F294585

General Info

Members Datasets Scaffolds Average Seq Length
191 146 185 364

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0003446|Ga0495636_0003446_2338_3597
Length 419
Sequence LEHCAGEKATQRLRVTPILAASMPSRQTAMNASTSADTAAAFPASADLDQRAVPCILMRGGTSRGPFFLASDLPADQLGRDRVLLAAMGSPDPRQIDGLGGAHPLTSKVGIVAAGVAGEYDLEFQFAQLQPDSNTVDTTPNCGNMLAAVVPFALETGLLAPRGDTTRARVLTRNTGMVCDITVATPGGRPRYAGDARIDGVPGTAAAIVIDFLDTAGSVCAALLPTGRVRDTLDIRDANGATITVNATLIDNGMPMVLLRAADLGRSGYEDVASLNDDAPLKATLEALRTAAGHKMGLGDVSSKSYPKMCLIAAPQTGGAITTRCFIPHVCHAAIGVLAAVTVGTACVLPGTVADGIARLDSNGPVHTVSIEHPSGEFTVEIETDPERPGTIARSALVRTARPIMRGEVLIPAAAWPAN

Samples

Sample ID Description Type Environment
1 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
4 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
5 2885266251 Ralstonia sp. SET104 Isolate Nodule
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
30 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
37 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
53 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
56 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
62 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
72 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
73 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
80 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
81 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
82 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
83 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
84 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
85 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
86 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
87 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
88 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
89 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
90 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
91 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
92 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
93 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
94 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
97 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
98 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
99 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
107 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
108 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
109 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
114 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
115 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
116 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
126 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
139 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
140 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
141 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
146 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 0
Isolates 3.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.66
Nodule 2.09
Rhizoplane 1.05
Rhizosphere 73.82
Stem 0
Stem Tuber 0
Unclassified 8.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000545 3300003187 Bacteria 34695
