F296343

General Info

Members Datasets Scaffolds Average Seq Length
192 125 189 105

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_086377|Ga0500595_086377_441_761
Length 106
Sequence MAKLRKNDNVVVLTGRDKGRQTTILQVIGDDRLLLEGVNVVKRHTKGNPNPSAGQPGGIREKEMPIHHSNVAIFNQATKKADKVGFKLLNDGKKVRIYKSTGEAID

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
3 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
4 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
56 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
60 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
68 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
69 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
74 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
75 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
81 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
105 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
110 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
113 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
114 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
115 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
116 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
117 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
118 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.65
Metatranscriptomes 19.79
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.94
Nodule 1.04
Rhizoplane 0.52
Rhizosphere 85.42
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC22185_g1 2010549000 Bacteria 825
2 rootL2_10004257 3300003322 Bacteria 11441
3 Ga0055524_1029964 3300003775 Bacteria 1596
4 Ga0055528_1037491 3300003790 Bacteria 1139
5 Ga0055528_1038872 3300003790 Bacteria 1096
6 Ga0055530_10073925 3300003791 Bacteria 729
7 Ga0055540_1011339 3300003792 Bacteria 2882
8 Ga0055531_10021540 3300003794 Bacteria 2495
9 Ga0058861_10032824 3300004800 Bacteria 1948
10 Ga0070683_100451111 3300005329 Bacteria 1227
11 Ga0070692_10178216 3300005345 Bacteria 1230
12 Ga0070705_100003035 3300005440 Bacteria 8283
13 Ga0070700_100023087 3300005441 Bacteria 3637
14 Ga0070694_100022048 3300005444 Bacteria 4079
15 Ga0070681_10188570 3300005458 Bacteria 1982
16 Ga0068867_100118083 3300005459 Bacteria 2046
17 Ga0068867_100159199 3300005459 Bacteria 1779
18 Ga0070706_100467835 3300005467 Bacteria 1173
19 Ga0070707_100809736 3300005468 Bacteria 901
20 Ga0070698_100293080 3300005471 Bacteria 1558
21 Ga0070699_100137776 3300005518 Bacteria 2153
22 Ga0070697_100020637 3300005536 Bacteria 5214
23 Ga0070697_101287411 3300005536 Bacteria 652
24 Ga0068853_101581022 3300005539 Bacteria 635
25 Ga0070695_100001266 3300005545 Bacteria 13913
26 Ga0070695_101867723 3300005545 Bacteria 505
27 Ga0070696_100004428 3300005546 Bacteria 9371
28 Ga0068858_101870745 3300005842 Bacteria 593
29 Ga0075362_10323325 3300006177 Bacteria 769
30 Ga0075366_10026067 3300006195 Bacteria 3421
31 Ga0075370_10953567 3300006353 Bacteria 525
32 Ga0075436_100002331 3300006914 Bacteria 13096
33 Ga0075436_100164914 3300006914 Bacteria 1563
34 Ga0099823_1000064 3300006944 Bacteria 50328
35 Ga0075435_100776538 3300007076 Bacteria 834
36 Ga0099794_10176851 3300007265 Bacteria 1089
37 Ga0105243_10341121 3300009148 Bacteria 1372
38 Ga0105248_10350820 3300009177 Bacteria 1661
39 Ga0105237_10169697 3300009545 Bacteria 2181
40 Ga0157378_11562075 3300013297 Bacteria 705
