F294218

General Info

Members Datasets Scaffolds Average Seq Length
191 157 184 558

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10003796|Ga0265324_100037965
Length 581
Sequence MYRYDNFDHRIAAERVAQFRDQVRRRLSGELKEDEFRVLRLQNGLYMQIHAYMMRIAVPYGLISARQLRKLANIARKYDRNFGHFTTRQNIQFNWVKLQDAPDILADLAAVEMHANQTSGNCIRNTTTDEFAGVAPDEIVDPRPYAEILRQWSTFHPEFAYLPRKFKFSITGATTDRAAIEVNDVGLQVVRNAQGEIGFRVLVGGGLGRTPVIGTEIAAFIPWQHILTYAESIVRVFNEYGRRDNLYKARIKILVKAIGIDEFRRQVEADWKFTKDGPGTITQSELNRVSACFTAPDYEKLPENDAVVAALLQSNKSFANWHQRNVSAHKVPGYAAVTFSCKRTGVAPGDISAEQMEAAADLADRYSFGELRVTHMQNLVLADVKQADLLALWEAAKANGLATPNIGLLTDIICCPGGDYCTLANARSITLAKAIAERFDDIDYLQDIGDLDLNISGCVNACSHHHVAHIGILGVDKSGEEWYQVTIGGNKGSPASVGKIIGRSFSFAQIPNVIERLLQVYARERDEGERFIDTVRRTGIEPFVEFVYATPVAVDEKLLLPDYEAQGKGLPYAVSLYSPRF

Samples

Sample ID Description Type Environment
1 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
2 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
3 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
4 2818991436 Collimonas arenae 515 Isolate Unclassified
5 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
6 2904424332 Duganella sp. 1411 Isolate Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
53 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
88 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
89 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
143 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
144 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
148 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
149 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
157 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.67
Metatranscriptomes 3.66
Isolates 3.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.52
Nodule 0.52
Rhizoplane 5.76
Rhizosphere 76.96
Stem 0
Stem Tuber 0
Unclassified 5.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000586 3300002459 Bacteria 9794
2 JGI25163J39215_1001713 3300002771 Bacteria 3105
3 JGI25165J46597_1001005 3300003214 Bacteria 18693
4 Ga0055538_1000368 3300003751 Bacteria 18693
5 Ga0055539_1000374 3300003752 Bacteria 18693
6 Ga0055533_1000368 3300003756 Bacteria 18693
7 Ga0055525_1000516 3300003759 Bacteria 18693
8 Ga0055526_1000060 3300003771 Bacteria 106424
9 Ga0055541_1000258 3300003841 Bacteria 18693
10 Ga0068869_100025842 3300005334 Bacteria 4081
11 Ga0070666_10041416 3300005335 Bacteria 3078
12 Ga0070682_100069288 3300005337 Bacteria 2252
13 Ga0068868_100019955 3300005338 Bacteria 5028
14 Ga0070660_100012454 3300005339 Bacteria 6073
15 Ga0070687_100056499 3300005343 Bacteria 2054
16 Ga0070661_100005725 3300005344 Bacteria 8564
17 Ga0070669_100014394 3300005353 Bacteria 5630
18 Ga0070671_100000145 3300005355 Bacteria 46029
19 Ga0070659_100005960 3300005366 Bacteria 8787
20 Ga0070667_100002775 3300005367 Bacteria 15131
21 Ga0070667_100064224 3300005367 Bacteria 3114
22 Ga0070714_100037910 3300005435 Bacteria 4053
23 Ga0070700_100008672 3300005441 Bacteria 5545
24 Ga0068867_100017040 3300005459 Bacteria 5162
25 Ga0068867_100044168 3300005459 Bacteria 3264
26 Ga0070697_100017360 3300005536 Bacteria 5662
27 Ga0068853_100041459 3300005539 Bacteria 3933
28 Ga0070672_100159879 3300005543 Bacteria 1868
29 Ga0070665_100151523 3300005548 Bacteria 2321
30 Ga0068855_100002757 3300005563 Bacteria 21625
