F296080
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 192 | 152 | 384 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300045049|Ga0466959_0454908|Ga0466959_0454908_271_840 |
| Length | 189 |
| Sequence | VRSGEGLRCTAGGRAGARERERELSRRPGAGGTPATQILAAAGAPYTLRAYEHDRLARDRGLPYGLEAAQALGVDPGQVFKTLLADVDGRLTVAVIPVDRTLDLKALAAAMNGKRAVLADPAAAEKATGYVVGGISPLGQRRRLPTVVDESALRWPTVLVSAGRRGLDLELAPVDLVRLTGAVTAAVAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 11 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 12 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 13 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 14 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 16 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 17 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 18 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 20 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 21 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 22 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 23 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 24 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 25 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 36 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 37 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 38 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 39 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 40 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 41 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 42 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 43 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 44 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 45 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 46 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 47 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 48 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 49 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 50 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 51 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 52 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 53 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 54 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 55 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 56 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 57 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 58 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 59 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 60 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 61 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 62 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 63 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 84 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 85 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 86 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 87 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 88 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 89 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 90 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 91 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 92 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 93 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 94 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 95 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 96 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 97 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 98 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 99 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 100 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 101 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 102 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 103 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 104 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 106 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 107 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 108 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 116 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 117 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 119 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 120 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 124 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 125 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 126 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 127 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 128 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 129 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 130 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 131 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 132 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 133 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 134 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 135 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 136 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 137 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 138 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 141 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 142 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 143 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 144 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 145 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 146 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 147 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 148 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 149 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 150 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 151 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 152 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.23 |
| Metatranscriptomes | 1.04 |
| Isolates | 5.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.81 |
| Nodule | 0 |
| Rhizoplane | 2.08 |
| Rhizosphere | 82.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466959_0454908 | 3300045049 | Bacteria | 868 |
| 2 | Ga0070658_11453475 | 3300005327 | Bacteria | 595 |
| 3 | Ga0070683_100188719 | 3300005329 | Bacteria | 1957 |
| 4 | Ga0070682_100245796 | 3300005337 | Bacteria | 1287 |
| 5 | Ga0070682_100472659 | 3300005337 | Bacteria | 965 |
| 6 | Ga0070661_100302130 | 3300005344 | Bacteria | 1246 |
| 7 | Ga0070659_100073431 | 3300005366 | Bacteria | 2723 |
| 8 | Ga0070714_101255739 | 3300005435 | Bacteria | 723 |
| 9 | Ga0070710_10353483 | 3300005437 | Bacteria | 973 |
| 10 | Ga0070662_100054001 | 3300005457 | Bacteria | 2911 |
| 11 | Ga0068855_100795980 | 3300005563 | Bacteria | 1005 |
| 12 | Ga0068852_100185191 | 3300005616 | Bacteria | 1960 |
| 13 | Ga0068852_100241317 | 3300005616 | Bacteria | 1727 |
| 14 | Ga0068861_100331789 | 3300005719 | Bacteria | 1328 |
| 15 | Ga0068851_10284972 | 3300005834 | Bacteria | 946 |
| 16 | Ga0081539_10008926 | 3300005985 | Bacteria | 8547 |
| 17 | Ga0081539_10021277 | 3300005985 | Bacteria | 4340 |
| 18 | Ga0075428_100016355 | 3300006844 | Bacteria | 8198 |
| 19 | Ga0075428_102052352 | 3300006844 | Bacteria | 592 |
| 20 | Ga0075431_100636585 | 3300006847 | Unclassified | 1048 |
| 21 | Ga0111539_10023523 | 3300009094 | Bacteria | 7570 |
| 22 | Ga0111539_10338997 | 3300009094 | Bacteria | 1750 |
| 23 | Ga0105245_10071158 | 3300009098 | Bacteria | 3158 |
| 24 | Ga0114129_10000240 | 3300009147 | Bacteria | 61395 |
| 25 | Ga0114129_10881134 | 3300009147 | Bacteria | 1135 |
| 26 | Ga0157371_10194054 | 3300013102 | Bacteria | 1454 |
| 27 | Ga0157369_10047734 | 3300013105 | Bacteria | 4647 |
| 28 | Ga0157372_10053428 | 3300013307 | Bacteria | 4503 |
| 29 | Ga0206353_11415757 | 3300020082 | Bacteria | 1685 |
| 30 | Ga0224712_10071743 | 3300022467 | Bacteria | 1408 |
| 31 | Ga0207699_10250221 | 3300025906 | Bacteria | 1221 |
| 32 | Ga0207663_10042069 | 3300025916 | Bacteria | 2790 |
| 33 | Ga0207664_11097421 | 3300025929 | Bacteria | 711 |
| 34 | Ga0207690_10943149 | 3300025932 | Bacteria | 717 |
| 35 | Ga0207706_10426390 | 3300025933 | Bacteria | 1149 |
| 36 | Ga0207661_10264200 | 3300025944 | Bacteria | 1534 |
| 37 | Ga0207667_11535289 | 3300025949 | Bacteria | 636 |
| 38 | Ga0207702_11064693 | 3300026078 | Bacteria | 802 |
| 39 | Ga0207675_100169066 | 3300026118 | Bacteria | 2089 |
| 40 | Ga0207698_10172819 | 3300026142 | Bacteria | 1905 |
| 41 | Ga0207428_10161744 | 3300027907 | Bacteria | 1700 |
| 42 | Ga0307511_10058889 | 3300030521 | Bacteria | 2962 |
| 43 | Ga0265327_10000019 | 3300031251 | Bacteria | 427653 |
| 44 | Ga0307513_10017967 | 3300031456 | Bacteria | 8467 |
| 45 | Ga0307509_10248622 | 3300031507 | Bacteria | 1564 |
| 46 | Ga0307408_100487264 | 3300031548 | Bacteria | 1077 |
| 47 | Ga0307508_10003933 | 3300031616 | Bacteria | 14744 |
| 48 | Ga0307405_10165317 | 3300031731 | Bacteria | 1572 |
| 49 | Ga0307405_10259204 | 3300031731 | Bacteria | 1298 |
| 50 | Ga0307407_10236695 | 3300031903 | Bacteria | 1243 |
| 51 | Ga0307412_11803104 | 3300031911 | Bacteria | 563 |
| 52 | Ga0307409_101111256 | 3300031995 | Bacteria | 812 |
| 53 | Ga0307415_100016888 | 3300032126 | Bacteria | 4364 |
| 54 | Ga0316574_0028146 | 3300035398 | Bacteria | 3388 |
| 55 | Ga0395905_0208110 | 3300037471 | Bacteria | 1833 |
| 56 | Ga0395901_0026328 | 3300038443 | Bacteria | 5972 |
| 57 | Ga0400487_32542 | 3300039110 | Bacteria | 31777 |
| 58 | Ga0451793_1334793 | 3300041452 | Bacteria | 614 |
| 59 | Ga0451577_0612758 | 3300042876 | Bacteria | 988 |
| 60 | Ga0466969_0290774 | 3300044656 | Bacteria | 739 |
| 61 | Ga0466966_0004522 | 3300044684 | Bacteria | 9175 |
| 62 | Ga0466961_0060660 | 3300044693 | Bacteria | 2405 |
| 63 | Ga0453684_0007631 | 3300044712 | Bacteria | 19809 |
| 64 | Ga0453684_0122385 | 3300044712 | Bacteria | 3139 |
| 65 | Ga0466971_0097791 | 3300044719 | Bacteria | 1347 |
| 66 | Ga0466968_0108961 | 3300044735 | Bacteria | 1244 |
| 67 | Ga0466957_0139814 | 3300044842 | Bacteria | 1559 |
| 68 | Ga0466957_0410898 | 3300044842 | Bacteria | 927 |
| 69 | Ga0466960_0510390 | 3300044901 | Bacteria | 705 |
| 70 | Ga0466958_0031707 | 3300045836 | Bacteria | 3142 |
| 71 | Ga0466958_0257872 | 3300045836 | Bacteria | 1116 |
| 72 | Ga0466958_0350923 | 3300045836 | Bacteria | 950 |
| 73 | Ga0466967_0315861 | 3300045976 | Bacteria | 1506 |
| 74 | Ga0466967_1275154 | 3300045976 | Bacteria | 732 |
| 75 | Ga0495629_0014292 | 3300046459 | Bacteria | 5713 |
| 76 | Ga0495585_0055448 | 3300046492 | Bacteria | 2190 |
| 77 | Ga0495594_0191237 | 3300046499 | Bacteria | 1166 |
| 78 | Ga0495607_0034514 | 3300046501 | Bacteria | 3068 |
| 79 | Ga0495630_0075670 | 3300046517 | Bacteria | 2536 |
| 80 | Ga0495632_0023292 | 3300046519 | Bacteria | 3309 |
| 81 | Ga0495643_0008639 | 3300046522 | Bacteria | 6428 |
| 82 | Ga0495586_0003538 | 3300046535 | Bacteria | 8371 |
| 83 | Ga0495633_0007313 | 3300046558 | Bacteria | 6372 |
| 84 | Ga0495656_0356414 | 3300046615 | Bacteria | 759 |
| 85 | Ga0495634_0067171 | 3300046642 | Bacteria | 2372 |
| 86 | Ga0495658_0038431 | 3300046683 | Bacteria | 2651 |
| 87 | Ga0495613_0030994 | 3300046689 | Bacteria | 3971 |
| 88 | Ga0495670_0003457 | 3300046691 | Bacteria | 7762 |
| 89 | Ga0495581_0150125 | 3300047315 | Bacteria | 1361 |
| 90 | Ga0495674_1101251 | 3300047319 | Bacteria | 604 |
| 91 | Ga0495676_0155507 | 3300047321 | Bacteria | 1623 |
| 92 | Ga0495676_0598503 | 3300047321 | Bacteria | 718 |
| 93 | Ga0495687_012165 | 3300047443 | Bacteria | 4567 |
| 94 | Ga0495685_000366 | 3300047447 | Bacteria | 14391 |
| 95 | Ga0495681_0000244 | 3300047470 | Bacteria | 45285 |
| 96 | Ga0496102_0525384 | 3300048905 | Bacteria | 1106 |
| 97 | Ga0496109_0263990 | 3300048912 | Bacteria | 1622 |
| 98 | Ga0496112_0036787 | 3300048915 | Bacteria | 4776 |
| 99 | Ga0501031_0021874 | 3300049568 | Bacteria | 4167 |
| 100 | Ga0501032_0113244 | 3300049569 | Bacteria | 1794 |
| 101 | Ga0501033_0013055 | 3300049570 | Bacteria | 6332 |
| 102 | Ga0501036_0026283 | 3300049572 | Bacteria | 4912 |
| 103 | Ga0501036_0146628 | 3300049572 | Bacteria | 1991 |
| 104 | Ga0501037_0108705 | 3300049573 | Bacteria | 1998 |
| 105 | Ga0501037_0390944 | 3300049573 | Bacteria | 955 |
| 106 | Ga0501038_0058111 | 3300049574 | Bacteria | 3317 |
| 107 | Ga0501038_0088509 | 3300049574 | Bacteria | 2599 |
| 108 | Ga0501039_0091620 | 3300049575 | Bacteria | 2369 |
| 109 | Ga0501039_0406981 | 3300049575 | Bacteria | 1068 |
| 110 | Ga0501039_1237239 | 3300049575 | Bacteria | 577 |
| 111 | Ga0501040_0010312 | 3300049576 | Bacteria | 6110 |
| 112 | Ga0501040_0523086 | 3300049576 | Bacteria | 855 |
| 113 | Ga0501041_0091278 | 3300049577 | Bacteria | 1880 |
| 114 | Ga0501041_0242354 | 3300049577 | Bacteria | 1133 |
| 115 | Ga0501042_0002782 | 3300049578 | Bacteria | 10813 |
| 116 | Ga0501042_0023669 | 3300049578 | Bacteria | 4300 |
| 117 | Ga0501046_0017224 | 3300049580 | Bacteria | 6037 |
| 118 | Ga0501046_0637967 | 3300049580 | Bacteria | 754 |
| 119 | Ga0501048_0004669 | 3300049582 | Bacteria | 10427 |
| 120 | Ga0501048_0273262 | 3300049582 | Bacteria | 1201 |
| 121 | Ga0501048_0847388 | 3300049582 | Bacteria | 657 |
| 122 | Ga0501067_0012207 | 3300049583 | Bacteria | 4763 |
| 123 | Ga0501068_0089721 | 3300049584 | Bacteria | 1895 |
| 124 | Ga0501068_0926633 | 3300049584 | Bacteria | 574 |
| 125 | Ga0501069_0026464 | 3300049585 | Bacteria | 3176 |
| 126 | Ga0501070_0268935 | 3300049586 | Bacteria | 1392 |
| 127 | Ga0501070_0510434 | 3300049586 | Bacteria | 965 |
| 128 | Ga0501071_0000767 | 3300049587 | Bacteria | 17035 |
| 129 | Ga0501072_0003982 | 3300049588 | Bacteria | 11174 |
| 130 | Ga0501072_0126006 | 3300049588 | Bacteria | 2041 |
| 131 | Ga0501073_0022512 | 3300049589 | Bacteria | 4537 |
| 132 | Ga0501073_0927972 | 3300049589 | Bacteria | 599 |
| 133 | Ga0501074_0032001 | 3300049590 | Bacteria | 3812 |
| 134 | Ga0501074_0439760 | 3300049590 | Bacteria | 925 |
| 135 | Ga0501075_0011326 | 3300049591 | Bacteria | 6309 |
| 136 | Ga0501076_0275242 | 3300049592 | Bacteria | 1379 |
| 137 | Ga0501076_0621218 | 3300049592 | Bacteria | 891 |
| 138 | Ga0501077_0001272 | 3300049593 | Bacteria | 15228 |
| 139 | Ga0501077_0024353 | 3300049593 | Bacteria | 3843 |
| 140 | Ga0501077_0210028 | 3300049593 | Bacteria | 1237 |
| 141 | Ga0501079_0215339 | 3300049741 | Bacteria | 1500 |
| 142 | Ga0501079_0649419 | 3300049741 | Bacteria | 830 |
| 143 | Ga0501080_0003263 | 3300049742 | Bacteria | 14314 |
| 144 | Ga0501081_0013344 | 3300049743 | Bacteria | 5404 |
| 145 | Ga0501081_0069031 | 3300049743 | Bacteria | 2461 |
| 146 | Ga0501083_0005164 | 3300049744 | Bacteria | 9237 |
| 147 | Ga0501035_0015511 | 3300049822 | Bacteria | 7029 |
| 148 | Ga0501045_0016554 | 3300049824 | Bacteria | 5238 |
| 149 | nmdc:mga05p37_2066_c1 | 3300050507 | Bacteria | 23406 |
| 150 | nmdc:mga09592_42_c1 | 3300050508 | Bacteria | 71005 |
| 151 | nmdc:mga0qj67_2_c1 | 3300050509 | Bacteria | 181700 |
| 152 | nmdc:mga06r32_1_c1 | 3300050510 | Bacteria | 147976 |
| 153 | nmdc:mga06r32_469209_c1 | 3300050510 | Unclassified | 1237 |
| 154 | nmdc:mga08y16_43070_c1 | 3300050511 | Bacteria | 4729 |
| 155 | Ga0495601_0035919 | 3300053077 | Bacteria | 3095 |
| 156 | Ga0495612_0009884 | 3300053078 | Bacteria | 3863 |
| 157 | Ga0495619_0562772 | 3300053085 | Bacteria | 781 |
| 158 | Ga0500578_0020137 | 3300053086 | Bacteria | 4286 |
| 159 | Ga0500566_0062344 | 3300053094 | Bacteria | 2108 |
| 160 | Ga0500654_007417 | 3300053099 | Bacteria | 7613 |
| 161 | Ga0500660_073392 | 3300053100 | Bacteria | 1595 |
| 162 | Ga0500560_089687 | 3300053107 | Bacteria | 1027 |
| 163 | Ga0500569_000605 | 3300053109 | Bacteria | 6077 |
| 164 | Ga0500614_173784 | 3300053123 | Bacteria | 657 |
| 165 | Ga0500628_003600 | 3300053129 | Bacteria | 2559 |
| 166 | Ga0500652_002080 | 3300053131 | Bacteria | 6015 |
| 167 | Ga0500561_0003263 | 3300053137 | Bacteria | 2820 |
| 168 | Ga0500579_068132 | 3300053143 | Bacteria | 2070 |
| 169 | Ga0500616_0011506 | 3300053153 | Bacteria | 5217 |
| 170 | Ga0500633_0014358 | 3300053160 | Bacteria | 2246 |
| 171 | Ga0500656_000368 | 3300053732 | Bacteria | 3240 |
| 172 | Ga0500587_004347 | 3300053739 | Bacteria | 1948 |
| 173 | Ga0501084_0030953 | 3300054114 | Bacteria | 4474 |
| 174 | Ga0501084_0078059 | 3300054114 | Bacteria | 2775 |
| 175 | Ga0501084_0290382 | 3300054114 | Bacteria | 1381 |
| 176 | Ga0501082_0038515 | 3300060353 | Bacteria | 4125 |
| 177 | Ga0501082_0250814 | 3300060353 | Bacteria | 1540 |
| 178 | Ga0466962_0021922 | 3300061719 | Bacteria | 3067 |
| 179 | Ga0466962_0141188 | 3300061719 | Bacteria | 1167 |
| 180 | Ga0530510_0060830 | 3300061734 | Bacteria | 2733 |
| 181 | Ga0530510_0527205 | 3300061734 | Bacteria | 896 |
| 182 | 2687577701 | 2687453129 | Bacteria | 4387428 |
| 183 | 2768646848 | 2767802112 | Bacteria | 6465194 |
| 184 | 2849562896 | 2849560528 | Bacteria | 5393480 |
| 185 | 2851153366 | 2851153111 | Bacteria | 5542585 |
| 186 | 2856858780 | 2856858025 | Bacteria | 7255264 |
| 187 | 2862707766 | 2862705112 | Bacteria | 6563286 |
| 188 | 2929214254 | 2929212328 | Bacteria | 7708288 |
| 189 | 2990049360 | 2990044586 | Bacteria | 6603797 |
| 190 | 2996223795 | 2996221748 | Bacteria | 6799777 |
| 191 | 8008489575 | 8008485437 | Bacteria | 7198341 |
| 192 | 8025528849 | 8025524527 | Bacteria | 7197316 |
| 193 | Ga0466959_0454908 | |||
| 194 | Ga0070658_11453475 | |||
| 195 | Ga0070683_100188719 | |||
| 196 | Ga0070682_100245796 | |||
| 197 | Ga0070682_100472659 | |||
| 198 | Ga0070661_100302130 | |||
| 199 | Ga0070659_100073431 | |||
| 200 | Ga0070714_101255739 | |||
| 201 | Ga0070710_10353483 | |||
| 202 | Ga0070662_100054001 | |||
| 203 | Ga0068855_100795980 | |||
| 204 | Ga0068852_100185191 | |||
| 205 | Ga0068852_100241317 | |||
| 206 | Ga0068861_100331789 | |||
| 207 | Ga0068851_10284972 | |||
| 208 | Ga0081539_10008926 | |||
| 209 | Ga0081539_10021277 | |||
| 210 | Ga0075428_100016355 | |||
| 211 | Ga0075428_102052352 | |||
| 212 | Ga0075431_100636585 | |||
| 213 | Ga0111539_10023523 | |||
| 214 | Ga0111539_10338997 | |||
| 215 | Ga0105245_10071158 | |||
| 216 | Ga0114129_10000240 | |||
| 217 | Ga0114129_10881134 | |||
| 218 | Ga0157371_10194054 | |||
| 219 | Ga0157369_10047734 | |||
| 220 | Ga0157372_10053428 | |||
| 221 | Ga0206353_11415757 | |||
| 222 | Ga0224712_10071743 | |||
| 223 | Ga0207699_10250221 | |||
| 224 | Ga0207663_10042069 | |||
| 225 | Ga0207664_11097421 | |||
| 226 | Ga0207690_10943149 | |||
| 227 | Ga0207706_10426390 | |||
| 228 | Ga0207661_10264200 | |||
| 229 | Ga0207667_11535289 | |||
| 230 | Ga0207702_11064693 | |||
| 231 | Ga0207675_100169066 | |||
| 232 | Ga0207698_10172819 | |||
| 233 | Ga0207428_10161744 | |||
| 234 | Ga0307511_10058889 | |||
| 235 | Ga0265327_10000019 | |||
| 236 | Ga0307513_10017967 | |||
| 237 | Ga0307509_10248622 | |||
| 238 | Ga0307408_100487264 | |||
| 239 | Ga0307508_10003933 | |||
| 240 | Ga0307405_10165317 | |||
| 241 | Ga0307405_10259204 | |||
| 242 | Ga0307407_10236695 | |||
| 243 | Ga0307412_11803104 | |||
| 244 | Ga0307409_101111256 | |||
| 245 | Ga0307415_100016888 | |||
| 246 | Ga0316574_0028146 | |||
| 247 | Ga0395905_0208110 | |||
| 248 | Ga0395901_0026328 | |||
| 249 | Ga0400487_32542 | |||
| 250 | Ga0451793_1334793 | |||
| 251 | Ga0451577_0612758 | |||
| 252 | Ga0466969_0290774 | |||
| 253 | Ga0466966_0004522 | |||
| 254 | Ga0466961_0060660 | |||
| 255 | Ga0453684_0007631 | |||
| 256 | Ga0453684_0122385 | |||
| 257 | Ga0466971_0097791 | |||
| 258 | Ga0466968_0108961 | |||
| 259 | Ga0466957_0139814 | |||
| 260 | Ga0466957_0410898 | |||
| 261 | Ga0466960_0510390 | |||
| 262 | Ga0466958_0031707 | |||
| 263 | Ga0466958_0257872 | |||
| 264 | Ga0466958_0350923 | |||
| 265 | Ga0466967_0315861 | |||
| 266 | Ga0466967_1275154 | |||
| 267 | Ga0495629_0014292 | |||
| 268 | Ga0495585_0055448 | |||
| 269 | Ga0495594_0191237 | |||
| 270 | Ga0495607_0034514 | |||
| 271 | Ga0495630_0075670 | |||
| 272 | Ga0495632_0023292 | |||
| 273 | Ga0495643_0008639 | |||
| 274 | Ga0495586_0003538 | |||
| 275 | Ga0495633_0007313 | |||
| 276 | Ga0495656_0356414 | |||
| 277 | Ga0495634_0067171 | |||
| 278 | Ga0495658_0038431 | |||
| 279 | Ga0495613_0030994 | |||
| 280 | Ga0495670_0003457 | |||
| 281 | Ga0495581_0150125 | |||
| 282 | Ga0495674_1101251 | |||
| 283 | Ga0495676_0155507 | |||
| 284 | Ga0495676_0598503 | |||
| 285 | Ga0495687_012165 | |||
| 286 | Ga0495685_000366 | |||
| 287 | Ga0495681_0000244 | |||
| 288 | Ga0496102_0525384 | |||
| 289 | Ga0496109_0263990 | |||
| 290 | Ga0496112_0036787 | |||
| 291 | Ga0501031_0021874 | |||
| 292 | Ga0501032_0113244 | |||
| 293 | Ga0501033_0013055 | |||
| 294 | Ga0501036_0026283 | |||
| 295 | Ga0501036_0146628 | |||
| 296 | Ga0501037_0108705 | |||
| 297 | Ga0501037_0390944 | |||
| 298 | Ga0501038_0058111 | |||
| 299 | Ga0501038_0088509 | |||
| 300 | Ga0501039_0091620 | |||
| 301 | Ga0501039_0406981 | |||
| 302 | Ga0501039_1237239 | |||
| 303 | Ga0501040_0010312 | |||
| 304 | Ga0501040_0523086 | |||
| 305 | Ga0501041_0091278 | |||
| 306 | Ga0501041_0242354 | |||
| 307 | Ga0501042_0002782 | |||
| 308 | Ga0501042_0023669 | |||
| 309 | Ga0501046_0017224 | |||
| 310 | Ga0501046_0637967 | |||
| 311 | Ga0501048_0004669 | |||
| 312 | Ga0501048_0273262 | |||
| 313 | Ga0501048_0847388 | |||
| 314 | Ga0501067_0012207 | |||
| 315 | Ga0501068_0089721 | |||
| 316 | Ga0501068_0926633 | |||
| 317 | Ga0501069_0026464 | |||
| 318 | Ga0501070_0268935 | |||
| 319 | Ga0501070_0510434 | |||
| 320 | Ga0501071_0000767 | |||
| 321 | Ga0501072_0003982 | |||
| 322 | Ga0501072_0126006 | |||
| 323 | Ga0501073_0022512 | |||
| 324 | Ga0501073_0927972 | |||
| 325 | Ga0501074_0032001 | |||
| 326 | Ga0501074_0439760 | |||
| 327 | Ga0501075_0011326 | |||
| 328 | Ga0501076_0275242 | |||
| 329 | Ga0501076_0621218 | |||
| 330 | Ga0501077_0001272 | |||
| 331 | Ga0501077_0024353 | |||
| 332 | Ga0501077_0210028 | |||
| 333 | Ga0501079_0215339 | |||
| 334 | Ga0501079_0649419 | |||
| 335 | Ga0501080_0003263 | |||
| 336 | Ga0501081_0013344 | |||
| 337 | Ga0501081_0069031 | |||
| 338 | Ga0501083_0005164 | |||
| 339 | Ga0501035_0015511 | |||
| 340 | Ga0501045_0016554 | |||
| 341 | nmdc:mga05p37_2066_c1 | |||
| 342 | nmdc:mga09592_42_c1 | |||
| 343 | nmdc:mga0qj67_2_c1 | |||
| 344 | nmdc:mga06r32_1_c1 | |||
| 345 | nmdc:mga06r32_469209_c1 | |||
| 346 | nmdc:mga08y16_43070_c1 | |||
| 347 | Ga0495601_0035919 | |||
| 348 | Ga0495612_0009884 | |||
| 349 | Ga0495619_0562772 | |||
| 350 | Ga0500578_0020137 | |||
| 351 | Ga0500566_0062344 | |||
| 352 | Ga0500654_007417 | |||
| 353 | Ga0500660_073392 | |||
| 354 | Ga0500560_089687 | |||
| 355 | Ga0500569_000605 | |||
| 356 | Ga0500614_173784 | |||
| 357 | Ga0500628_003600 | |||
| 358 | Ga0500652_002080 | |||
| 359 | Ga0500561_0003263 | |||
| 360 | Ga0500579_068132 | |||
| 361 | Ga0500616_0011506 | |||
| 362 | Ga0500633_0014358 | |||
| 363 | Ga0500656_000368 | |||
| 364 | Ga0500587_004347 | |||
| 365 | Ga0501084_0030953 | |||
| 366 | Ga0501084_0078059 | |||
| 367 | Ga0501084_0290382 | |||
| 368 | Ga0501082_0038515 | |||
| 369 | Ga0501082_0250814 | |||
| 370 | Ga0466962_0021922 | |||
| 371 | Ga0466962_0141188 | |||
| 372 | Ga0530510_0060830 | |||
| 373 | Ga0530510_0527205 | |||
| 374 | 2687577701 | |||
| 375 | 2768646848 | |||
| 376 | 2849562896 | |||
| 377 | 2851153366 | |||
| 378 | 2856858780 | |||
| 379 | 2862707766 | |||
| 380 | 2929214254 | |||
| 381 | 2990049360 | |||
| 382 | 2996223795 | |||
| 383 | 8008489575 | |||
| 384 | 8025528849 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dxa-assembly1.cif.gz_A | crystal structure of trans editing enzyme prox from e.coli | 0.9531 | 4 | 152 |
| 1dbx-assembly2.cif.gz_B | crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) | 0.9377 | 4 | 152 |
| 1dbu-assembly1.cif.gz_A | crystal structure of cysteinyl-trna(pro) deacylase protein from h. influenzae (hi1434) | 0.9331 | 4 | 152 |
| 2dxa-assembly1.cif.gz_A | crystal structure of trans editing enzyme prox from e.coli | 0.9288 | 4 | 152 |
| 1wdv-assembly2.cif.gz_B | crystal structure of hypothetical protein ape2540 | 0.8952 | 4 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0A0_1_158_3.90.960.10 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.9501 | 2 | 149 | 3.90.960.10 |
| 1dbxB00 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.9276 | 4 | 152 | 3.90.960.10 |
| af_Q2G0A0_1_158_3.90.960.10 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.9199 | 2 | 149 | 3.90.960.10 |
| 1dbxB00 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.9155 | 4 | 152 | 3.90.960.10 |
| 1wdvB00 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.8891 | 4 | 151 | 3.90.960.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A840IFR0-F1-model_v4 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) | 0.9989 | 4 | 151 |
GO:0002161
GO:0006412 GO:0016829 |
| AF-A0A1A5D4F9-F1-model_v4 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) | 0.9951 | 4 | 152 |
GO:0002161
GO:0006412 GO:0016829 |
| AF-A0A7Y8FRB2-F1-model_v4 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) | 0.995 | 4 | 152 |
GO:0002161
GO:0006412 GO:0016829 |
| AF-A0A1H7CKI1-F1-model_v4 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase | 0.9949 | 18 | 152 |
GO:0002161
GO:0006412 GO:0016829 |
| AF-A0A5E6QMY9-F1-model_v4 | deleted | 0.9948 | 4 | 152 |
|