41 Ga0157372_10180877 3300013307 Bacteria 2441
42 Ga0163163_10305665 3300014325 Bacteria 1643
43 Ga0206349_1157331 3300020075 Bacteria 694
44 Ga0206354_10722014 3300020081 Bacteria 1721
45 Ga0209258_105352 3300025242 Bacteria 2202
46 Ga0209050_1008272 3300025298 Bacteria 5607
47 Ga0209051_1000938 3300025303 Bacteria 28786
48 Ga0209257_1019529 3300025304 Bacteria 2547
49 Ga0207671_10269801 3300025914 Bacteria 1340
50 Ga0207693_10636892 3300025915 Bacteria 829
51 Ga0207646_10158398 3300025922 Bacteria 2043
52 Ga0207709_11443517 3300025935 Bacteria 570
53 Ga0207704_10115591 3300025938 Bacteria 1824
54 Ga0207665_10125879 3300025939 Bacteria 1814
55 Ga0207708_10013450 3300026075 Bacteria 6119
56 Ga0207648_10065486 3300026089 Bacteria 3168
57 Ga0207648_11435430 3300026089 Bacteria 649
58 Ga0209389_1000305 3300027296 Bacteria 30534
59 Ga0209981_1039334 3300027378 Bacteria 705
60 Ga0265336_10000618 3300028666 Bacteria 19547
61 Ga0265338_10117192 3300028800 Bacteria 2132
62 Ga0265324_10000002 3300029957 Bacteria 382754
63 Ga0265324_10000500 3300029957 Bacteria 27131
64 Ga0265328_10003225 3300031239 Bacteria 7230
65 Ga0265325_10001662 3300031241 Bacteria 15453
66 Ga0265325_10014526 3300031241 Bacteria 4446
67 Ga0265325_10074612 3300031241 Bacteria 1696
68 Ga0265331_10002744 3300031250 Bacteria 11718
69 Ga0265331_10195800 3300031250 Bacteria 911
70 Ga0265327_10001331 3300031251 Bacteria 32073
71 Ga0265327_10003591 3300031251 Bacteria 14634
72 Ga0265327_10011983 3300031251 Bacteria 5905
73 Ga0265316_10045967 3300031344 Bacteria 3463
74 Ga0265316_10061349 3300031344 Bacteria 2921
75 Ga0265316_10101308 3300031344 Bacteria 2188
76 Ga0307508_10753018 3300031616 Bacteria 587
77 Ga0265314_10001521 3300031711 Bacteria 25613
78 Ga0265314_10055535 3300031711 Bacteria 2733
79 Ga0265314_10121046 3300031711 Bacteria 1647
80 Ga0316576_10012044 3300031727 Bacteria 5699
81 Ga0316576_10016311 3300031727 Bacteria 5012
82 Ga0316578_10000445 3300031728 Bacteria 13704
83 Ga0316578_10001214 3300031728 Bacteria 10228
84 Ga0316578_10088973 3300031728 Bacteria 1843
85 Ga0316578_10447130 3300031728 Bacteria 764
86 Ga0316577_10070317 3300031733 Bacteria 1954
87 Ga0307413_10324614 3300031824 Bacteria 1177
88 Ga0307413_10395470 3300031824 Bacteria 1081
89 Ga0307416_102155250 3300032002 Bacteria 659
90 Ga0307414_10121151 3300032004 Bacteria 2011
91 Ga0307414_11175532 3300032004 Bacteria 710
92 Ga0316583_10000730 3300032133 Bacteria 10224
93 Ga0316580_10008762 3300032139 Bacteria 3038
94 Ga0316593_10000041 3300032168 Bacteria 14110
95 Ga0316593_10000267 3300032168 Bacteria 8686
96 Ga0316593_10000658 3300032168 Bacteria 6651
97 Ga0316593_10003521 3300032168 Bacteria 3902
98 Ga0316593_10033972 3300032168 Bacteria 1672
99 Ga0316593_10058087 3300032168 Bacteria 1318
100 Ga0316593_10076354 3300032168 Bacteria 1164
101 Ga0316593_10169486 3300032168 Bacteria 800
102 Ga0316593_10172880 3300032168 Bacteria 792
103 Ga0316593_10285838 3300032168 Bacteria 622
104 Ga0316592_1000041 3300033524 Bacteria 10240
105 Ga0316592_1000599 3300033524 Bacteria 5204
106 Ga0316592_1005735 3300033524 Bacteria 2368
107 Ga0316592_1091869 3300033524 Bacteria 695
108 Ga0316588_1001345 3300033528 Bacteria 3987
109 Ga0316587_1000717 3300033529 Bacteria 3603
110 Ga0316596_1000014 3300033541 Bacteria 16366
111 Ga0316596_1000073 3300033541 Bacteria 11690
112 Ga0316596_1000650 3300033541 Bacteria 6228