31 Ga0068855_100006389 3300005563 Bacteria 14354
32 Ga0070664_100013547 3300005564 Bacteria 6645
33 Ga0068859_100033410 3300005617 Bacteria 5165
34 Ga0068861_100002396 3300005719 Bacteria 12220
35 Ga0068861_100107129 3300005719 Bacteria 2234
36 Ga0068851_10001368 3300005834 Bacteria 10630
37 Ga0068858_100001295 3300005842 Bacteria 25828
38 Ga0068862_100021350 3300005844 Bacteria 5409
39 Ga0068862_100028708 3300005844 Bacteria 4685
40 Ga0081539_10005657 3300005985 Bacteria 12557
41 Ga0081539_10043004 3300005985 Bacteria 2624
42 Ga0075362_10003942 3300006177 Bacteria 5272
43 Ga0097621_100033489 3300006237 Bacteria 4092
44 Ga0097620_100033407 3300006931 Bacteria 5165
45 Ga0105244_10000745 3300009036 Bacteria 27842
46 Ga0105244_10012212 3300009036 Bacteria 5092
47 Ga0105240_10017875 3300009093 Bacteria 9540
48 Ga0105247_10036409 3300009101 Bacteria 3000
49 Ga0105248_10013622 3300009177 Bacteria 8952
50 Ga0105248_10027676 3300009177 Bacteria 6315
51 Ga0105238_10017521 3300009551 Bacteria 7284
52 Ga0163163_10097662 3300014325 Bacteria 2958
53 Ga0157379_10010334 3300014968 Bacteria 8128
54 Ga0182005_1001465 3300015265 Bacteria 9464
55 Ga0183365_10001 3300015684 Bacteria 2090444
56 Ga0213872_10011704 3300021361 Bacteria 4147
57 Ga0209784_100020 3300025224 Bacteria 412353
58 Ga0209566_100020 3300025225 Bacteria 412353
59 Ga0209674_100035 3300025226 Bacteria 412353
60 Ga0209563_100038 3300025230 Bacteria 412353
61 Ga0207427_101044 3300025231 Bacteria 11509
62 Ga0209437_100066 3300025233 Bacteria 327883
63 Ga0209677_100031 3300025253 Bacteria 329719
64 Ga0209233_1000060 3300025261 Bacteria 412379
65 Ga0209565_1006693 3300025263 Bacteria 3202
66 Ga0209675_1003181 3300025291 Bacteria 7971
67 Ga0209564_1000141 3300025295 Bacteria 179852
68 Ga0207657_10021349 3300025919 Bacteria 6097
69 Ga0207649_10058892 3300025920 Bacteria 2407
70 Ga0207681_10011639 3300025923 Bacteria 5407
71 Ga0207644_10000060 3300025931 Bacteria 79209
72 Ga0207706_10131512 3300025933 Bacteria 2201
73 Ga0207691_10020355 3300025940 Bacteria 6271
74 Ga0207711_10176529 3300025941 Bacteria 1941
75 Ga0207689_10000171 3300025942 Bacteria 56716
76 Ga0207679_10003684 3300025945 Bacteria 9498
77 Ga0207667_10000073 3300025949 Bacteria 174391
78 Ga0207667_10000076 3300025949 Bacteria 166704
79 Ga0207667_10004711 3300025949 Bacteria 16696
80 Ga0207658_10011857 3300025986 Bacteria 5941
81 Ga0207677_10011894 3300026023 Bacteria 4982
82 Ga0207703_10006019 3300026035 Bacteria 9705
83 Ga0207703_10056134 3300026035 Bacteria 3206
84 Ga0207703_10078682 3300026035 Bacteria 2740
85 Ga0207675_100004385 3300026118 Bacteria 13640
86 Ga0209968_1004194 3300027526 Bacteria 2165
87 Ga0209982_1002535 3300027552 Bacteria 2570
88 Ga0209971_1000492 3300027682 Bacteria 10463
89 Ga0209974_10003543 3300027876 Bacteria 5614
90 Ga0268266_10113238 3300028379 Bacteria 2406
91 Ga0268265_10010245 3300028380 Bacteria 6331
92 Ga0268264_10011793 3300028381 Bacteria 7205
93 Ga0268264_10051095 3300028381 Bacteria 3444
94 Ga0265336_10000287 3300028666 Bacteria 34809
95 Ga0265324_10003796 3300029957 Bacteria 7058
96 Ga0265328_10000002 3300031239 Bacteria 275819
97 Ga0265325_10016189 3300031241 Bacteria 4171
98 Ga0265331_10000012 3300031250 Bacteria 297201
99 Ga0265327_10000173 3300031251 Bacteria 138925
100 Ga0307408_100000709 3300031548 Bacteria 27106
