044 | Ga0316576_1001204410 | 105 |
| 88 | 3300031727 | Ga0316576_10016311 | Ga0316576_1001631111 | 105 |
| 89 | 3300031728 | Ga0316578_10000445 | Ga0316578_100004453 | 105 |
| 90 | 3300031728 | Ga0316578_10001214 | Ga0316578_1000121410 | 105 |
| 91 | 3300031728 | Ga0316578_10088973 | Ga0316578_100889735 | 105 |
| 92 | 3300031728 | Ga0316578_10447130 | Ga0316578_104471302 | 105 |
| 93 | 3300031733 | Ga0316577_10070317 | Ga0316577_100703172 | 105 |
| 94 | 3300031824 | Ga0307413_10324614 | Ga0307413_103246142 | 105 |
| 95 | 3300031824 | Ga0307413_10395470 | Ga0307413_103954702 | 105 |
| 96 | 3300032002 | Ga0307416_102155250 | Ga0307416_1021552502 | 105 |
| 97 | 3300032004 | Ga0307414_10121151 | Ga0307414_101211514 | 105 |
| 98 | 3300032004 | Ga0307414_11175532 | Ga0307414_111755321 | 105 |
| 99 | 3300032133 | Ga0316583_10000730 | Ga0316583_1000073016 | 105 |
| 100 | 3300032139 | Ga0316580_10008762 | Ga0316580_100087627 | 105 |
| 101 | 3300032168 | Ga0316593_10000041 | Ga0316593_1000004117 | 105 |
| 102 | 3300032168 | Ga0316593_10000267 | Ga0316593_100002677 | 105 |
| 103 | 3300032168 | Ga0316593_10000658 | Ga0316593_100006587 | 105 |
| 104 | 3300032168 | Ga0316593_10003521 | Ga0316593_100035218 | 105 |
| 105 | 3300032168 | Ga0316593_10033972 | Ga0316593_100339722 | 105 |
| 106 | 3300032168 | Ga0316593_10058087 | Ga0316593_100580871 | 105 |
| 107 | 3300032168 | Ga0316593_10076354 | Ga0316593_100763543 | 105 |
| 108 | 3300032168 | Ga0316593_10169486 | Ga0316593_101694862 | 105 |
| 109 | 3300032168 | Ga0316593_10172880 | Ga0316593_101728802 | 105 |
| 110 | 3300032168 | Ga0316593_10285838 | Ga0316593_102858382 | 105 |
| 111 | 3300033524 | Ga0316592_1000041 | Ga0316592_100004110 | 105 |
| 112 | 3300033524 | Ga0316592_1000599 | Ga0316592_100059910 | 105 |
| 113 | 3300033524 | Ga0316592_1005735 | Ga0316592_10057355 | 105 |
| 114 | 3300033524 | Ga0316592_1091869 | Ga0316592_10918692 | 105 |
| 115 | 3300033528 | Ga0316588_1001345 | Ga0316588_10013457 | 105 |
| 116 | 3300033529 | Ga0316587_1000717 | Ga0316587_10007175 | 105 |
| 117 | 3300033541 | Ga0316596_1000014 | Ga0316596_100001414 | 105 |
| 118 | 3300033541 | Ga0316596_1000073 | Ga0316596_10000738 | 105 |
| 119 | 3300033541 | Ga0316596_1000650 | Ga0316596_10006508 | 105 |
| 120 | 3300033541 | Ga0316596_1000766 | Ga0316596_100076613 | 105 |
| 121 | 3300033541 | Ga0316596_1031776 | Ga0316596_10317764 | 105 |
| 122 | 3300033541 | Ga0316596_1061312 | Ga0316596_10613123 | 105 |
| 123 | 3300033541 | Ga0316596_1088215 | Ga0316596_10882152 | 105 |
| 124 | 3300035112 | Ga0373932_0244923 | Ga0373932_0244923_212_529 | 105 |
| 125 | 3300035113 | Ga0373936_0274744 | Ga0373936_0274744_419_736 | 105 |
| 126 | 3300035170 | Ga0373943_0664653 | Ga0373943_0664653_133_450 | 105 |
| 127 | 3300035398 | Ga0316574_0005612 | Ga0316574_0005612_1870_2187 | 105 |
| 128 | 3300035691 | Ga0373931_0399093 | Ga0373931_0399093_516_833 | 105 |
| 129 | 3300035692 | Ga0373935_0048532 | Ga0373935_0048532_675_992 | 105 |
| 130 | 3300035695 | Ga0373927_0616158 | Ga0373927_0616158_17_334 | 105 |
| 131 | 3300035724 | Ga0373933_0234874 | Ga0373933_0234874_164_481 | 105 |
| 132 | 3300035725 | Ga0373947_0082113 | Ga0373947_0082113_113_430 | 105 |