113 Ga0316596_1000766 3300033541 Bacteria 5881
114 Ga0316596_1031776 3300033541 Bacteria 1372
115 Ga0316596_1061312 3300033541 Bacteria 1003
116 Ga0316596_1088215 3300033541 Bacteria 835
117 Ga0373932_0244923 3300035112 Bacteria 652
118 Ga0373936_0274744 3300035113 Bacteria 756
119 Ga0373943_0664653 3300035170 Bacteria 616
120 Ga0316574_0005612 3300035398 Bacteria 6707
121 Ga0373931_0399093 3300035691 Bacteria 870
122 Ga0373935_0048532 3300035692 Bacteria 2688
123 Ga0373927_0616158 3300035695 Bacteria 717
124 Ga0373933_0234874 3300035724 Bacteria 1178
125 Ga0373947_0082113 3300035725 Bacteria 1997
126 Ga0373937_0228383 3300036401 Bacteria 1752
127 Ga0373937_0304200 3300036401 Bacteria 1507
128 Ga0373937_0840980 3300036401 Bacteria 866
129 Ga0316582_0099996 3300036647 Bacteria 1920
130 Ga0316582_0198826 3300036647 Bacteria 1367
131 Ga0316582_0542207 3300036647 Bacteria 801
132 Ga0316584_0004833 3300036712 Bacteria 8958
133 Ga0373925_0163298 3300037068 Bacteria 1755
134 Ga0451577_0012814 3300042876 Bacteria 7869
135 Ga0451577_0121977 3300042876 Bacteria 2335
136 Ga0451577_0288955 3300042876 Bacteria 1486
137 Ga0451577_0435040 3300042876 Bacteria 1191
138 Ga0451577_0466260 3300042876 Bacteria 1147
139 Ga0453683_0003443 3300044673 Bacteria 11656
140 Ga0453683_0363900 3300044673 Bacteria 930
141 Ga0453683_0708707 3300044673 Bacteria 660
142 Ga0453683_0941179 3300044673 Bacteria 572
143 Ga0466963_1343676 3300044694 Bacteria 501
144 Ga0453684_0000014 3300044712 Bacteria 993311
145 Ga0453684_0000682 3300044712 Bacteria 121090
146 Ga0453684_0001268 3300044712 Bacteria 75704
147 Ga0453684_0003526 3300044712 Bacteria 35001
148 Ga0453684_0026453 3300044712 Bacteria 8377
149 Ga0453684_0035225 3300044712 Bacteria 6924
150 Ga0453684_0052275 3300044712 Bacteria 5345
151 Ga0453684_0145970 3300044712 Bacteria 2818
152 Ga0453684_0436833 3300044712 Bacteria 1459
153 Ga0453684_0537871 3300044712 Bacteria 1289
154 Ga0453684_1151341 3300044712 Bacteria 817
155 Ga0451576_0000096 3300045051 Bacteria 221078
156 Ga0451576_0000909 3300045051 Bacteria 56035
157 Ga0451576_0044061 3300045051 Bacteria 4705
158 Ga0451576_0419975 3300045051 Bacteria 1403
159 Ga0451576_0774187 3300045051 Bacteria 1008
160 Ga0451576_0886009 3300045051 Bacteria 936
161 Ga0466967_0988843 3300045976 Bacteria 838
162 Ga0495681_0027011 3300047470 Bacteria 2977
163 Ga0496102_1529823 3300048905 Bacteria 586
164 Ga0496124_0030272 3300048927 Bacteria 4807
165 Ga0496126_0094581 3300048929 Bacteria 2622
166 Ga0501306_002779 3300049127 Bacteria 1827
167 Ga0501290_001582 3300049513 Bacteria 3072
168 Ga0501320_008553 3300049536 Bacteria 1009
169 Ga0501335_011291 3300049551 Bacteria 872
170 Ga0501337_000866 3300049553 Bacteria 1621
171 Ga0501071_0836955 3300049587 Bacteria 710
172 Ga0501209_000329 3300049656 Bacteria 5742
173 nmdc:mga0k408_78109_c2 3300050493 Bacteria 822
174 nmdc:mga08x19_141689_c1 3300050514 Bacteria 1624
175 nmdc:mga08x19_15449_c1 3300050514 Bacteria 4646
176 Ga0500595_086377 3300053119 Unclassified 913
177 Ga0500607_007545 3300053121 Bacteria 6708
178 Ga0500622_0000002 3300053156 Bacteria 646442
179 Ga0500636_0017061 3300053177 Bacteria 4282
180 Ga0500637_0015290 3300053178 Bacteria 4066
181 Ga0500625_174794 3300053729 Bacteria 764
182 Ga0587070_044780 3300059491 Bacteria 861
183 Ga0587077_036405 3300059493 Bacteria 966
184 Ga0587083_0079963 3300059505 Bacteria 777