2 JGI25151J46595_10033445 3300003187 Bacteria 1981
3 Ga0055526_1000336 3300003771 Bacteria 38625
4 Ga0055526_1004371 3300003771 Bacteria 8524
5 Ga0055526_1008553 3300003771 Bacteria 5079
6 Ga0055537_1001197 3300003773 Bacteria 11019
7 Ga0055524_1001729 3300003775 Bacteria 12127
8 Ga0055534_1000341 3300003784 Bacteria 30179
9 Ga0055534_1000777 3300003784 Bacteria 14972
10 Ga0070676_10002014 3300005328 Bacteria 10326
11 Ga0070682_100006781 3300005337 Bacteria 6425
12 Ga0070660_100129557 3300005339 Bacteria 2018
13 Ga0070671_100080519 3300005355 Bacteria 2723
14 Ga0070667_100104801 3300005367 Bacteria 2447
15 Ga0070709_10050013 3300005434 Bacteria 2616
16 Ga0070711_100150877 3300005439 Bacteria 1752
17 Ga0070678_100088192 3300005456 Bacteria 2371
18 Ga0068867_100001878 3300005459 Bacteria 14605
19 Ga0070707_100144493 3300005468 Bacteria 2315
20 Ga0070672_100008902 3300005543 Bacteria 6896
21 Ga0068857_100039009 3300005577 Bacteria 4206
22 Ga0068852_100108964 3300005616 Bacteria 2514
23 Ga0097621_100043645 3300006237 Bacteria 3615
24 Ga0068871_100142794 3300006358 Bacteria 2037
25 Ga0075428_100014031 3300006844 Bacteria 8916
26 Ga0075431_100005130 3300006847 Bacteria 12882
27 Ga0075429_100020934 3300006880 Bacteria 5674
28 Ga0099826_10000011 3300006948 Bacteria 287659
29 Ga0099795_10010768 3300007788 Bacteria 2707
30 Ga0114129_10029501 3300009147 Bacteria 7770
31 Ga0105248_10140392 3300009177 Bacteria 2725
32 Ga0099796_10000730 3300010159 Bacteria 5856
33 Ga0157375_10034886 3300013308 Bacteria 4796
34 Ga0157379_10241155 3300014968 Bacteria 1640
35 Ga0213872_10000001 3300021361 Bacteria 662532
36 Ga0209565_1000086 3300025263 Bacteria 152204
37 Ga0209565_1007495 3300025263 Bacteria 2937
38 Ga0209675_1000510 3300025291 Bacteria 28831
39 Ga0209675_1001661 3300025291 Bacteria 12382
40 Ga0209675_1001762 3300025291 Bacteria 11860
41 Ga0209025_1000059 3300025294 Bacteria 305480
42 Ga0209025_1000550 3300025294 Bacteria 70073
43 Ga0209564_1000814 3300025295 Bacteria 42501
44 Ga0209564_1001766 3300025295 Bacteria 20140
45 Ga0209564_1002095 3300025295 Bacteria 17070
46 Ga0209758_1011560 3300025297 Bacteria 5089
47 Ga0209256_1000086 3300025299 Bacteria 218837
48 Ga0209256_1003909 3300025299 Bacteria 9850
49 Ga0209051_1021034 3300025303 Bacteria 2791
50 Ga0207645_10003433 3300025907 Bacteria 12042
51 Ga0207657_10180930 3300025919 Bacteria 1704
52 Ga0207690_10118796 3300025932 Bacteria 1917
53 Ga0207691_10050504 3300025940 Bacteria 3807
54 Ga0207689_10004241 3300025942 Bacteria 13040
55 Ga0207648_10000984 3300026089 Bacteria 32138
56 Ga0207674_10017659 3300026116 Bacteria 7778
57 Ga0207674_10142129 3300026116 Bacteria 2359
58 Ga0207683_10096487 3300026121 Bacteria 2636
59 Ga0209282_1000050 3300027666 Bacteria 109312
60 Ga0265336_10000003 3300028666 Bacteria 423158
61 Ga0307515_10203096 3300028794 Bacteria 1851
62 Ga0265324_10000224 3300029957 Bacteria 43527
63 Ga0265332_10008821 3300031238 Bacteria 4514
64 Ga0265332_10032768 3300031238 Bacteria 2263
65 Ga0265327_10059657 3300031251 Bacteria 1953
66 Ga0265316_10051355 3300031344 Bacteria 3239
67 Ga0307513_10118949 3300031456 Bacteria 2615
68 Ga0307408_100054869 3300031548 Bacteria 2883
69 Ga0307508_10011607 3300031616 Bacteria 8050
70 Ga0307516_10003526 3300031730 Bacteria 20030
71 Ga0307516_10124920 3300031730 Bacteria 2359
72 Ga0307405_10008218 3300031731 Bacteria 5278
73 Ga0307409_100004113 3300031995 Bacteria 8101
74 Ga0307416_100010080 3300032002 Bacteria 6224
75 Ga0373931_0017208 3300035691 Bacteria 3571
76 Ga0316582_0038338 3300036647 Bacteria 2978
77 Ga0373925_0102897 3300037068 Bacteria 2198
78 Ga0395898_0230384 3300037466 Bacteria 1767
79 Ga0395905_0001095 3300037471 Bacteria 34067
80 Ga0395905_0002007 3300037471 Bacteria 23235
81 Ga0395905_0013595 3300037471 Bacteria 7797
82 Ga0400490_43931 3300038726 Bacteria 87826
83 Ga0400487_34027 3300039110 Bacteria 1367
84 Ga0400487_42799 3300039110 Bacteria 62577
85 Ga0400487_44343 3300039110 Bacteria 4179
86 Ga0436361_0028664 3300039447 Bacteria 69721
87 Ga0436361_0513880 3300039447 Bacteria 3241
88 Ga0436361_1008280 3300039447 Bacteria 1964
89 Ga0451577_0010994 3300042876 Bacteria 8596
90 Ga0453684_0000583 3300044712 Bacteria 135940
91 Ga0453684_0003874 3300044712 Bacteria 32937
92 Ga0451576_0000137 3300045051 Bacteria 185212
93 Ga0495590_0000003 3300046457 Bacteria 478593
94 Ga0495638_0001152 3300046460 Bacteria 25467
95 Ga0495638_0121572 3300046460 Bacteria 1542
96 Ga0495605_0001167 3300046474 Bacteria 17440
97 Ga0495605_0004053 3300046474 Bacteria 8646
98 Ga0495584_0000173 3300046491 Bacteria 45316
99 Ga0495584_0002177 3300046491 Bacteria 11176
100 Ga0495585_0004296 3300046492 Bacteria 9275
101 Ga0495594_0002705 3300046499 Bacteria 9199
102 Ga0495596_0000127 3300046500 Bacteria 52593
103 Ga0495596_0000355 3300046500 Bacteria 29677
104 Ga0495596_0000604 3300046500 Bacteria 22532
105 Ga0495596_0030223 3300046500 Bacteria 2169
106 Ga0495607_0010849 3300046501 Bacteria 6095
107 Ga0495607_0014372 3300046501 Bacteria 5157
108 Ga0495583_0007163 3300046506 Bacteria 7093
109 Ga0495583_0057202 3300046506 Bacteria 1755
110 Ga0495606_0007183 3300046507 Bacteria 10051
111 Ga0495610_0000395 3300046512 Bacteria 45218
112 Ga0495616_0000643 3300046513 Bacteria 26050
113 Ga0495631_0015092 3300046518 Bacteria 3711
114 Ga0495632_0017507 3300046519 Bacteria 3953
115 Ga0495643_0025217 3300046522 Bacteria 3366
116 Ga0495644_0000119 3300046523 Bacteria 37559
117 Ga0495644_0015669 3300046523 Bacteria 2906
118 Ga0495648_0000070 3300046524 Bacteria 136680
119 Ga0495642_0051397 3300046528 Bacteria 1695
120 Ga0495609_0002530 3300046538 Bacteria 11212
121 Ga0495609_0005007 3300046538 Bacteria 7088
122 Ga0495597_0000560 3300046542 Bacteria 30875
123 Ga0495597_0000911 3300046542 Bacteria 22921
124 Ga0495597_0024676 3300046542 Bacteria 2773
125 Ga0495622_0105940 3300046557 Bacteria 1288
126 Ga0495633_0003117 3300046558 Bacteria 11237
127 Ga0495656_0016209 3300046615 Bacteria 2825
128 Ga0495656_0040958 3300046615 Bacteria 1933
129 Ga0495668_0001435 3300046616 Bacteria 23071
130 Ga0495668_0002062 3300046616 Bacteria 17425
131 Ga0495668_0042735 3300046616 Bacteria 2522
132 Ga0495611_0001188 3300046648 Bacteria 13508
133 Ga0495611_0013006 3300046648 Bacteria 3539
134 Ga0495625_0051989 3300046660 Bacteria 2935
135 Ga0495625_0068081 3300046660 Bacteria 2503
136 Ga0495661_0001634 3300046665 Bacteria 18297
137 Ga0495661_0012256 3300046665 Bacteria 5790
138 Ga0495661_0113901 3300046665 Bacteria 1503
139 Ga0495669_0007195 3300046684 Bacteria 4664
140 Ga0495670_0000053 3300046691 Bacteria 60401
141 Ga0495671_0000239 3300046692 Bacteria 47493
142 Ga0495649_0033613 3300046694 Bacteria 2822
143 Ga0495589_0025675 3300046794 Bacteria 2989
144 Ga0495660_0037056 3300046810 Bacteria 2717
145 Ga0495636_0003446 3300047318 Bacteria 6139
146 Ga0495672_0000125 3300047320 Bacteria 118271
147 Ga0495672_0003194 3300047320 Bacteria 14247
148 Ga0495672_0005289 3300047320 Bacteria 10274
149 Ga0495676_0041794 3300047321 Bacteria 3770
150 Ga0495677_0025794 3300047445 Bacteria 2132
151 Ga0495685_006973 3300047447 Bacteria 3717
152 Ga0495673_0000008 3300047469 Bacteria 752462
153 Ga0495681_0072428 3300047470 Bacteria 1558
154 Ga0495686_0000407 3300047472 Bacteria 68110
155 Ga0495686_0100749 3300047472 Bacteria 1742
156 Ga0495626_0021192 3300048091 Bacteria 3228
157 Ga0496102_0001846 3300048905 Bacteria 18270
158 Ga0496114_0152850 3300048917 Bacteria 2002
159 Ga0496121_0008508 3300048924 Bacteria 12041
160 Ga0496122_0004024 3300048925 Bacteria 18691
161 Ga0496123_0001605 3300048926 Bacteria 30644
162 Ga0496125_0057809 3300048928 Bacteria 3138
163 Ga0495678_003261 3300049459 Bacteria 10144
164 Ga0495682_0010722 3300049460 Bacteria 3540
165 Ga0501042_0138807 3300049578 Bacteria 1752
166 Ga0501068_0003737 3300049584 Bacteria 8233
167 Ga0501070_0020021 3300049586 Bacteria 5610
168 Ga0501070_0169311 3300049586 Bacteria 1800
169 Ga0501071_0002889 3300049587 Bacteria 10595
170 Ga0501071_0312299 3300049587 Bacteria 1193
171 Ga0501073_0000559 3300049589 Bacteria 26196
172 Ga0501074_0000380 3300049590 Bacteria 26299
173 Ga0501079_0000390 3300049741 Bacteria 28259
174 Ga0501080_0010289 3300049742 Bacteria 8552
175 Ga0501083_0043223 3300049744 Bacteria 3053
176 nmdc:mga05p37_33643_c1 3300050507 Bacteria 6278
177 nmdc:mga09592_60142_c1 3300050508 Bacteria 3212
178 Ga0500646_0003514 3300053090 Bacteria 4016
179 Ga0500566_0022560 3300053094 Bacteria 3698
180 Ga0500597_018512 3300053120 Bacteria 2703
181 Ga0500614_004211 3300053123 Bacteria 3053
182 Ga0500616_0055385 3300053153 Bacteria 2074
183 Ga0501084_0022430 3300054114 Bacteria 5268
184 Ga0501082_0057133 3300060353 Bacteria 3362
185 Ga0530510_0083986 3300061734 Bacteria 2319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053153 Ga0500616_0055385 Ga0500616_0055385_1090_2028 312
2 3300049586 Ga0501070_0020021 Ga0501070_0020021_1743_2798 314
3 3300006237 Ga0097621_100043645 Ga0097621_1000436453 318
4 3300031238 Ga0265332_10008821 Ga0265332_100088212 326
5 3300007788 Ga0099795_10010768 Ga0099795_100107683 338
6 3300046523 Ga0495644_0015669 Ga0495644_0015669_1808_2869 341
7 3300006358 Ga0068871_100142794 Ga0068871_1001427942 343
8 3300006948 Ga0099826_10000011 Ga0099826_10000011176 347
9 3300027666 Ga0209282_1000050 Ga0209282_100005010 347
10 3300046474 Ga0495605_0004053 Ga0495605_0004053_3063_4211 347
11 3300046500 Ga0495596_0000127 Ga0495596_0000127_43893_45041 347
12 3300046501 Ga0495607_0010849 Ga0495607_0010849_4262_5410 347
13 3300046512 Ga0495610_0000395 Ga0495610_0000395_35799_36947 347
14 3300046538 Ga0495609_0005007 Ga0495609_0005007_4401_5549 347
15 3300046615 Ga0495656_0040958 Ga0495656_0040958_624_1772 347
16 3300046665 Ga0495661_0001634 Ga0495661_0001634_9205_10353 347
17 3300046692 Ga0495671_0000239 Ga0495671_0000239_37039_38187 347
18 3300046694 Ga0495649_0033613 Ga0495649_0033613_1278_2426 347
19 3300047320 Ga0495672_0005289 Ga0495672_0005289_2811_3959 347
20 3300047447 Ga0495685_006973 Ga0495685_006973_353_1501 347
21 3300048924 Ga0496121_0008508 Ga0496121_0008508_8312_9460 347
22 3300048925 Ga0496122_0004024 Ga0496122_0004024_9448_10596 347
23 3300048926 Ga0496123_0001605 Ga0496123_0001605_21483_22631 347
24 3300048928 Ga0496125_0057809 Ga0496125_0057809_545_1693 347
25 3300049586 Ga0501070_0169311 Ga0501070_0169311_512_1621 347
26 3300046557 Ga0495622_0105940 Ga0495622_0105940_71_1189 348
27 3300021361 Ga0213872_10000001 Ga0213872_10000001210 350
28 3300031548 Ga0307408_100054869 Ga0307408_1000548694 350
29 3300031731 Ga0307405_10008218 Ga0307405_100082185 350
30 3300031995 Ga0307409_100004113 Ga0307409_1000041136 350
31 3300032002 Ga0307416_100010080 Ga0307416_1000100802 350
32 3300046500 Ga0495596_0000355 Ga0495596_0000355_26881_27969 350
33 3300046684 Ga0495669_0007195 Ga0495669_0007195_228_1316 350
34 3300049578 Ga0501042_0138807 Ga0501042_0138807_264_1319 350
35 3300049584 Ga0501068_0003737 Ga0501068_0003737_1960_3015 350
36 3300049587 Ga0501071_0002889 Ga0501071_0002889_7377_8432 350
37 3300049589 Ga0501073_0000559 Ga0501073_0000559_17057_18112 350
38 3300049590 Ga0501074_0000380 Ga0501074_0000380_19876_20931 350
39 3300049741 Ga0501079_0000390 Ga0501079_0000390_5543_6598 350
40 3300049742 Ga0501080_0010289 Ga0501080_0010289_2013_3068 350
41 3300049744 Ga0501083_0043223 Ga0501083_0043223_1898_2953 350
42 3300054114 Ga0501084_0022430 Ga0501084_0022430_1928_2983 350
43 3300060353 Ga0501082_0057133 Ga0501082_0057133_2150_3205 350
44 3300061734 Ga0530510_0083986 Ga0530510_0083986_210_1265 350
45 3300005339 Ga0070660_100129557 Ga0070660_1001295572 351
46 3300005616 Ga0068852_100108964 Ga0068852_1001089642 351
47 3300025919 Ga0207657_10180930 Ga0207657_101809302 351
48 3300025932 Ga0207690_10118796 Ga0207690_101187962 351
49 3300036647 Ga0316582_0038338 Ga0316582_0038338_1222_2310 351
50 3300039110 Ga0400487_42799 Ga0400487_42799_22143_23207 351
51 3300046460 Ga0495638_0001152 Ga0495638_0001152_22694_23752 351
52 3300046474 Ga0495605_0001167 Ga0495605_0001167_16165_17223 351
53 3300046491 Ga0495584_0002177 Ga0495584_0002177_8656_9714 351
54 3300046500 Ga0495596_0000604 Ga0495596_0000604_17943_19001 351
55 3300046500 Ga0495596_0030223 Ga0495596_0030223_246_1307 351
56 3300046506 Ga0495583_0007163 Ga0495583_0007163_2398_3456 351
57 3300046518 Ga0495631_0015092 Ga0495631_0015092_2321_3382 351
58 3300046519 Ga0495632_0017507 Ga0495632_0017507_23_1084 351
59 3300046522 Ga0495643_0025217 Ga0495643_0025217_1619_2677 351
60 3300046538 Ga0495609_0002530 Ga0495609_0002530_8143_9201 351
61 3300046542 Ga0495597_0000911 Ga0495597_0000911_2468_3526 351
62 3300046542 Ga0495597_0024676 Ga0495597_0024676_1643_2704 351
63 3300046616 Ga0495668_0002062 Ga0495668_0002062_14275_15333 351
64 3300046665 Ga0495661_0012256 Ga0495661_0012256_3158_4216 351
65 3300046665 Ga0495661_0113901 Ga0495661_0113901_153_1214 351
66 3300047470 Ga0495681_0072428 Ga0495681_0072428_267_1328 351
67 3300048091 Ga0495626_0021192 Ga0495626_0021192_1975_3036 351
68 3300010159 Ga0099796_10000730 Ga0099796_100007304 355
69 3300046460 Ga0495638_0121572 Ga0495638_0121572_292_1371 356
70 iso_pu_bacteria 2574179768 2574433009 356
71 iso_pu_bacteria 639633007 639787699 356
72 3300047469 Ga0495673_0000008 Ga0495673_0000008_430445_431584 357
73 iso_pu_bacteria 2643221627 2644157324 357
74 3300005337 Ga0070682_100006781 Ga0070682_1000067816 358
75 3300031456 Ga0307513_10118949 Ga0307513_101189493 359
76 3300039110 Ga0400487_34027 Ga0400487_34027_158_1249 359
77 3300039447 Ga0436361_0028664 Ga0436361_0028664_63493_64572 359
78 3300047472 Ga0495686_0000407 Ga0495686_0000407_64677_65756 359
79 3300047472 Ga0495686_0100749 Ga0495686_0100749_300_1379 359
80 3300048905 Ga0496102_0001846 Ga0496102_0001846_378_1469 359
81 3300026116 Ga0207674_10142129 Ga0207674_101421292 360
82 3300031251 Ga0265327_10059657 Ga0265327_100596572 360
83 3300031344 Ga0265316_10051355 Ga0265316_100513553 360
84 3300037068 Ga0373925_0102897 Ga0373925_0102897_1073_2161 360
85 3300037471 Ga0395905_0001095 Ga0395905_0001095_22141_23226 360
86 3300038726 Ga0400490_43931 Ga0400490_43931_33456_34541 360
87 3300044712 Ga0453684_0000583 Ga0453684_0000583_133055_134140 360
88 3300044712 Ga0453684_0003874 Ga0453684_0003874_27436_28530 360
89 3300045051 Ga0451576_0000137 Ga0451576_0000137_1801_2886 360
90 3300046457 Ga0495590_0000003 Ga0495590_0000003_111189_112283 360
91 3300046501 Ga0495607_0014372 Ga0495607_0014372_2204_3289 360
92 3300046524 Ga0495648_0000070 Ga0495648_0000070_66286_67380 360
93 3300046528 Ga0495642_0051397 Ga0495642_0051397_260_1354 360
94 3300046558 Ga0495633_0003117 Ga0495633_0003117_355_1443 360
95 3300046615 Ga0495656_0016209 Ga0495656_0016209_722_1807 360
96 3300046616 Ga0495668_0001435 Ga0495668_0001435_8611_9705 360
97 3300046616 Ga0495668_0042735 Ga0495668_0042735_1101_2189 360
98 3300046660 Ga0495625_0051989 Ga0495625_0051989_203_1291 360
99 3300046660 Ga0495625_0068081 Ga0495625_0068081_659_1744 360
100 3300046794 Ga0495589_0025675 Ga0495589_0025675_1011_2099 360
101 3300046810 Ga0495660_0037056 Ga0495660_0037056_108_1202 360
102 3300049459 Ga0495678_003261 Ga0495678_003261_5812_6906 360
103 3300049460 Ga0495682_0010722 Ga0495682_0010722_358_1446 360
104 3300049587 Ga0501071_0312299 Ga0501071_0312299_61_1170 361
105 iso_pu_bacteria 2721755763 2723879022 361
106 3300025291 Ga0209675_1001762 Ga0209675_10017629 362
107 3300039447 Ga0436361_0513880 Ga0436361_0513880_90_1190 362
108 3300046523 Ga0495644_0000119 Ga0495644_0000119_11098_12189 362
109 3300046648 Ga0495611_0001188 Ga0495611_0001188_917_2008 362
110 3300046648 Ga0495611_0013006 Ga0495611_0013006_2169_3260 362
111 3300047320 Ga0495672_0003194 Ga0495672_0003194_5891_6982 362
112 3300047445 Ga0495677_0025794 Ga0495677_0025794_368_1459 362
113 3300031238 Ga0265332_10032768 Ga0265332_100327683 363
114 3300039110 Ga0400487_44343 Ga0400487_44343_2712_3809 363
115 3300005468 Ga0070707_100144493 Ga0070707_1001444932 365
116 3300009177 Ga0105248_10140392 Ga0105248_101403922 365
117 3300046499 Ga0495594_0002705 Ga0495594_0002705_4155_5279 365
118 3300053090 Ga0500646_0003514 Ga0500646_0003514_2321_3436 365
119 3300053120 Ga0500597_018512 Ga0500597_018512_976_2097 365
120 3300053123 Ga0500614_004211 Ga0500614_004211_190_1323 365
121 3300005434 Ga0070709_10050013 Ga0070709_100500133 367
122 3300005439 Ga0070711_100150877 Ga0070711_1001508771 367
123 3300005328 Ga0070676_10002014 Ga0070676_100020148 369
124 3300005355 Ga0070671_100080519 Ga0070671_1000805192 369
125 3300005367 Ga0070667_100104801 Ga0070667_1001048012 369
126 3300005456 Ga0070678_100088192 Ga0070678_1000881922 369
127 3300005459 Ga0068867_100001878 Ga0068867_10000187811 369
128 3300005543 Ga0070672_100008902 Ga0070672_1000089029 369
129 3300005577 Ga0068857_100039009 Ga0068857_1000390092 369
130 3300006844 Ga0075428_100014031 Ga0075428_1000140316 369
131 3300006847 Ga0075431_100005130 Ga0075431_1000051306 369
132 3300006880 Ga0075429_100020934 Ga0075429_1000209346 369
133 3300009147 Ga0114129_10029501 Ga0114129_100295014 369
134 3300013308 Ga0157375_10034886 Ga0157375_100348865 369
135 3300025907 Ga0207645_10003433 Ga0207645_100034338 369
136 3300025940 Ga0207691_10050504 Ga0207691_100505044 369
137 3300025942 Ga0207689_10004241 Ga0207689_100042415 369
138 3300026089 Ga0207648_10000984 Ga0207648_1000098429 369
139 3300026116 Ga0207674_10017659 Ga0207674_100176592 369
140 3300026121 Ga0207683_10096487 Ga0207683_100964873 369
141 3300035691 Ga0373931_0017208 Ga0373931_0017208_1168_2277 369
142 3300046542 Ga0495597_0000560 Ga0495597_0000560_27606_28724 369
143 3300050507 nmdc:mga05p37_33643_c1 nmdc:mga05p37_33643_c1_2797_3915 369
144 3300050508 nmdc:mga09592_60142_c1 nmdc:mga09592_60142_c1_97_1215 369
145 3300028666 Ga0265336_10000003 Ga0265336_1000000348 370
146 3300028794 Ga0307515_10203096 Ga0307515_102030962 370
147 3300029957 Ga0265324_10000224 Ga0265324_100002242 370
148 3300031730 Ga0307516_10003526 Ga0307516_100035266 370
149 3300039447 Ga0436361_1008280 Ga0436361_1008280_42_1166 370
150 3300048917 Ga0496114_0152850 Ga0496114_0152850_669_1793 371
151 3300053094 Ga0500566_0022560 Ga0500566_0022560_329_1492 372
152 iso_pu_bacteria 2513237165 2514042724 373
153 iso_pu_bacteria 2885266251 2885267958 373
154 3300031616 Ga0307508_10011607 Ga0307508_100116074 374
155 3300031730 Ga0307516_10124920 Ga0307516_101249203 374
156 3300014968 Ga0157379_10241155 Ga0157379_102411552 375
157 3300037466 Ga0395898_0230384 Ga0395898_0230384_59_1186 375
158 3300046506 Ga0495583_0057202 Ga0495583_0057202_375_1502 375
159 3300047320 Ga0495672_0000125 Ga0495672_0000125_59133_60260 375
160 3300037471 Ga0395905_0013595 Ga0395905_0013595_4109_5272 376
161 3300042876 Ga0451577_0010994 Ga0451577_0010994_1500_2651 376
162 3300046507 Ga0495606_0007183 Ga0495606_0007183_8678_9814 376
163 3300047321 Ga0495676_0041794 Ga0495676_0041794_2121_3254 376
164 3300003187 JGI25151J46595_10033445 JGI25151J46595_100334452 377
165 3300003771 Ga0055526_1000336 Ga0055526_100033616 377
166 3300003771 Ga0055526_1004371 Ga0055526_10043714 377
167 3300003775 Ga0055524_1001729 Ga0055524_10017294 377
168 3300003784 Ga0055534_1000341 Ga0055534_100034113 377
169 3300025263 Ga0209565_1007495 Ga0209565_10074953 377
170 3300025291 Ga0209675_1000510 Ga0209675_100051014 377
171 3300025294 Ga0209025_1000550 Ga0209025_100055047 377
172 3300025295 Ga0209564_1000814 Ga0209564_100081423 377
173 3300025295 Ga0209564_1002095 Ga0209564_10020955 377
174 3300025299 Ga0209256_1000086 Ga0209256_1000086101 377
175 3300025303 Ga0209051_1021034 Ga0209051_10210342 377
176 3300037471 Ga0395905_0002007 Ga0395905_0002007_1467_2600 377
177 3300046491 Ga0495584_0000173 Ga0495584_0000173_5104_6249 378
178 3300046492 Ga0495585_0004296 Ga0495585_0004296_858_2003 378
179 3300046513 Ga0495616_0000643 Ga0495616_0000643_24021_25166 378
180 3300046691 Ga0495670_0000053 Ga0495670_0000053_28588_29733 378
181 3300047318 Ga0495636_0003446 Ga0495636_0003446_2338_3597 383
182 3300003187 JGI25151J46595_10000545 JGI25151J46595_1000054515 384
183 3300003771 Ga0055526_1008553 Ga0055526_10085532 384
184 3300003773 Ga0055537_1001197 Ga0055537_10011973 384
185 3300003784 Ga0055534_1000777 Ga0055534_100077710 384
186 3300025263 Ga0209565_1000086 Ga0209565_1000086111 384
187 3300025291 Ga0209675_1001661 Ga0209675_10016613 384
188 3300025294 Ga0209025_1000059 Ga0209025_1000059176 384
189 3300025295 Ga0209564_1001766 Ga0209564_10017664 384
190 3300025297 Ga0209758_1011560 Ga0209758_10115604 384
191 3300025299 Ga0209256_1003909 Ga0209256_10039094 384

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04303

PrpF

PrpF protein

50

412

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6otv-assembly1.cif.gz_A crystal structure of putative isomerase ec2056 0.9372 17 378
6otv-assembly1.cif.gz_A crystal structure of putative isomerase ec2056 0.9321 17 378
6p3j-assembly1.cif.gz_A crystal structure of ligu 0.9256 18 377
6p3j-assembly1.cif.gz_B crystal structure of ligu 0.9249 10 378
6p3k-assembly2.cif.gz_B crystal structure of ligu(c100s) 0.9182 18 377
ID Description Score Start End Superfamily
3g7kB01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9332 14 185 3.10.310.10
af_P0AAV8_1_178_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9326 17 192 3.10.310.10
af_P0AAV8_1_178_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9174 17 192 3.10.310.10
2pvzA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.916 16 180 3.10.310.10
af_P0AAV8_179_330_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9055 194 356 3.10.310.10
ID Description Score Start End GO Terms
AF-K9NK90-F1-model_v4 deleted 0.9922 221 295
AF-A0A538QCS5-F1-model_v4 4-oxalomesaconate tautomerase (EC 5.3.2.8) 0.9769 17 345 GO:0016853
AF-A0A2M8Q6N3-F1-model_v4 4-oxalomesaconate tautomerase 0.9765 191 320 GO:0016853
AF-A0A3S4JUN3-F1-model_v4 PrpF protein 0.9737 212 303 GO:0016853
AF-A0A2M8Q6N3-F1-model_v4 4-oxalomesaconate tautomerase 0.9685 191 320 GO:0016853

Feature Viewer

pLDDT pTM Quality
89.52 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map