| 133 | 3300036401 | Ga0373937_0228383 | Ga0373937_0228383_479_796 | 105 |
| 134 | 3300036401 | Ga0373937_0304200 | Ga0373937_0304200_32_349 | 105 |
| 135 | 3300036401 | Ga0373937_0840980 | Ga0373937_0840980_106_459 | 105 |
| 136 | 3300036647 | Ga0316582_0099996 | Ga0316582_0099996_20_337 | 105 |
| 137 | 3300036647 | Ga0316582_0198826 | Ga0316582_0198826_97_414 | 105 |
| 138 | 3300036647 | Ga0316582_0542207 | Ga0316582_0542207_230_550 | 105 |
| 139 | 3300036712 | Ga0316584_0004833 | Ga0316584_0004833_3220_3540 | 105 |
| 140 | 3300037068 | Ga0373925_0163298 | Ga0373925_0163298_384_701 | 105 |
| 141 | 3300042876 | Ga0451577_0012814 | Ga0451577_0012814_6067_6384 | 105 |
| 142 | 3300042876 | Ga0451577_0288955 | Ga0451577_0288955_577_894 | 105 |
| 143 | 3300042876 | Ga0451577_0435040 | Ga0451577_0435040_786_1103 | 105 |
| 144 | 3300042876 | Ga0451577_0466260 | Ga0451577_0466260_357_677 | 105 |
| 145 | 3300044673 | Ga0453683_0003443 | Ga0453683_0003443_5310_5627 | 105 |
| 146 | 3300044673 | Ga0453683_0363900 | Ga0453683_0363900_383_700 | 105 |
| 147 | 3300044673 | Ga0453683_0708707 | Ga0453683_0708707_156_473 | 105 |
| 148 | 3300044673 | Ga0453683_0941179 | Ga0453683_0941179_204_521 | 105 |
| 149 | 3300044694 | Ga0466963_1343676 | Ga0466963_1343676_21_338 | 105 |
| 150 | 3300044712 | Ga0453684_0000014 | Ga0453684_0000014_557292_557609 | 105 |
| 151 | 3300044712 | Ga0453684_0000682 | Ga0453684_0000682_114784_115101 | 105 |
| 152 | 3300044712 | Ga0453684_0001268 | Ga0453684_0001268_69379_69696 | 105 |
| 153 | 3300044712 | Ga0453684_0003526 | Ga0453684_0003526_8274_8591 | 105 |
| 154 | 3300044712 | Ga0453684_0035225 | Ga0453684_0035225_6527_6844 | 105 |
| 155 | 3300044712 | Ga0453684_0052275 | Ga0453684_0052275_4058_4375 | 105 |
| 156 | 3300044712 | Ga0453684_0145970 | Ga0453684_0145970_143_460 | 105 |
| 157 | 3300044712 | Ga0453684_0436833 | Ga0453684_0436833_1105_1422 | 105 |
| 158 | 3300044712 | Ga0453684_0537871 | Ga0453684_0537871_121_438 | 105 |
| 159 | 3300044712 | Ga0453684_1151341 | Ga0453684_1151341_291_608 | 105 |
| 160 | 3300045051 | Ga0451576_0000096 | Ga0451576_0000096_212488_212805 | 105 |
| 161 | 3300045051 | Ga0451576_0000909 | Ga0451576_0000909_49695_50012 | 105 |
| 162 | 3300045051 | Ga0451576_0044061 | Ga0451576_0044061_2108_2425 | 105 |
| 163 | 3300045051 | Ga0451576_0419975 | Ga0451576_0419975_1073_1390 | 105 |
| 164 | 3300045051 | Ga0451576_0774187 | Ga0451576_0774187_212_529 | 105 |
| 165 | 3300045051 | Ga0451576_0886009 | Ga0451576_0886009_420_737 | 105 |
| 166 | 3300045976 | Ga0466967_0988843 | Ga0466967_0988843_434_757 | 105 |
| 167 | 3300047470 | Ga0495681_0027011 | Ga0495681_0027011_186_503 | 105 |
| 168 | 3300048905 | Ga0496102_1529823 | Ga0496102_1529823_142_459 | 105 |
| 169 | 3300048927 | Ga0496124_0030272 | Ga0496124_0030272_2801_3118 | 105 |
| 170 | 3300048929 | Ga0496126_0094581 | Ga0496126_0094581_1295_1618 | 105 |
| 171 | 3300049127 | Ga0501306_002779 | Ga0501306_002779_1311_1634 | 105 |
| 172 | 3300049513 | Ga0501290_001582 | Ga0501290_001582_388_705 | 105 |
| 173 | 3300049536 | Ga0501320_008553 | Ga0501320_008553_176_499 | 105 |
| 174 | 3300049551 | Ga0501335_011291 | Ga0501335_011291_461_778 | 105 |
| 175 | 3300049553 | Ga0501337_000866 | Ga0501337_000866_1123_1446 | 105 |