185 Ga0587085_006077 3300059506 Bacteria 1453
186 Ga0587090_068651 3300059510 Bacteria 688
187 Ga0587109_006245 3300059624 Bacteria 1751
188 Ga0587076_020602 3300059645 Bacteria 1084
189 Ga0587100_021546 3300059648 Bacteria 632

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031344 Ga0265316_10045967 Ga0265316_100459679 88
2 3300042876 Ga0451577_0121977 Ga0451577_0121977_1013_1333 93
3 3300044712 Ga0453684_0026453 Ga0453684_0026453_5312_5632 93
4 iso_pu_bacteria 2547132103 2547375770 100
5 iso_pu_bacteria 2843690924 2843691333 100
6 iso_pu_bacteria 2894414249 2894414505 100
7 3300005440 Ga0070705_100003035 Ga0070705_1000030352 104
8 3300005444 Ga0070694_100022048 Ga0070694_1000220489 104
9 3300005536 Ga0070697_100020637 Ga0070697_1000206379 104
10 3300005545 Ga0070695_100001266 Ga0070695_10000126614 104
11 3300005546 Ga0070696_100004428 Ga0070696_10000442810 104
12 3300006914 Ga0075436_100002331 Ga0075436_10000233115 104
13 3300025915 Ga0207693_10636892 Ga0207693_106368922 104
14 3300025939 Ga0207665_10125879 Ga0207665_101258794 104
15 3300028666 Ga0265336_10000618 Ga0265336_1000061814 104
16 3300028800 Ga0265338_10117192 Ga0265338_101171922 104
17 3300029957 Ga0265324_10000002 Ga0265324_1000000277 104
18 3300029957 Ga0265324_10000500 Ga0265324_1000050032 104
19 3300031241 Ga0265325_10001662 Ga0265325_100016629 104
20 3300031344 Ga0265316_10061349 Ga0265316_100613496 104
21 3300031711 Ga0265314_10001521 Ga0265314_1000152114 104
22 3300031711 Ga0265314_10055535 Ga0265314_100555356 104
23 3300031711 Ga0265314_10121046 Ga0265314_101210461 104
24 3300050514 nmdc:mga08x19_15449_c1 nmdc:mga08x19_15449_c1_419_733 104
25 3300053119 Ga0500595_086377 Ga0500595_086377_441_761 104
26 2010549000 RicEn_FSXC22185_g1 RicEn_296650 105
27 3300003322 rootL2_10004257 rootL2_100042576 105
28 3300003775 Ga0055524_1029964 Ga0055524_10299642 105
29 3300003790 Ga0055528_1037491 Ga0055528_10374912 105
30 3300003790 Ga0055528_1038872 Ga0055528_10388722 105
31 3300003791 Ga0055530_10073925 Ga0055530_100739252 105
32 3300003792 Ga0055540_1011339 Ga0055540_10113394 105
33 3300003794 Ga0055531_10021540 Ga0055531_100215405 105
34 3300004800 Ga0058861_10032824 Ga0058861_100328243 105
35 3300005329 Ga0070683_100451111 Ga0070683_1004511111 105
36 3300005345 Ga0070692_10178216 Ga0070692_101782161 105
37 3300005441 Ga0070700_100023087 Ga0070700_1000230878 105
38 3300005458 Ga0070681_10188570 Ga0070681_101885702 105
39 3300005459 Ga0068867_100118083 Ga0068867_1001180835 105
40 3300005459 Ga0068867_100159199 Ga0068867_1001591994 105
41 3300005467 Ga0070706_100467835 Ga0070706_1004678352 105
42 3300005468 Ga0070707_100809736 Ga0070707_1008097362 105
43 3300005471 Ga0070698_100293080 Ga0070698_1002930803 105
44 3300005518 Ga0070699_100137776 Ga0070699_1001377766 105
45 3300005536 Ga0070697_101287411 Ga0070697_1012874111 105
46 3300005539 Ga0068853_101581022 Ga0068853_1015810222 105
47 3300005545 Ga0070695_101867723 Ga0070695_1018677231 105
48 3300005842 Ga0068858_101870745 Ga0068858_1018707452 105
49 3300006177 Ga0075362_10323325 Ga0075362_103233252 105
50 3300006195 Ga0075366_10026067 Ga0075366_100260678 105
51 3300006353 Ga0075370_10953567 Ga0075370_109535672 105
52 3300006914 Ga0075436_100164914 Ga0075436_1001649142 105
53 3300006944 Ga0099823_1000064 Ga0099823_100006415 105
54 3300007076 Ga0075435_100776538 Ga0075435_1007765382 105
55 3300007265 Ga0099794_10176851 Ga0099794_101768512 105
56 3300009148 Ga0105243_10341121 Ga0105243_103411212 105
57 3300009177 Ga0105248_10350820 Ga0105248_103508202 105
58 3300009545 Ga0105237_10169697 Ga0105237_101696972 105
59 3300013297 Ga0157378_11562075 Ga0157378_115620752 105
60 3300013307 Ga0157372_10180877 Ga0157372_101808772 105
61 3300014325 Ga0163163_10305665 Ga0163163_103056654 105
62 3300020075 Ga0206349_1157331 Ga0206349_11573312 105
63 3300020081 Ga0206354_10722014 Ga0206354_107220143 105
64 3300025242 Ga0209258_105352 Ga0209258_1053524 105
65 3300025298 Ga0209050_1008272 Ga0209050_10082723 105
66 3300025303 Ga0209051_1000938 Ga0209051_100093837 105
67 3300025304 Ga0209257_1019529 Ga0209257_10195295 105
68 3300025914 Ga0207671_10269801 Ga0207671_102698013 105
69 3300025922 Ga0207646_10158398 Ga0207646_101583986 105
70 3300025935 Ga0207709_11443517 Ga0207709_114435172 105
71 3300025938 Ga0207704_10115591 Ga0207704_101155913 105
72 3300026075 Ga0207708_10013450 Ga0207708_1001345013 105
73 3300026089 Ga0207648_10065486 Ga0207648_100654865 105
74 3300026089 Ga0207648_11435430 Ga0207648_114354302 105
75 3300027296 Ga0209389_1000305 Ga0209389_100030533 105
76 3300027378 Ga0209981_1039334 Ga0209981_10393342 105
77 3300031239 Ga0265328_10003225 Ga0265328_100032255 105
78 3300031241 Ga0265325_10014526 Ga0265325_100145263 105
79 3300031241 Ga0265325_10074612 Ga0265325_100746122 105
80 3300031250 Ga0265331_10002744 Ga0265331_1000274414 105
81 3300031250 Ga0265331_10195800 Ga0265331_101958001 105
82 3300031251 Ga0265327_10001331 Ga0265327_1000133116 105
83 3300031251 Ga0265327_10003591 Ga0265327_1000359118 105
84 3300031251 Ga0265327_10011983 Ga0265327_1001198310 105
85 3300031344 Ga0265316_10101308 Ga0265316_101013086 105
86 3300031616 Ga0307508_10753018 Ga0307508_107530182 105
87 3300031727 Ga0316576_10012044 Ga0316576_1001204410 105
88 3300031727 Ga0316576_10016311 Ga0316576_1001631111 105
89 3300031728 Ga0316578_10000445 Ga0316578_100004453 105
90 3300031728 Ga0316578_10001214 Ga0316578_1000121410 105
91 3300031728 Ga0316578_10088973 Ga0316578_100889735 105
92 3300031728 Ga0316578_10447130 Ga0316578_104471302 105
93 3300031733 Ga0316577_10070317 Ga0316577_100703172 105
94 3300031824 Ga0307413_10324614 Ga0307413_103246142 105
95 3300031824 Ga0307413_10395470 Ga0307413_103954702 105
96 3300032002 Ga0307416_102155250 Ga0307416_1021552502 105
97 3300032004 Ga0307414_10121151 Ga0307414_101211514 105
98 3300032004 Ga0307414_11175532 Ga0307414_111755321 105
99 3300032133 Ga0316583_10000730 Ga0316583_1000073016 105
100 3300032139 Ga0316580_10008762 Ga0316580_100087627 105
101 3300032168 Ga0316593_10000041 Ga0316593_1000004117 105
102 3300032168 Ga0316593_10000267 Ga0316593_100002677 105
103 3300032168 Ga0316593_10000658 Ga0316593_100006587 105
104 3300032168 Ga0316593_10003521 Ga0316593_100035218 105
105 3300032168 Ga0316593_10033972 Ga0316593_100339722 105
106 3300032168 Ga0316593_10058087 Ga0316593_100580871 105
107 3300032168 Ga0316593_10076354 Ga0316593_100763543 105
108 3300032168 Ga0316593_10169486 Ga0316593_101694862 105
109 3300032168 Ga0316593_10172880 Ga0316593_101728802 105
110 3300032168 Ga0316593_10285838 Ga0316593_102858382 105
111 3300033524 Ga0316592_1000041 Ga0316592_100004110 105
112 3300033524 Ga0316592_1000599 Ga0316592_100059910 105
113 3300033524 Ga0316592_1005735 Ga0316592_10057355 105
114 3300033524 Ga0316592_1091869 Ga0316592_10918692 105
115 3300033528 Ga0316588_1001345 Ga0316588_10013457 105
116 3300033529 Ga0316587_1000717 Ga0316587_10007175 105
117 3300033541 Ga0316596_1000014 Ga0316596_100001414 105
118 3300033541 Ga0316596_1000073 Ga0316596_10000738 105
119 3300033541 Ga0316596_1000650 Ga0316596_10006508 105
120 3300033541 Ga0316596_1000766 Ga0316596_100076613 105
121 3300033541 Ga0316596_1031776 Ga0316596_10317764 105
122 3300033541 Ga0316596_1061312 Ga0316596_10613123 105
123 3300033541 Ga0316596_1088215 Ga0316596_10882152 105
124 3300035112 Ga0373932_0244923 Ga0373932_0244923_212_529 105
125 3300035113 Ga0373936_0274744 Ga0373936_0274744_419_736 105
126 3300035170 Ga0373943_0664653 Ga0373943_0664653_133_450 105
127 3300035398 Ga0316574_0005612 Ga0316574_0005612_1870_2187 105
128 3300035691 Ga0373931_0399093 Ga0373931_0399093_516_833 105
129 3300035692 Ga0373935_0048532 Ga0373935_0048532_675_992 105
130 3300035695 Ga0373927_0616158 Ga0373927_0616158_17_334 105
131 3300035724 Ga0373933_0234874 Ga0373933_0234874_164_481 105
132 3300035725 Ga0373947_0082113 Ga0373947_0082113_113_430 105
133 3300036401 Ga0373937_0228383 Ga0373937_0228383_479_796 105
134 3300036401 Ga0373937_0304200 Ga0373937_0304200_32_349 105
135 3300036401 Ga0373937_0840980 Ga0373937_0840980_106_459 105
136 3300036647 Ga0316582_0099996 Ga0316582_0099996_20_337 105
137 3300036647 Ga0316582_0198826 Ga0316582_0198826_97_414 105
138 3300036647 Ga0316582_0542207 Ga0316582_0542207_230_550 105
139 3300036712 Ga0316584_0004833 Ga0316584_0004833_3220_3540 105
140 3300037068 Ga0373925_0163298 Ga0373925_0163298_384_701 105
141 3300042876 Ga0451577_0012814 Ga0451577_0012814_6067_6384 105
142 3300042876 Ga0451577_0288955 Ga0451577_0288955_577_894 105
143 3300042876 Ga0451577_0435040 Ga0451577_0435040_786_1103 105
144 3300042876 Ga0451577_0466260 Ga0451577_0466260_357_677 105
145 3300044673 Ga0453683_0003443 Ga0453683_0003443_5310_5627 105
146 3300044673 Ga0453683_0363900 Ga0453683_0363900_383_700 105
147 3300044673 Ga0453683_0708707 Ga0453683_0708707_156_473 105
148 3300044673 Ga0453683_0941179 Ga0453683_0941179_204_521 105
149 3300044694 Ga0466963_1343676 Ga0466963_1343676_21_338 105
150 3300044712 Ga0453684_0000014 Ga0453684_0000014_557292_557609 105
151 3300044712 Ga0453684_0000682 Ga0453684_0000682_114784_115101 105
152 3300044712 Ga0453684_0001268 Ga0453684_0001268_69379_69696 105
153 3300044712 Ga0453684_0003526 Ga0453684_0003526_8274_8591 105
154 3300044712 Ga0453684_0035225 Ga0453684_0035225_6527_6844 105
155 3300044712 Ga0453684_0052275 Ga0453684_0052275_4058_4375 105
156 3300044712 Ga0453684_0145970 Ga0453684_0145970_143_460 105
157 3300044712 Ga0453684_0436833 Ga0453684_0436833_1105_1422 105
158 3300044712 Ga0453684_0537871 Ga0453684_0537871_121_438 105
159 3300044712 Ga0453684_1151341 Ga0453684_1151341_291_608 105
160 3300045051 Ga0451576_0000096 Ga0451576_0000096_212488_212805 105
161 3300045051 Ga0451576_0000909 Ga0451576_0000909_49695_50012 105
162 3300045051 Ga0451576_0044061 Ga0451576_0044061_2108_2425 105
163 3300045051 Ga0451576_0419975 Ga0451576_0419975_1073_1390 105
164 3300045051 Ga0451576_0774187 Ga0451576_0774187_212_529 105
165 3300045051 Ga0451576_0886009 Ga0451576_0886009_420_737 105
166 3300045976 Ga0466967_0988843 Ga0466967_0988843_434_757 105
167 3300047470 Ga0495681_0027011 Ga0495681_0027011_186_503 105
168 3300048905 Ga0496102_1529823 Ga0496102_1529823_142_459 105
169 3300048927 Ga0496124_0030272 Ga0496124_0030272_2801_3118 105
170 3300048929 Ga0496126_0094581 Ga0496126_0094581_1295_1618 105
171 3300049127 Ga0501306_002779 Ga0501306_002779_1311_1634 105
172 3300049513 Ga0501290_001582 Ga0501290_001582_388_705 105
173 3300049536 Ga0501320_008553 Ga0501320_008553_176_499 105
174 3300049551 Ga0501335_011291 Ga0501335_011291_461_778 105
175 3300049553 Ga0501337_000866 Ga0501337_000866_1123_1446 105
176 3300049587 Ga0501071_0836955 Ga0501071_0836955_78_395 105
177 3300049656 Ga0501209_000329 Ga0501209_000329_3445_3768 105
178 3300050493 nmdc:mga0k408_78109_c2 nmdc:mga0k408_78109_c2_182_499 105
179 3300050514 nmdc:mga08x19_141689_c1 nmdc:mga08x19_141689_c1_367_684 105
180 3300053121 Ga0500607_007545 Ga0500607_007545_6303_6620 105
181 3300053156 Ga0500622_0000002 Ga0500622_0000002_5850_6167 105
182 3300053177 Ga0500636_0017061 Ga0500636_0017061_3365_3682 105
183 3300053178 Ga0500637_0015290 Ga0500637_0015290_1845_2162 105
184 3300053729 Ga0500625_174794 Ga0500625_174794_11_328 105
185 3300059491 Ga0587070_044780 Ga0587070_044780_288_605 105
186 3300059493 Ga0587077_036405 Ga0587077_036405_338_655 105
187 3300059505 Ga0587083_0079963 Ga0587083_0079963_227_544 105
188 3300059506 Ga0587085_006077 Ga0587085_006077_585_902 105
189 3300059510 Ga0587090_068651 Ga0587090_068651_195_512 105
190 3300059624 Ga0587109_006245 Ga0587109_006245_449_766 105
191 3300059645 Ga0587076_020602 Ga0587076_020602_199_516 105
192 3300059648 Ga0587100_021546 Ga0587100_021546_199_516 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

38

105

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgv-assembly1.cif.gz_t tiamulin bound to the 50s subunit 0.9505 4 103
8cam-assembly1.cif.gz_t evernimicin bound to the 50s subunit 0.9472 1 103
6vwn-assembly1.cif.gz_S 70s ribosome bound to hiv frameshifting stem-loop (fss) and p-site trna (non-rotated conformation, structure ii) 0.9457 1 103
6vwl-assembly1.cif.gz_S 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) 0.9424 4 103
7nwt-assembly1.cif.gz_U initiated 70s ribosome in complex with 2a protein from encephalomyocarditis virus (emcv) 0.9423 1 104
ID Description Score Start End Superfamily
af_Q69T55_240_282_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8935 4 36 2.30.30.30
af_C6KSP8_36_136_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8897 1 100 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8853 4 101 2.30.30.30
af_C6SX56_4_111_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.883 4 100 2.30.30.30
af_Q653V9_69_173_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8614 4 101 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A7C3GS56-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9916 1 66 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2E0ICJ6-F1-model_v4 Large ribosomal subunit protein uL24 0.9783 1 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A352Q4Q8-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9775 1 82 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2E2ZH91-F1-model_v4 Large ribosomal subunit protein uL24 0.9745 1 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E0ICJ6-F1-model_v4 Large ribosomal subunit protein uL24 0.9691 1 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
88.84 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map