F294285

General Info

Members Datasets Scaffolds Average Seq Length
191 136 188 148

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101069750|Ga0307416_1010697502
Length 169
Sequence MEGDRDLAERVGAAMWEADAASRNTMGMELVSCEPGRAVLRMAVREQHLNGHLICHGGFIFTLADSTFAFACNSHNKVTVAAGASIEFLRPGQLGDVLTCEGVEQTLAGRHGIYDMKVTNQRGEVVALFRGKSTSIQGTVVAAGPPQGNESPLGGQRSAGADNPQEPEA

Samples

Sample ID Description Type Environment
1 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
2 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
3 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
4 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
41 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
60 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
63 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
64 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
82 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
83 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
84 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
85 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
86 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
87 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
88 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
89 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
90 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
91 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
92 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
93 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
94 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
122 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
123 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
124 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
125 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
129 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
130 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
131 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 0
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.75
Nodule 0
Rhizoplane 2.09
Rhizosphere 79.06
Stem 0
Stem Tuber 0
Unclassified 2.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26138J51218_101116 3300003504 Bacteria 1027
2 Ga0055540_1007713 3300003792 Bacteria 4007
3 Ga0055531_10000452 3300003794 Bacteria 38120
4 Ga0070658_10800498 3300005327 Bacteria 819
5 Ga0070658_11244764 3300005327 Bacteria 647
6 Ga0070658_11905152 3300005327 Unclassified 513
7 Ga0070677_10885539 3300005333 Bacteria 515
8 Ga0070680_100462452 3300005336 Bacteria 1084
9 Ga0070714_100126645 3300005435 Bacteria 2278
10 Ga0068867_101073205 3300005459 Bacteria 734
11 Ga0070679_100155101 3300005530 Bacteria 2265
12 Ga0070679_101514765 3300005530 Bacteria 618
13 Ga0068853_100112731 3300005539 Bacteria 2417
14 Ga0068855_100061470 3300005563 Bacteria 4389
15 Ga0068855_100116141 3300005563 Bacteria 3067
16 Ga0068855_100506826 3300005563 Bacteria 1311
17 Ga0068856_100226545 3300005614 Bacteria 1885
18 Ga0068856_100942364 3300005614 Bacteria 882