| 176 | 3300049587 | Ga0501071_0836955 | Ga0501071_0836955_78_395 | 105 |
| 177 | 3300049656 | Ga0501209_000329 | Ga0501209_000329_3445_3768 | 105 |
| 178 | 3300050493 | nmdc:mga0k408_78109_c2 | nmdc:mga0k408_78109_c2_182_499 | 105 |
| 179 | 3300050514 | nmdc:mga08x19_141689_c1 | nmdc:mga08x19_141689_c1_367_684 | 105 |
| 180 | 3300053121 | Ga0500607_007545 | Ga0500607_007545_6303_6620 | 105 |
| 181 | 3300053156 | Ga0500622_0000002 | Ga0500622_0000002_5850_6167 | 105 |
| 182 | 3300053177 | Ga0500636_0017061 | Ga0500636_0017061_3365_3682 | 105 |
| 183 | 3300053178 | Ga0500637_0015290 | Ga0500637_0015290_1845_2162 | 105 |
| 184 | 3300053729 | Ga0500625_174794 | Ga0500625_174794_11_328 | 105 |
| 185 | 3300059491 | Ga0587070_044780 | Ga0587070_044780_288_605 | 105 |
| 186 | 3300059493 | Ga0587077_036405 | Ga0587077_036405_338_655 | 105 |
| 187 | 3300059505 | Ga0587083_0079963 | Ga0587083_0079963_227_544 | 105 |
| 188 | 3300059506 | Ga0587085_006077 | Ga0587085_006077_585_902 | 105 |
| 189 | 3300059510 | Ga0587090_068651 | Ga0587090_068651_195_512 | 105 |
| 190 | 3300059624 | Ga0587109_006245 | Ga0587109_006245_449_766 | 105 |
| 191 | 3300059645 | Ga0587076_020602 | Ga0587076_020602_199_516 | 105 |
| 192 | 3300059648 | Ga0587100_021546 | Ga0587100_021546_199_516 | 105 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cgv-assembly1.cif.gz_t | tiamulin bound to the 50s subunit | 0.9505 | 4 | 103 |
| 8cam-assembly1.cif.gz_t | evernimicin bound to the 50s subunit | 0.9472 | 1 | 103 |
| 6vwn-assembly1.cif.gz_S | 70s ribosome bound to hiv frameshifting stem-loop (fss) and p-site trna (non-rotated conformation, structure ii) | 0.9457 | 1 | 103 |
| 6vwl-assembly1.cif.gz_S | 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) | 0.9424 | 4 | 103 |
| 7nwt-assembly1.cif.gz_U | initiated 70s ribosome in complex with 2a protein from encephalomyocarditis virus (emcv) | 0.9423 | 1 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q69T55_240_282_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8935 | 4 | 36 | 2.30.30.30 |
| af_C6KSP8_36_136_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8897 | 1 | 100 | 2.30.30.30 |
| af_Q55DJ4_14_116_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8853 | 4 | 101 | 2.30.30.30 |
| af_C6SX56_4_111_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.883 | 4 | 100 | 2.30.30.30 |
| af_Q653V9_69_173_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8614 | 4 | 101 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C3GS56-F1-model_v4 | Large ribosomal subunit protein uL24 (50S ribosomal protein L24) | 0.9916 | 1 | 66 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2E0ICJ6-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9783 | 1 | 103 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A352Q4Q8-F1-model_v4 | Large ribosomal subunit protein uL24 (50S ribosomal protein L24) | 0.9775 | 1 | 82 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2E2ZH91-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9745 | 1 | 103 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2E0ICJ6-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9691 | 1 | 103 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar