F296080

General Info

Members Datasets Scaffolds Average Seq Length
192 152 384 159

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0454908|Ga0466959_0454908_271_840
Length 189
Sequence VRSGEGLRCTAGGRAGARERERELSRRPGAGGTPATQILAAAGAPYTLRAYEHDRLARDRGLPYGLEAAQALGVDPGQVFKTLLADVDGRLTVAVIPVDRTLDLKALAAAMNGKRAVLADPAAAEKATGYVVGGISPLGQRRRLPTVVDESALRWPTVLVSAGRRGLDLELAPVDLVRLTGAVTAAVAR

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
36 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
40 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
43 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
44 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
47 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
48 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
49 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
50 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
51 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
52 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
53 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
54 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
58 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
59 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
60 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
61 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
64 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
65 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
66 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
69 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
70 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
71 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
72 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
73 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
74 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
77 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
78 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
79 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
80 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
81 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
82 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
86 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
99 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
100 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
122 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
123 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
124 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
125 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
126 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
127 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
128 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
129 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
130 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
131 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
132 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
133 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
136 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
137 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
142 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
143 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
144 2849560528 Caulobacter zeae 410 Isolate Unclassified
145 2851153111 Caulobacter radicis 736 Isolate Unclassified
146 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
147 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
148 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
149 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
150 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
151 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
152 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.23
Metatranscriptomes 1.04
Isolates 5.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.81
Nodule 0
Rhizoplane 2.08
Rhizosphere 82.81
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0454908 3300045049 Bacteria 868
2 Ga0070658_11453475 3300005327 Bacteria 595
3 Ga0070683_100188719 3300005329 Bacteria 1957
4 Ga0070682_100245796 3300005337 Bacteria 1287
5 Ga0070682_100472659 3300005337 Bacteria 965
6 Ga0070661_100302130 3300005344 Bacteria 1246
7 Ga0070659_100073431 3300005366 Bacteria 2723
8 Ga0070714_101255739 3300005435 Bacteria 723
9 Ga0070710_10353483 3300005437 Bacteria 973
10 Ga0070662_100054001 3300005457 Bacteria 2911
11 Ga0068855_100795980 3300005563 Bacteria 1005
12 Ga0068852_100185191 3300005616 Bacteria 1960
13 Ga0068852_100241317 3300005616 Bacteria 1727
14 Ga0068861_100331789 3300005719 Bacteria 1328
15 Ga0068851_10284972 3300005834 Bacteria 946
16 Ga0081539_10008926 3300005985 Bacteria 8547
17 Ga0081539_10021277 3300005985 Bacteria 4340
18 Ga0075428_100016355 3300006844 Bacteria 8198
19 Ga0075428_102052352 3300006844 Bacteria 592
20 Ga0075431_100636585 3300006847 Unclassified 1048
21 Ga0111539_10023523 3300009094 Bacteria 7570
22 Ga0111539_10338997 3300009094 Bacteria 1750
23 Ga0105245_10071158 3300009098 Bacteria 3158
24 Ga0114129_10000240 3300009147 Bacteria 61395
25 Ga0114129_10881134 3300009147 Bacteria 1135
26 Ga0157371_10194054 3300013102 Bacteria 1454
27 Ga0157369_10047734 3300013105 Bacteria 4647
28 Ga0157372_10053428 3300013307 Bacteria 4503
29 Ga0206353_11415757 3300020082 Bacteria 1685
30 Ga0224712_10071743 3300022467 Bacteria 1408
31 Ga0207699_10250221 3300025906 Bacteria 1221
32 Ga0207663_10042069 3300025916 Bacteria 2790
33 Ga0207664_11097421 3300025929 Bacteria 711
34 Ga0207690_10943149 3300025932 Bacteria 717
35 Ga0207706_10426390 3300025933 Bacteria 1149
36 Ga0207661_10264200 3300025944 Bacteria 1534
37 Ga0207667_11535289 3300025949 Bacteria 636
38 Ga0207702_11064693 3300026078 Bacteria 802
39 Ga0207675_100169066 3300026118 Bacteria 2089
40 Ga0207698_10172819 3300026142 Bacteria 1905
41 Ga0207428_10161744 3300027907 Bacteria 1700
42 Ga0307511_10058889 3300030521 Bacteria 2962
43 Ga0265327_10000019 3300031251 Bacteria 427653
44 Ga0307513_10017967 3300031456 Bacteria 8467
45 Ga0307509_10248622 3300031507 Bacteria 1564
46 Ga0307408_100487264 3300031548 Bacteria 1077
47 Ga0307508_10003933 3300031616 Bacteria 14744
48 Ga0307405_10165317 3300031731 Bacteria 1572
49 Ga0307405_10259204 3300031731 Bacteria 1298
50 Ga0307407_10236695 3300031903 Bacteria 1243
51 Ga0307412_11803104 3300031911 Bacteria 563
52 Ga0307409_101111256 3300031995 Bacteria 812
53 Ga0307415_100016888 3300032126 Bacteria 4364
54 Ga0316574_0028146 3300035398 Bacteria 3388
55 Ga0395905_0208110 3300037471 Bacteria 1833
56 Ga0395901_0026328 3300038443 Bacteria 5972
57 Ga0400487_32542 3300039110 Bacteria 31777
58 Ga0451793_1334793 3300041452 Bacteria 614
59 Ga0451577_0612758 3300042876 Bacteria 988
60 Ga0466969_0290774 3300044656 Bacteria 739
61 Ga0466966_0004522 3300044684 Bacteria 9175
62 Ga0466961_0060660 3300044693 Bacteria 2405
63 Ga0453684_0007631 3300044712 Bacteria 19809
64 Ga0453684_0122385 3300044712 Bacteria 3139
65 Ga0466971_0097791 3300044719 Bacteria 1347
66 Ga0466968_0108961 3300044735 Bacteria 1244
67 Ga0466957_0139814 3300044842 Bacteria 1559
68 Ga0466957_0410898 3300044842 Bacteria 927
69 Ga0466960_0510390 3300044901 Bacteria 705
70 Ga0466958_0031707 3300045836 Bacteria 3142
71 Ga0466958_0257872 3300045836 Bacteria 1116
72 Ga0466958_0350923 3300045836 Bacteria 950
73 Ga0466967_0315861 3300045976 Bacteria 1506
74 Ga0466967_1275154 3300045976 Bacteria 732
75 Ga0495629_0014292 3300046459 Bacteria 5713
76 Ga0495585_0055448 3300046492 Bacteria 2190
77 Ga0495594_0191237 3300046499 Bacteria 1166
78 Ga0495607_0034514 3300046501 Bacteria 3068
79 Ga0495630_0075670 3300046517 Bacteria 2536
80 Ga0495632_0023292 3300046519 Bacteria 3309
81 Ga0495643_0008639 3300046522 Bacteria 6428
82 Ga0495586_0003538 3300046535 Bacteria 8371
83 Ga0495633_0007313 3300046558 Bacteria 6372
84 Ga0495656_0356414 3300046615 Bacteria 759
85 Ga0495634_0067171 3300046642 Bacteria 2372
86 Ga0495658_0038431 3300046683 Bacteria 2651
87 Ga0495613_0030994 3300046689 Bacteria 3971
88 Ga0495670_0003457 3300046691 Bacteria 7762
89 Ga0495581_0150125 3300047315 Bacteria 1361
90 Ga0495674_1101251 3300047319 Bacteria 604
91 Ga0495676_0155507 3300047321 Bacteria 1623
92 Ga0495676_0598503 3300047321 Bacteria 718
93 Ga0495687_012165 3300047443 Bacteria 4567
94 Ga0495685_000366 3300047447 Bacteria 14391
95 Ga0495681_0000244 3300047470 Bacteria 45285
96 Ga0496102_0525384 3300048905 Bacteria 1106
97 Ga0496109_0263990 3300048912 Bacteria 1622
98 Ga0496112_0036787 3300048915 Bacteria 4776
99 Ga0501031_0021874 3300049568 Bacteria 4167
100 Ga0501032_0113244 3300049569 Bacteria 1794
101 Ga0501033_0013055 3300049570 Bacteria 6332
102 Ga0501036_0026283 3300049572 Bacteria 4912
103 Ga0501036_0146628 3300049572 Bacteria 1991
104 Ga0501037_0108705 3300049573 Bacteria 1998
105 Ga0501037_0390944 3300049573 Bacteria 955
106 Ga0501038_0058111 3300049574 Bacteria 3317
107 Ga0501038_0088509 3300049574 Bacteria 2599
108 Ga0501039_0091620 3300049575 Bacteria 2369
109 Ga0501039_0406981 3300049575 Bacteria 1068
110 Ga0501039_1237239 3300049575 Bacteria 577
111 Ga0501040_0010312 3300049576 Bacteria 6110
112 Ga0501040_0523086 3300049576 Bacteria 855
113 Ga0501041_0091278 3300049577 Bacteria 1880
114 Ga0501041_0242354 3300049577 Bacteria 1133
115 Ga0501042_0002782 3300049578 Bacteria 10813
116 Ga0501042_0023669 3300049578 Bacteria 4300
117 Ga0501046_0017224 3300049580 Bacteria 6037
118 Ga0501046_0637967 3300049580 Bacteria 754
119 Ga0501048_0004669 3300049582 Bacteria 10427
120 Ga0501048_0273262 3300049582 Bacteria 1201
121 Ga0501048_0847388 3300049582 Bacteria 657
122 Ga0501067_0012207 3300049583 Bacteria 4763
123 Ga0501068_0089721 3300049584 Bacteria 1895
124 Ga0501068_0926633 3300049584 Bacteria 574
125 Ga0501069_0026464 3300049585 Bacteria 3176
126 Ga0501070_0268935 3300049586 Bacteria 1392
127 Ga0501070_0510434 3300049586 Bacteria 965
128 Ga0501071_0000767 3300049587 Bacteria 17035
129 Ga0501072_0003982 3300049588 Bacteria 11174
130 Ga0501072_0126006 3300049588 Bacteria 2041
131 Ga0501073_0022512 3300049589 Bacteria 4537
132 Ga0501073_0927972 3300049589 Bacteria 599
133 Ga0501074_0032001 3300049590 Bacteria 3812
134 Ga0501074_0439760 3300049590 Bacteria 925
135 Ga0501075_0011326 3300049591 Bacteria 6309
136 Ga0501076_0275242 3300049592 Bacteria 1379
137 Ga0501076_0621218 3300049592 Bacteria 891
138 Ga0501077_0001272 3300049593 Bacteria 15228
139 Ga0501077_0024353 3300049593 Bacteria 3843
140 Ga0501077_0210028 3300049593 Bacteria 1237
141 Ga0501079_0215339 3300049741 Bacteria 1500
142 Ga0501079_0649419 3300049741 Bacteria 830
143 Ga0501080_0003263 3300049742 Bacteria 14314
144 Ga0501081_0013344 3300049743 Bacteria 5404
145 Ga0501081_0069031 3300049743 Bacteria 2461
146 Ga0501083_0005164 3300049744 Bacteria 9237
147 Ga0501035_0015511 3300049822 Bacteria 7029
148 Ga0501045_0016554 3300049824 Bacteria 5238
149 nmdc:mga05p37_2066_c1 3300050507 Bacteria 23406
150 nmdc:mga09592_42_c1 3300050508 Bacteria 71005
151 nmdc:mga0qj67_2_c1 3300050509 Bacteria 181700
152 nmdc:mga06r32_1_c1 3300050510 Bacteria 147976
153 nmdc:mga06r32_469209_c1 3300050510 Unclassified 1237
154 nmdc:mga08y16_43070_c1 3300050511 Bacteria 4729
155 Ga0495601_0035919 3300053077 Bacteria 3095
156 Ga0495612_0009884 3300053078 Bacteria 3863
157 Ga0495619_0562772 3300053085 Bacteria 781
158 Ga0500578_0020137 3300053086 Bacteria 4286
159 Ga0500566_0062344 3300053094 Bacteria 2108
160 Ga0500654_007417 3300053099 Bacteria 7613
161 Ga0500660_073392 3300053100 Bacteria 1595
162 Ga0500560_089687 3300053107 Bacteria 1027
163 Ga0500569_000605 3300053109 Bacteria 6077
164 Ga0500614_173784 3300053123 Bacteria 657
165 Ga0500628_003600 3300053129 Bacteria 2559
166 Ga0500652_002080 3300053131 Bacteria 6015
167 Ga0500561_0003263 3300053137 Bacteria 2820
168 Ga0500579_068132 3300053143 Bacteria 2070
169 Ga0500616_0011506 3300053153 Bacteria 5217
170 Ga0500633_0014358 3300053160 Bacteria 2246
171 Ga0500656_000368 3300053732 Bacteria 3240
172 Ga0500587_004347 3300053739 Bacteria 1948
173 Ga0501084_0030953 3300054114 Bacteria 4474
174 Ga0501084_0078059 3300054114 Bacteria 2775
175 Ga0501084_0290382 3300054114 Bacteria 1381
176 Ga0501082_0038515 3300060353 Bacteria 4125
177 Ga0501082_0250814 3300060353 Bacteria 1540
178 Ga0466962_0021922 3300061719 Bacteria 3067
179 Ga0466962_0141188 3300061719 Bacteria 1167
180 Ga0530510_0060830 3300061734 Bacteria 2733
181 Ga0530510_0527205 3300061734 Bacteria 896
182 2687577701 2687453129 Bacteria 4387428
183 2768646848 2767802112 Bacteria 6465194
184 2849562896 2849560528 Bacteria 5393480
185 2851153366 2851153111 Bacteria 5542585
186 2856858780 2856858025 Bacteria 7255264
187 2862707766 2862705112 Bacteria 6563286
188 2929214254 2929212328 Bacteria 7708288
189 2990049360 2990044586 Bacteria 6603797
190 2996223795 2996221748 Bacteria 6799777
191 8008489575 8008485437 Bacteria 7198341
192 8025528849 8025524527 Bacteria 7197316
193 Ga0466959_0454908
194 Ga0070658_11453475
195 Ga0070683_100188719
196 Ga0070682_100245796
197 Ga0070682_100472659
198 Ga0070661_100302130
199 Ga0070659_100073431
200 Ga0070714_101255739
201 Ga0070710_10353483
202 Ga0070662_100054001
203 Ga0068855_100795980
204 Ga0068852_100185191
205 Ga0068852_100241317
206 Ga0068861_100331789
207 Ga0068851_10284972
208 Ga0081539_10008926
209 Ga0081539_10021277
210 Ga0075428_100016355
211 Ga0075428_102052352
212 Ga0075431_100636585
213 Ga0111539_10023523
214 Ga0111539_10338997
215 Ga0105245_10071158
216 Ga0114129_10000240
217 Ga0114129_10881134
218 Ga0157371_10194054
219 Ga0157369_10047734
220 Ga0157372_10053428
221 Ga0206353_11415757
222 Ga0224712_10071743
223 Ga0207699_10250221
224 Ga0207663_10042069
225 Ga0207664_11097421
226 Ga0207690_10943149
227 Ga0207706_10426390
228 Ga0207661_10264200
229 Ga0207667_11535289
230 Ga0207702_11064693
231 Ga0207675_100169066
232 Ga0207698_10172819
233 Ga0207428_10161744
234 Ga0307511_10058889
235 Ga0265327_10000019
236 Ga0307513_10017967
237 Ga0307509_10248622
238 Ga0307408_100487264
239 Ga0307508_10003933
240 Ga0307405_10165317
241 Ga0307405_10259204
242 Ga0307407_10236695
243 Ga0307412_11803104
244 Ga0307409_101111256
245 Ga0307415_100016888
246 Ga0316574_0028146
247 Ga0395905_0208110
248 Ga0395901_0026328
249 Ga0400487_32542
250 Ga0451793_1334793
251 Ga0451577_0612758
252 Ga0466969_0290774
253 Ga0466966_0004522
254 Ga0466961_0060660
255 Ga0453684_0007631
256 Ga0453684_0122385
257 Ga0466971_0097791
258 Ga0466968_0108961
259 Ga0466957_0139814
260 Ga0466957_0410898
261 Ga0466960_0510390
262 Ga0466958_0031707
263 Ga0466958_0257872
264 Ga0466958_0350923
265 Ga0466967_0315861
266 Ga0466967_1275154
267 Ga0495629_0014292
268 Ga0495585_0055448
269 Ga0495594_0191237
270 Ga0495607_0034514
271 Ga0495630_0075670
272 Ga0495632_0023292
273 Ga0495643_0008639
274 Ga0495586_0003538
275 Ga0495633_0007313
276 Ga0495656_0356414
277 Ga0495634_0067171
278 Ga0495658_0038431
279 Ga0495613_0030994
280 Ga0495670_0003457
281 Ga0495581_0150125
282 Ga0495674_1101251
283 Ga0495676_0155507
284 Ga0495676_0598503
285 Ga0495687_012165
286 Ga0495685_000366
287 Ga0495681_0000244
288 Ga0496102_0525384
289 Ga0496109_0263990
290 Ga0496112_0036787
291 Ga0501031_0021874
292 Ga0501032_0113244
293 Ga0501033_0013055
294 Ga0501036_0026283
295 Ga0501036_0146628
296 Ga0501037_0108705
297 Ga0501037_0390944
298 Ga0501038_0058111
299 Ga0501038_0088509
300 Ga0501039_0091620
301 Ga0501039_0406981
302 Ga0501039_1237239
303 Ga0501040_0010312
304 Ga0501040_0523086
305 Ga0501041_0091278
306 Ga0501041_0242354
307 Ga0501042_0002782
308 Ga0501042_0023669
309 Ga0501046_0017224
310 Ga0501046_0637967
311 Ga0501048_0004669
312 Ga0501048_0273262
313 Ga0501048_0847388
314 Ga0501067_0012207
315 Ga0501068_0089721
316 Ga0501068_0926633
317 Ga0501069_0026464
318 Ga0501070_0268935
319 Ga0501070_0510434
320 Ga0501071_0000767
321 Ga0501072_0003982
322 Ga0501072_0126006
323 Ga0501073_0022512
324 Ga0501073_0927972
325 Ga0501074_0032001
326 Ga0501074_0439760
327 Ga0501075_0011326
328 Ga0501076_0275242
329 Ga0501076_0621218
330 Ga0501077_0001272
331 Ga0501077_0024353
332 Ga0501077_0210028
333 Ga0501079_0215339
334 Ga0501079_0649419
335 Ga0501080_0003263
336 Ga0501081_0013344
337 Ga0501081_0069031
338 Ga0501083_0005164
339 Ga0501035_0015511
340 Ga0501045_0016554
341 nmdc:mga05p37_2066_c1
342 nmdc:mga09592_42_c1
343 nmdc:mga0qj67_2_c1
344 nmdc:mga06r32_1_c1
345 nmdc:mga06r32_469209_c1
346 nmdc:mga08y16_43070_c1
347 Ga0495601_0035919
348 Ga0495612_0009884
349 Ga0495619_0562772
350 Ga0500578_0020137
351 Ga0500566_0062344
352 Ga0500654_007417
353 Ga0500660_073392
354 Ga0500560_089687
355 Ga0500569_000605
356 Ga0500614_173784
357 Ga0500628_003600
358 Ga0500652_002080
359 Ga0500561_0003263
360 Ga0500579_068132
361 Ga0500616_0011506
362 Ga0500633_0014358
363 Ga0500656_000368
364 Ga0500587_004347
365 Ga0501084_0030953
366 Ga0501084_0078059
367 Ga0501084_0290382
368 Ga0501082_0038515
369 Ga0501082_0250814
370 Ga0466962_0021922
371 Ga0466962_0141188
372 Ga0530510_0060830
373 Ga0530510_0527205
374 2687577701
375 2768646848
376 2849562896
377 2851153366
378 2856858780
379 2862707766
380 2929214254
381 2990049360
382 2996223795
383 8008489575
384 8025528849

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

66

179

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dxa-assembly1.cif.gz_A crystal structure of trans editing enzyme prox from e.coli 0.9531 4 152
1dbx-assembly2.cif.gz_B crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) 0.9377 4 152
1dbu-assembly1.cif.gz_A crystal structure of cysteinyl-trna(pro) deacylase protein from h. influenzae (hi1434) 0.9331 4 152
2dxa-assembly1.cif.gz_A crystal structure of trans editing enzyme prox from e.coli 0.9288 4 152
1wdv-assembly2.cif.gz_B crystal structure of hypothetical protein ape2540 0.8952 4 151
ID Description Score Start End Superfamily
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9501 2 149 3.90.960.10
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9276 4 152 3.90.960.10
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9199 2 149 3.90.960.10
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9155 4 152 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8891 4 151 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A840IFR0-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.9989 4 151 GO:0002161
GO:0006412
GO:0016829
AF-A0A1A5D4F9-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.9951 4 152 GO:0002161
GO:0006412
GO:0016829
AF-A0A7Y8FRB2-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.995 4 152 GO:0002161
GO:0006412
GO:0016829
AF-A0A1H7CKI1-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase 0.9949 18 152 GO:0002161
GO:0006412
GO:0016829
AF-A0A5E6QMY9-F1-model_v4 deleted 0.9948 4 152

Map