19 Ga0068852_100959604 3300005616 Bacteria 873
20 Ga0068859_100179314 3300005617 Bacteria 2201
21 Ga0068861_101895240 3300005719 Bacteria 593
22 Ga0075365_10164891 3300006038 Bacteria 1545
23 Ga0075365_10180339 3300006038 Bacteria 1476
24 Ga0075368_10460925 3300006042 Bacteria 564
25 Ga0075363_100194001 3300006048 Bacteria 1159
26 Ga0075362_10079757 3300006177 Bacteria 1507
27 Ga0075367_10058300 3300006178 Bacteria 2297
28 Ga0075366_10064255 3300006195 Bacteria 2183
29 Ga0075366_10660105 3300006195 Bacteria 649
30 Ga0075370_10202967 3300006353 Bacteria 1170
31 Ga0068871_101843253 3300006358 Bacteria 575
32 Ga0097620_100179308 3300006931 Bacteria 2201
33 Ga0105240_10015617 3300009093 Bacteria 10312
34 Ga0105245_10038507 3300009098 Bacteria 4254
35 Ga0105245_12587370 3300009098 Bacteria 561
36 Ga0105241_10627174 3300009174 Bacteria 974
37 Ga0105242_10739315 3300009176 Bacteria 967
38 Ga0105238_10440290 3300009551 Bacteria 1299
39 Ga0105239_10494523 3300010375 Bacteria 1390
40 Ga0105239_12205405 3300010375 Bacteria 640
41 Ga0157378_10999664 3300013297 Bacteria 871
42 Ga0163162_13292082 3300013306 Bacteria 517
43 Ga0157380_11193484 3300014326 Bacteria 804
44 Ga0157376_10012936 3300014969 Bacteria 6212
45 Ga0209673_1007609 3300025273 Bacteria 4951
46 Ga0209673_1021286 3300025273 Bacteria 2273
47 Ga0209130_1039958 3300025284 Bacteria 911
48 Ga0209758_1015192 3300025297 Bacteria 4013
49 Ga0209051_1000114 3300025303 Bacteria 152303
50 Ga0209257_1000015 3300025304 Bacteria 908141
51 Ga0207705_10864561 3300025909 Bacteria 701
52 Ga0207707_10196178 3300025912 Bacteria 1761
53 Ga0207695_10068733 3300025913 Bacteria 3629
54 Ga0207657_10031330 3300025919 Bacteria 4818
55 Ga0207652_10269046 3300025921 Bacteria 1537
56 Ga0207694_10497557 3300025924 Bacteria 1020
57 Ga0207687_10045479 3300025927 Bacteria 3034
58 Ga0207664_10121718 3300025929 Bacteria 2185
59 Ga0207644_11822430 3300025931 Bacteria 509
60 Ga0207690_11013752 3300025932 Bacteria 691
61 Ga0207667_10078059 3300025949 Bacteria 3433
62 Ga0207667_10254465 3300025949 Bacteria 1796
63 Ga0207677_10010744 3300026023 Bacteria 5190
64 Ga0207639_10128232 3300026041 Bacteria 2096
65 Ga0207702_10720517 3300026078 Bacteria 984
66 Ga0209968_1025467 3300027526 Bacteria 974
67 Ga0209970_1000026 3300027614 Bacteria 19518
68 Ga0209813_10371216 3300027866 Bacteria 571
69 Ga0209974_10010577 3300027876 Bacteria 3113
70 Ga0307515_10149053 3300028794 Bacteria 2457
71 Ga0265332_10003009 3300031238 Bacteria 8269
72 Ga0265328_10156287 3300031239 Bacteria 859
73 Ga0265329_10056107 3300031242 Bacteria 1249
74 Ga0265340_10052221 3300031247 Bacteria 1978
75 Ga0265316_10056195 3300031344 Bacteria 3076
76 Ga0307513_10000008 3300031456 Bacteria 442128
77 Ga0307408_100248702 3300031548 Bacteria 1465
78 Ga0307408_100716883 3300031548 Bacteria 900
79 Ga0265314_10008127 3300031711 Bacteria 9029
80 Ga0265314_10009447 3300031711 Bacteria 8225
81 Ga0265342_10027415 3300031712 Bacteria 3561
82 Ga0307516_10036692 3300031730 Bacteria 4905
83 Ga0307406_11961107 3300031901 Bacteria 523
84 Ga0307416_101069750 3300032002 Bacteria 911
85 Ga0307411_10324350 3300032005 Bacteria 1245
86 Ga0307415_101687317 3300032126 Bacteria 611
87 Ga0395899_0010475 3300037312 Bacteria 7100
88 Ga0395899_0016053 3300037312 Bacteria 5709
89 Ga0395899_0219720 3300037312 Bacteria 1317
90 Ga0395900_0043581 3300037418 Bacteria 4624
91 Ga0395900_0064545 3300037418 Bacteria 3762
92 Ga0395900_0115138 3300037418 Bacteria 2759
93 Ga0395900_0153865 3300037418 Bacteria 2349
94 Ga0395900_0206899 3300037418 Bacteria 1983
95 Ga0395900_0433017 3300037418 Bacteria 1274
96 Ga0395900_1026988 3300037418 Bacteria 744
97 Ga0395898_0019368 3300037466 Bacteria 6927
98 Ga0395898_0026798 3300037466 Bacteria 5793
99 Ga0395898_0051820 3300037466 Bacteria 4011
100 Ga0395898_0403706 3300037466 Bacteria 1303
101 Ga0395898_1017355 3300037466 Bacteria 764
102 Ga0395905_0000090 3300037471 Bacteria 152117
103 Ga0395905_0011798 3300037471 Bacteria 8437
104 Ga0395905_0052436 3300037471 Bacteria 3818
105 Ga0395905_0053522 3300037471 Bacteria 3777
106 Ga0395905_0074747 3300037471 Bacteria 3176
107 Ga0395905_0079305 3300037471 Bacteria 3077
108 Ga0395905_0115310 3300037471 Bacteria 2524
109 Ga0395905_0126015 3300037471 Bacteria 2408
110 Ga0395905_0318614 3300037471 Bacteria 1444
111 Ga0395905_0334216 3300037471 Bacteria 1406
112 Ga0395901_0030636 3300038443 Bacteria 5543
113 Ga0395901_0035979 3300038443 Bacteria 5116
114 Ga0395901_0187736 3300038443 Bacteria 2168
115 Ga0395901_0673312 3300038443 Bacteria 1035
116 Ga0395901_1831701 3300038443 Bacteria 555
117 Ga0439453_0006550 3300041408 Bacteria 1817
118 Ga0451802_1469911 3300041460 Bacteria 525
119 Ga0451807_2384992 3300041486 Bacteria 753
120 Ga0439437_039691 3300042000 Bacteria 608
121 Ga0439432_087190 3300042006 Bacteria 941
122 Ga0439449_0000682 3300042007 Bacteria 12925
123 Ga0439457_056224 3300042014 Bacteria 887
124 Ga0450911_007002 3300042115 Bacteria 1656
125 Ga0450894_083498 3300042131 Bacteria 500
126 Ga0450896_045674 3300042133 Bacteria 690
127 Ga0450898_014500 3300042134 Bacteria 1325
128 Ga0450909_006724 3300042185 Bacteria 1657
129 Ga0439434_0147830 3300042435 Bacteria 777
130 Ga0450893_0007359 3300042532 Bacteria 1788
131 Ga0450893_0009249 3300042532 Bacteria 1609
132 Ga0466969_0009330 3300044656 Bacteria 5200
133 Ga0466969_0371110 3300044656 Bacteria 648
134 Ga0466972_0054269 3300044658 Bacteria 1928
135 Ga0466965_0289314 3300044683 Bacteria 887
136 Ga0466966_0003044 3300044684 Bacteria 11068
137 Ga0466961_0111070 3300044693 Bacteria 1725
138 Ga0466961_0170970 3300044693 Bacteria 1351
139 Ga0466964_0449308 3300044706 Bacteria 683
140 Ga0466964_0720042 3300044706 Bacteria 558
141 Ga0453684_0329384 3300044712 Bacteria 1727
142 Ga0466968_0553301 3300044735 Bacteria 577
143 Ga0466970_0142544 3300044765 Bacteria 1320
144 Ga0466957_0112328 3300044842 Bacteria 1729
145 Ga0466957_0507960 3300044842 Bacteria 836
146 Ga0466957_1215411 3300044842 Bacteria 545
147 Ga0466960_0278805 3300044901 Bacteria 936
148 Ga0466959_0022497 3300045049 Bacteria 4661
149 Ga0466959_0396896 3300045049 Bacteria 938
150 Ga0466959_0492631 3300045049 Bacteria 829
151 Ga0451576_0136332 3300045051 Bacteria 2560
152 Ga0451576_1985220 3300045051 Bacteria 599
153 Ga0496109_0601494 3300048912 Bacteria 1036
154 Ga0496114_0476401 3300048917 Bacteria 1104
155 Ga0501032_0272747 3300049569 Bacteria 1096
156 Ga0501033_0605069 3300049570 Bacteria 751
157 Ga0501034_0244573 3300049571 Bacteria 1739
158 Ga0501036_0198473 3300049572 Bacteria 1688
159 Ga0501039_0441507 3300049575 Bacteria 1022
160 Ga0501043_0127344 3300049579 Bacteria 1997
161 Ga0501043_1197422 3300049579 Bacteria 533
162 Ga0501047_0073259 3300049581 Bacteria 3297
163 Ga0501047_0259263 3300049581 Bacteria 1587
164 Ga0501068_0236309 3300049584 Bacteria 1163
165 Ga0501080_0063192 3300049742 Bacteria 3446
166 Ga0501080_1585835 3300049742 Bacteria 555
167 Ga0501035_0180015 3300049822 Bacteria 1821
168 Ga0501044_0042400 3300049823 Bacteria 4733
169 Ga0501044_0112916 3300049823 Bacteria 2724
170 nmdc:mga03683_571531_c1 3300050489 Bacteria 552
171 nmdc:mga03n38_152986_c1 3300050490 Bacteria 1162
172 nmdc:mga03n38_405703_c1 3300050490 Bacteria 751
173 nmdc:mga0yw44_115831_c1 3300050492 Bacteria 1722
174 nmdc:mga0yw44_393728_c1 3300050492 Bacteria 936
175 nmdc:mga0k408_635394_c1 3300050493 Bacteria 628
176 nmdc:mga04h51_236033_c1 3300050495 Bacteria 729
177 nmdc:mga07m45_203246_c1 3300050496 Bacteria 1152
178 nmdc:mga07m45_697886_c1 3300050496 Bacteria 584
179 nmdc:mga09592_367551_c1 3300050508 Bacteria 1244
180 Ga0500651_0062733 3300053093 Bacteria 2320
181 Ga0500562_012316 3300053108 Bacteria 2175
182 Ga0500577_0092547 3300053142 Bacteria 1224
183 Ga0500586_023053 3300053145 Bacteria 1983
184 Ga0500616_0125174 3300053153 Bacteria 1222
185 Ga0590075_017004 3300059424 Bacteria 1790
186 Ga0590077_021664 3300059426 Bacteria 1370
187 Ga0501082_0458679 3300060353 Bacteria 1114
188 Ga0466962_0249693 3300061719 Bacteria 872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_12587370 Ga0105245_125873701 141
2 3300031548 Ga0307408_100716883 Ga0307408_1007168832 141
3 3300050490 nmdc:mga03n38_405703_c1 nmdc:mga03n38_405703_c1_29_454 141
4 3300005336 Ga0070680_100462452 Ga0070680_1004624521 142
5 3300005530 Ga0070679_100155101 Ga0070679_1001551012 142
6 3300025921 Ga0207652_10269046 Ga0207652_102690462 142
7 3300038443 Ga0395901_0187736 Ga0395901_0187736_723_1154 142
8 iso_pu_bacteria 2919704043 2919706263 142
9 3300005327 Ga0070658_10800498 Ga0070658_108004981 143
10 3300006038 Ga0075365_10180339 Ga0075365_101803392 143
11 3300025284 Ga0209130_1039958 Ga0209130_10399582 143
12 3300031548 Ga0307408_100248702 Ga0307408_1002487022 143
13 3300042006 Ga0439432_087190 Ga0439432_087190_454_888 143
14 3300042007 Ga0439449_0000682 Ga0439449_0000682_5649_6083 143
15 3300042014 Ga0439457_056224 Ga0439457_056224_340_774 143
16 3300049569 Ga0501032_0272747 Ga0501032_0272747_509_946 143
17 3300049571 Ga0501034_0244573 Ga0501034_0244573_849_1286 143
18 3300049572 Ga0501036_0198473 Ga0501036_0198473_690_1127 143
19 3300049575 Ga0501039_0441507 Ga0501039_0441507_531_968 143
20 3300049579 Ga0501043_1197422 Ga0501043_1197422_65_502 143
21 3300049581 Ga0501047_0073259 Ga0501047_0073259_2617_3054 143
22 3300049742 Ga0501080_0063192 Ga0501080_0063192_2481_2918 143
23 3300049822 Ga0501035_0180015 Ga0501035_0180015_819_1256 143
24 3300049823 Ga0501044_0112916 Ga0501044_0112916_1198_1635 143
25 3300050492 nmdc:mga0yw44_393728_c1 nmdc:mga0yw44_393728_c1_74_514 143
26 3300059424 Ga0590075_017004 Ga0590075_017004_163_597 143
27 3300059426 Ga0590077_021664 Ga0590077_021664_393_827 143
28 3300060353 Ga0501082_0458679 Ga0501082_0458679_151_588 143
29 iso_pu_bacteria 2881101125 2881104962 143
30 3300003792 Ga0055540_1007713 Ga0055540_10077132 144
31 3300003794 Ga0055531_10000452 Ga0055531_100004521 144
32 3300005333 Ga0070677_10885539 Ga0070677_108855391 144
33 3300005459 Ga0068867_101073205 Ga0068867_1010732052 144
34 3300005530 Ga0070679_101514765 Ga0070679_1015147651 144
35 3300005617 Ga0068859_100179314 Ga0068859_1001793142 144
36 3300006048 Ga0075363_100194001 Ga0075363_1001940012 144
37 3300006177 Ga0075362_10079757 Ga0075362_100797572 144
38 3300006178 Ga0075367_10058300 Ga0075367_100583002 144
39 3300006195 Ga0075366_10064255 Ga0075366_100642553 144
40 3300006353 Ga0075370_10202967 Ga0075370_102029672 144
41 3300006358 Ga0068871_101843253 Ga0068871_1018432531 144
42 3300006931 Ga0097620_100179308 Ga0097620_1001793082 144
43 3300009176 Ga0105242_10739315 Ga0105242_107393152 144
44 3300013306 Ga0163162_13292082 Ga0163162_132920821 144
45 3300025273 Ga0209673_1007609 Ga0209673_10076098 144
46 3300025273 Ga0209673_1021286 Ga0209673_10212863 144
47 3300025297 Ga0209758_1015192 Ga0209758_10151923 144
48 3300025303 Ga0209051_1000114 Ga0209051_100011489 144
49 3300025304 Ga0209257_1000015 Ga0209257_1000015716 144
50 3300027526 Ga0209968_1025467 Ga0209968_10254672 144
51 3300032005 Ga0307411_10324350 Ga0307411_103243502 144
52 3300032126 Ga0307415_101687317 Ga0307415_1016873172 144
53 3300037312 Ga0395899_0010475 Ga0395899_0010475_2983_3423 144
54 3300037312 Ga0395899_0219720 Ga0395899_0219720_747_1184 144
55 3300037418 Ga0395900_0043581 Ga0395900_0043581_2572_3012 144
56 3300037418 Ga0395900_0115138 Ga0395900_0115138_2166_2603 144
57 3300037466 Ga0395898_0051820 Ga0395898_0051820_1055_1495 144
58 3300037471 Ga0395905_0011798 Ga0395905_0011798_7534_7974 144
59 3300037471 Ga0395905_0079305 Ga0395905_0079305_431_868 144
60 3300041408 Ga0439453_0006550 Ga0439453_0006550_513_962 144
61 3300041460 Ga0451802_1469911 Ga0451802_1469911_52_486 144
62 3300041486 Ga0451807_2384992 Ga0451807_2384992_268_705 144
63 3300042000 Ga0439437_039691 Ga0439437_039691_73_510 144
64 3300042131 Ga0450894_083498 Ga0450894_083498_22_471 144
65 3300042133 Ga0450896_045674 Ga0450896_045674_212_661 144
66 3300042134 Ga0450898_014500 Ga0450898_014500_744_1193 144
67 3300042185 Ga0450909_006724 Ga0450909_006724_571_1020 144
68 3300042435 Ga0439434_0147830 Ga0439434_0147830_13_462 144
69 3300042532 Ga0450893_0007359 Ga0450893_0007359_874_1308 144
70 3300042532 Ga0450893_0009249 Ga0450893_0009249_576_1025 144
71 3300044683 Ga0466965_0289314 Ga0466965_0289314_172_615 144
72 3300044712 Ga0453684_0329384 Ga0453684_0329384_1174_1614 144
73 3300044842 Ga0466957_0507960 Ga0466957_0507960_38_481 144
74 3300045049 Ga0466959_0492631 Ga0466959_0492631_146_586 144
75 3300045051 Ga0451576_0136332 Ga0451576_0136332_1038_1478 144
76 3300045051 Ga0451576_1985220 Ga0451576_1985220_129_575 144
77 3300048912 Ga0496109_0601494 Ga0496109_0601494_566_1003 144
78 3300050489 nmdc:mga03683_571531_c1 nmdc:mga03683_571531_c1_103_540 144
79 3300050490 nmdc:mga03n38_152986_c1 nmdc:mga03n38_152986_c1_581_1024 144
80 3300050493 nmdc:mga0k408_635394_c1 nmdc:mga0k408_635394_c1_144_581 144
81 3300050495 nmdc:mga04h51_236033_c1 nmdc:mga04h51_236033_c1_67_504 144
82 3300050496 nmdc:mga07m45_697886_c1 nmdc:mga07m45_697886_c1_120_557 144
83 3300050508 nmdc:mga09592_367551_c1 nmdc:mga09592_367551_c1_593_1042 144
84 3300053093 Ga0500651_0062733 Ga0500651_0062733_1185_1619 144
85 3300005327 Ga0070658_11244764 Ga0070658_112447641 145
86 3300005563 Ga0068855_100061470 Ga0068855_1000614702 145
87 3300005719 Ga0068861_101895240 Ga0068861_1018952401 145
88 3300010375 Ga0105239_10494523 Ga0105239_104945232 145
89 3300013297 Ga0157378_10999664 Ga0157378_109996642 145
90 3300014326 Ga0157380_11193484 Ga0157380_111934841 145
91 3300025909 Ga0207705_10864561 Ga0207705_108645612 145
92 3300025931 Ga0207644_11822430 Ga0207644_118224301 145
93 3300025932 Ga0207690_11013752 Ga0207690_110137522 145
94 3300031239 Ga0265328_10156287 Ga0265328_101562872 145
95 3300031711 Ga0265314_10009447 Ga0265314_100094473 145
96 3300037312 Ga0395899_0016053 Ga0395899_0016053_4458_4907 145
97 3300037418 Ga0395900_0064545 Ga0395900_0064545_3053_3490 145
98 3300037418 Ga0395900_0153865 Ga0395900_0153865_937_1386 145
99 3300037418 Ga0395900_0206899 Ga0395900_0206899_433_870 145
100 3300037418 Ga0395900_0433017 Ga0395900_0433017_135_575 145
101 3300037466 Ga0395898_0019368 Ga0395898_0019368_5603_6040 145
102 3300037466 Ga0395898_0026798 Ga0395898_0026798_1485_1934 145
103 3300037466 Ga0395898_0403706 Ga0395898_0403706_73_516 145
104 3300037466 Ga0395898_1017355 Ga0395898_1017355_203_640 145
105 3300037471 Ga0395905_0000090 Ga0395905_0000090_52423_52863 145
106 3300037471 Ga0395905_0053522 Ga0395905_0053522_2975_3415 145
107 3300037471 Ga0395905_0115310 Ga0395905_0115310_71_511 145
108 3300037471 Ga0395905_0126015 Ga0395905_0126015_949_1386 145
109 3300037471 Ga0395905_0318614 Ga0395905_0318614_904_1344 145
110 3300038443 Ga0395901_0030636 Ga0395901_0030636_2904_3341 145
111 3300038443 Ga0395901_0035979 Ga0395901_0035979_622_1059 145
112 3300038443 Ga0395901_0673312 Ga0395901_0673312_548_991 145
113 3300038443 Ga0395901_1831701 Ga0395901_1831701_41_490 145
114 3300042115 Ga0450911_007002 Ga0450911_007002_977_1417 145
115 3300044656 Ga0466969_0371110 Ga0466969_0371110_98_541 145
116 3300044842 Ga0466957_0112328 Ga0466957_0112328_534_983 145
117 3300045049 Ga0466959_0396896 Ga0466959_0396896_241_678 145
118 3300049570 Ga0501033_0605069 Ga0501033_0605069_116_565 145
119 3300049579 Ga0501043_0127344 Ga0501043_0127344_286_735 145
120 3300049581 Ga0501047_0259263 Ga0501047_0259263_1027_1476 145
121 3300049584 Ga0501068_0236309 Ga0501068_0236309_292_741 145
122 3300049742 Ga0501080_1585835 Ga0501080_1585835_34_483 145
123 3300049823 Ga0501044_0042400 Ga0501044_0042400_962_1411 145
124 3300003504 JGI26138J51218_101116 JGI26138J51218_1011162 146
125 3300005327 Ga0070658_11905152 Ga0070658_119051521 146
126 3300005435 Ga0070714_100126645 Ga0070714_1001266453 146
127 3300005539 Ga0068853_100112731 Ga0068853_1001127313 146
128 3300005563 Ga0068855_100116141 Ga0068855_1001161416 146
129 3300005563 Ga0068855_100506826 Ga0068855_1005068261 146
130 3300005614 Ga0068856_100226545 Ga0068856_1002265452 146
131 3300005614 Ga0068856_100942364 Ga0068856_1009423641 146
132 3300005616 Ga0068852_100959604 Ga0068852_1009596042 146
133 3300006038 Ga0075365_10164891 Ga0075365_101648912 146
134 3300006042 Ga0075368_10460925 Ga0075368_104609251 146
135 3300006195 Ga0075366_10660105 Ga0075366_106601052 146
136 3300009093 Ga0105240_10015617 Ga0105240_100156179 146
137 3300009098 Ga0105245_10038507 Ga0105245_100385072 146
138 3300009174 Ga0105241_10627174 Ga0105241_106271742 146
139 3300009551 Ga0105238_10440290 Ga0105238_104402902 146
140 3300010375 Ga0105239_12205405 Ga0105239_122054051 146
141 3300014969 Ga0157376_10012936 Ga0157376_100129362 146
142 3300025912 Ga0207707_10196178 Ga0207707_101961782 146
143 3300025913 Ga0207695_10068733 Ga0207695_100687332 146
144 3300025919 Ga0207657_10031330 Ga0207657_100313306 146
145 3300025924 Ga0207694_10497557 Ga0207694_104975572 146
146 3300025927 Ga0207687_10045479 Ga0207687_100454792 146
147 3300025929 Ga0207664_10121718 Ga0207664_101217182 146
148 3300025949 Ga0207667_10078059 Ga0207667_100780593 146
149 3300025949 Ga0207667_10254465 Ga0207667_102544652 146
150 3300026023 Ga0207677_10010744 Ga0207677_100107442 146
151 3300026041 Ga0207639_10128232 Ga0207639_101282323 146
152 3300026078 Ga0207702_10720517 Ga0207702_107205172 146
153 3300027614 Ga0209970_1000026 Ga0209970_10000269 146
154 3300027866 Ga0209813_10371216 Ga0209813_103712161 146
155 3300027876 Ga0209974_10010577 Ga0209974_100105775 146
156 3300028794 Ga0307515_10149053 Ga0307515_101490534 146
157 3300031238 Ga0265332_10003009 Ga0265332_100030094 146
158 3300031242 Ga0265329_10056107 Ga0265329_100561072 146
159 3300031247 Ga0265340_10052221 Ga0265340_100522212 146
160 3300031344 Ga0265316_10056195 Ga0265316_100561952 146
161 3300031456 Ga0307513_10000008 Ga0307513_10000008263 146
162 3300031711 Ga0265314_10008127 Ga0265314_1000812710 146
163 3300031712 Ga0265342_10027415 Ga0265342_100274154 146
164 3300031730 Ga0307516_10036692 Ga0307516_100366925 146
165 3300031901 Ga0307406_11961107 Ga0307406_119611071 146
166 3300032002 Ga0307416_101069750 Ga0307416_1010697502 146
167 3300037418 Ga0395900_1026988 Ga0395900_1026988_183_629 146
168 3300037471 Ga0395905_0052436 Ga0395905_0052436_3194_3640 146
169 3300037471 Ga0395905_0074747 Ga0395905_0074747_2078_2524 146
170 3300037471 Ga0395905_0334216 Ga0395905_0334216_834_1274 146
171 3300044656 Ga0466969_0009330 Ga0466969_0009330_4555_5001 146
172 3300044658 Ga0466972_0054269 Ga0466972_0054269_1381_1827 146
173 3300044684 Ga0466966_0003044 Ga0466966_0003044_1617_2063 146
174 3300044693 Ga0466961_0111070 Ga0466961_0111070_705_1145 146
175 3300044693 Ga0466961_0170970 Ga0466961_0170970_699_1145 146
176 3300044706 Ga0466964_0449308 Ga0466964_0449308_106_552 146
177 3300044706 Ga0466964_0720042 Ga0466964_0720042_31_474 146
178 3300044735 Ga0466968_0553301 Ga0466968_0553301_11_457 146
179 3300044765 Ga0466970_0142544 Ga0466970_0142544_498_941 146
180 3300044842 Ga0466957_1215411 Ga0466957_1215411_12_458 146
181 3300044901 Ga0466960_0278805 Ga0466960_0278805_49_495 146
182 3300045049 Ga0466959_0022497 Ga0466959_0022497_1335_1781 146
183 3300048917 Ga0496114_0476401 Ga0496114_0476401_338_778 146
184 3300050492 nmdc:mga0yw44_115831_c1 nmdc:mga0yw44_115831_c1_1257_1697 146
185 3300050496 nmdc:mga07m45_203246_c1 nmdc:mga07m45_203246_c1_154_600 146
186 3300053108 Ga0500562_012316 Ga0500562_012316_1124_1585 146
187 3300053142 Ga0500577_0092547 Ga0500577_0092547_681_1142 146
188 3300053145 Ga0500586_023053 Ga0500586_023053_778_1239 146
189 3300053153 Ga0500616_0125174 Ga0500616_0125174_559_1020 146
190 3300061719 Ga0466962_0249693 Ga0466962_0249693_30_476 146
191 iso_pu_bacteria 2939631187 2939634957 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

52

127

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fs2-assembly1.cif.gz_B structure of the e. coli paai protein from the phyenylacetic acid degradation operon 0.9887 2 138
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9792 22 135
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.9783 22 135
2fs2-assembly1.cif.gz_B structure of the e. coli paai protein from the phyenylacetic acid degradation operon 0.9675 2 138
3lbe-assembly1.cif.gz_B the crystal structure of smu.793 from streptococcus mutans ua159 bound to acetyl coa 0.965 27 138
ID Description Score Start End Superfamily
2fs2B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9865 2 138 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9783 22 135 3.10.129.10
2fs2B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9648 2 138 3.10.129.10
4xy5A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9554 27 138 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9374 22 138 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A4V1TYV4-F1-model_v4 Hydroxyphenylacetyl-CoA thioesterase PaaI 1.003 1 142 GO:0016289
AF-A0A5C7Z8L3-F1-model_v4 Hydroxyphenylacetyl-CoA thioesterase PaaI 1.002 3 142 GO:0016289
AF-A0A7L5Y6G9-F1-model_v4 Hydroxyphenylacetyl-CoA thioesterase PaaI 1.002 14 142 GO:0016289
AF-A0A6J4PKB0-F1-model_v4 Acyl-coenzyme A thioesterase PaaD (Pse.pu.) (E. coli PaaI) 1 1 143 GO:0016289
AF-A0A848H081-F1-model_v4 Hydroxyphenylacetyl-CoA thioesterase PaaI 0.9991 1 143 GO:0016289

Feature Viewer

pLDDT pTM Quality
95.8 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map