101 Ga0307408_100004480 3300031548 Bacteria 9482
102 Ga0307508_10019925 3300031616 Bacteria 6094
103 Ga0265314_10004831 3300031711 Bacteria 12327
104 Ga0265314_10025866 3300031711 Bacteria 4419
105 Ga0316576_10011511 3300031727 Bacteria 5801
106 Ga0307416_100012578 3300032002 Bacteria 5710
107 Ga0316574_0008370 3300035398 Bacteria 5743
108 Ga0316574_0053922 3300035398 Bacteria 2511
109 Ga0316584_0009730 3300036712 Bacteria 6688
110 Ga0316584_0029788 3300036712 Bacteria 4030
111 Ga0316584_0149270 3300036712 Bacteria 1741
112 Ga0395899_0000128 3300037312 Bacteria 119014
113 Ga0395899_0022800 3300037312 Bacteria 4743
114 Ga0395899_0066286 3300037312 Bacteria 2651
115 Ga0395900_0010624 3300037418 Bacteria 9415
116 Ga0395900_0014613 3300037418 Bacteria 8009
117 Ga0395900_0042657 3300037418 Bacteria 4674
118 Ga0395905_0000283 3300037471 Bacteria 74377
119 Ga0395905_0005259 3300037471 Bacteria 13240
120 Ga0395905_0022902 3300037471 Bacteria 5904
121 Ga0395905_0240318 3300037471 Bacteria 1692
122 Ga0395901_0005452 3300038443 Bacteria 12875
123 Ga0395901_0047248 3300038443 Bacteria 4469
124 Ga0395901_0163120 3300038443 Bacteria 2340
125 Ga0400483_023861 3300039062 Bacteria 3345
126 Ga0400483_150587 3300039062 Bacteria 9815
127 Ga0436361_0254571 3300039447 Bacteria 4176
128 Ga0466969_0013378 3300044656 Bacteria 4320
129 Ga0466972_0000037 3300044658 Bacteria 137184
130 Ga0466965_0000474 3300044683 Bacteria 14203
131 Ga0466966_0000188 3300044684 Bacteria 41105
132 Ga0466961_0004996 3300044693 Bacteria 8337
133 Ga0466961_0026962 3300044693 Bacteria 3695
134 Ga0466964_0010954 3300044706 Bacteria 3426
135 Ga0453684_0002678 3300044712 Bacteria 42425
136 Ga0466957_0005917 3300044842 Bacteria 6895
137 Ga0466959_0000086 3300045049 Bacteria 59057
138 Ga0466959_0010886 3300045049 Bacteria 6521
139 Ga0466959_0107470 3300045049 Bacteria 1994
140 Ga0451576_0000013 3300045051 Bacteria 665120
141 Ga0451576_0002024 3300045051 Bacteria 32030
142 Ga0495590_0000189 3300046457 Bacteria 35045
143 Ga0495650_0011548 3300046471 Bacteria 4827
144 Ga0495606_0011913 3300046507 Bacteria 7034
145 Ga0495608_0013499 3300046511 Bacteria 5665
146 Ga0495616_0003895 3300046513 Bacteria 9511
147 Ga0495643_0019427 3300046522 Bacteria 3931
148 Ga0495652_0083840 3300046529 Bacteria 2622
149 Ga0495645_0029765 3300046543 Bacteria 3974
150 Ga0495646_0013855 3300046680 Bacteria 5127
151 Ga0495676_0000133 3300047321 Bacteria 56165
152 Ga0495673_0000522 3300047469 Bacteria 40373
153 Ga0496101_0007023 3300048904 Bacteria 7276
154 Ga0496102_0110065 3300048905 Bacteria 2567
155 Ga0496105_0026096 3300048908 Bacteria 4761
156 Ga0496106_0000441 3300048909 Bacteria 29625
157 Ga0496107_0002062 3300048910 Bacteria 12845
158 Ga0496108_0044880 3300048911 Bacteria 3690
159 Ga0496109_0026306 3300048912 Bacteria 5188
160 Ga0496109_0034780 3300048912 Bacteria 4541
161 Ga0496111_0013269 3300048914 Bacteria 5601
162 Ga0496114_0010016 3300048917 Bacteria 7536
163 Ga0496114_0019707 3300048917 Bacteria 5467
164 Ga0496125_0002083 3300048928 Bacteria 26953
165 Ga0496126_0015799 3300048929 Bacteria 7582
166 Ga0495678_003440 3300049459 Bacteria 9806
167 Ga0501032_0001038 3300049569 Bacteria 22303
168 Ga0501036_0093606 3300049572 Bacteria 2539
169 Ga0501038_0032987 3300049574 Bacteria 4562
170 Ga0501249_001374 3300049679 Bacteria 5021
171 Ga0501269_000356 3300049766 Bacteria 11512
172 Ga0501280_001360 3300049776 Bacteria 4624
173 Ga0501035_0126599 3300049822 Bacteria 2230
174 Ga0495601_0005458 3300053077 Bacteria 7407
175 Ga0500635_0000331 3300053080 Bacteria 16279
176 Ga0500608_000537 3300053122 Bacteria 14200
177 Ga0587077_000860 3300059493 Bacteria 2972
178 Ga0587091_001058 3300059511 Bacteria 2815
179 Ga0587094_001281 3300059513 Bacteria 2324
180 Ga0587068_002407 3300059641 Bacteria 2269
181 Ga0587076_000670 3300059645 Bacteria 3002
182 Ga0587071_002532 3300060344 Bacteria 2492
183 Ga0587111_0001971 3300060346 Bacteria 2631
184 Ga0466962_0000678 3300061719 Bacteria 15141

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0240318 Ga0395905_0240318_113_1672 500
2 3300002771 JGI25163J39215_1001713 JGI25163J39215_10017132 503
3 3300037471 Ga0395905_0000283 Ga0395905_0000283_33230_34873 529
4 3300039447 Ga0436361_0254571 Ga0436361_0254571_2409_4124 533
5 3300025949 Ga0207667_10000073 Ga0207667_1000007349 534
6 3300025949 Ga0207667_10000076 Ga0207667_1000007643 534
7 3300005985 Ga0081539_10005657 Ga0081539_100056577 535
8 iso_pu_bacteria 2739367756 2739790934 535
9 iso_pu_bacteria 8057160832 8057161659 538
10 3300015684 Ga0183365_10001 Ga0183365_10001454 539
11 3300044656 Ga0466969_0013378 Ga0466969_0013378_300_1943 539
12 3300044684 Ga0466966_0000188 Ga0466966_0000188_27820_29463 539
13 3300044693 Ga0466961_0004996 Ga0466961_0004996_5383_7026 539
14 3300044693 Ga0466961_0026962 Ga0466961_0026962_325_1968 539
15 3300044842 Ga0466957_0005917 Ga0466957_0005917_1962_3605 539
16 3300045049 Ga0466959_0000086 Ga0466959_0000086_49358_51001 539
17 3300045049 Ga0466959_0107470 Ga0466959_0107470_115_1758 539
18 3300053080 Ga0500635_0000331 Ga0500635_0000331_4806_6449 539
19 3300053122 Ga0500608_000537 Ga0500608_000537_7577_9220 539
20 3300061719 Ga0466962_0000678 Ga0466962_0000678_6426_8069 539
21 3300005536 Ga0070697_100017360 Ga0070697_1000173606 541
22 3300048917 Ga0496114_0010016 Ga0496114_0010016_523_2217 542
23 3300048928 Ga0496125_0002083 Ga0496125_0002083_16802_18496 542
24 iso_pu_bacteria 2643221603 2644027698 542
25 iso_pu_bacteria 2765235838 2765568765 542
26 iso_pu_bacteria 2818991436 2819542935 542
27 iso_pu_bacteria 2839094727 2839096352 542
28 iso_pu_bacteria 2904424332 2904430430 542
29 3300025263 Ga0209565_1006693 Ga0209565_10066934 543
30 3300031548 Ga0307408_100000709 Ga0307408_10000070918 543
31 3300031548 Ga0307408_100004480 Ga0307408_1000044803 543
32 3300032002 Ga0307416_100012578 Ga0307416_1000125783 543
33 3300037312 Ga0395899_0000128 Ga0395899_0000128_102149_103837 543
34 3300045051 Ga0451576_0002024 Ga0451576_0002024_3920_5656 543
35 3300025291 Ga0209675_1003181 Ga0209675_10031815 544
36 3300031711 Ga0265314_10025866 Ga0265314_100258663 544
37 3300005334 Ga0068869_100025842 Ga0068869_1000258421 545
38 3300005367 Ga0070667_100002775 Ga0070667_1000027755 545
39 3300005367 Ga0070667_100064224 Ga0070667_1000642243 545
40 3300005441 Ga0070700_100008672 Ga0070700_1000086724 545
41 3300005459 Ga0068867_100017040 Ga0068867_1000170402 545
42 3300005459 Ga0068867_100044168 Ga0068867_1000441682 545
43 3300005543 Ga0070672_100159879 Ga0070672_1001598791 545
44 3300005548 Ga0070665_100151523 Ga0070665_1001515232 545
45 3300005617 Ga0068859_100033410 Ga0068859_1000334106 545
46 3300005719 Ga0068861_100002396 Ga0068861_1000023966 545
47 3300005719 Ga0068861_100107129 Ga0068861_1001071292 545
48 3300005842 Ga0068858_100001295 Ga0068858_10000129519 545
49 3300005844 Ga0068862_100021350 Ga0068862_1000213503 545
50 3300005844 Ga0068862_100028708 Ga0068862_1000287084 545
51 3300006931 Ga0097620_100033407 Ga0097620_1000334073 545
52 3300009101 Ga0105247_10036409 Ga0105247_100364092 545
53 3300009177 Ga0105248_10013622 Ga0105248_100136229 545
54 3300014325 Ga0163163_10097662 Ga0163163_100976623 545
55 3300014968 Ga0157379_10010334 Ga0157379_100103341 545
56 3300025933 Ga0207706_10131512 Ga0207706_101315122 545
57 3300025940 Ga0207691_10020355 Ga0207691_100203553 545
58 3300025941 Ga0207711_10176529 Ga0207711_101765292 545
59 3300025942 Ga0207689_10000171 Ga0207689_1000017117 545
60 3300026035 Ga0207703_10078682 Ga0207703_100786823 545
61 3300026118 Ga0207675_100004385 Ga0207675_1000043855 545
62 3300027526 Ga0209968_1004194 Ga0209968_10041942 545
63 3300027552 Ga0209982_1002535 Ga0209982_10025353 545
64 3300027682 Ga0209971_1000492 Ga0209971_10004926 545
65 3300027876 Ga0209974_10003543 Ga0209974_100035435 545
66 3300028379 Ga0268266_10113238 Ga0268266_101132381 545
67 3300028380 Ga0268265_10010245 Ga0268265_100102452 545
68 3300028381 Ga0268264_10051095 Ga0268264_100510952 545
69 3300035398 Ga0316574_0053922 Ga0316574_0053922_381_2045 545
70 3300036712 Ga0316584_0029788 Ga0316584_0029788_2216_3880 545
71 3300039062 Ga0400483_023861 Ga0400483_023861_1577_3241 545
72 3300039062 Ga0400483_150587 Ga0400483_150587_997_2661 545
73 3300048912 Ga0496109_0034780 Ga0496109_0034780_911_2569 545
74 3300002459 JGI24751J29686_10000586 JGI24751J29686_100005866 546
75 3300003214 JGI25165J46597_1001005 JGI25165J46597_10010053 546
76 3300003751 Ga0055538_1000368 Ga0055538_10003683 546
77 3300003752 Ga0055539_1000374 Ga0055539_10003743 546
78 3300003756 Ga0055533_1000368 Ga0055533_10003683 546
79 3300003759 Ga0055525_1000516 Ga0055525_10005163 546
80 3300003771 Ga0055526_1000060 Ga0055526_10000608 546
81 3300003841 Ga0055541_1000258 Ga0055541_10002583 546
82 3300005335 Ga0070666_10041416 Ga0070666_100414161 546
83 3300005337 Ga0070682_100069288 Ga0070682_1000692881 546
84 3300005338 Ga0068868_100019955 Ga0068868_1000199554 546
85 3300005339 Ga0070660_100012454 Ga0070660_1000124545 546
86 3300005343 Ga0070687_100056499 Ga0070687_1000564992 546
87 3300005344 Ga0070661_100005725 Ga0070661_1000057259 546
88 3300005353 Ga0070669_100014394 Ga0070669_1000143945 546
89 3300005355 Ga0070671_100000145 Ga0070671_10000014540 546
90 3300005366 Ga0070659_100005960 Ga0070659_1000059607 546
91 3300005435 Ga0070714_100037910 Ga0070714_1000379102 546
92 3300005539 Ga0068853_100041459 Ga0068853_1000414594 546
93 3300005563 Ga0068855_100002757 Ga0068855_10000275719 546
94 3300005563 Ga0068855_100006389 Ga0068855_10000638915 546
95 3300005564 Ga0070664_100013547 Ga0070664_1000135478 546
96 3300005834 Ga0068851_10001368 Ga0068851_1000136812 546
97 3300005985 Ga0081539_10043004 Ga0081539_100430042 546
98 3300006177 Ga0075362_10003942 Ga0075362_100039422 546
99 3300006237 Ga0097621_100033489 Ga0097621_1000334892 546
100 3300009036 Ga0105244_10000745 Ga0105244_1000074522 546
101 3300009036 Ga0105244_10012212 Ga0105244_100122121 546
102 3300009093 Ga0105240_10017875 Ga0105240_100178758 546
103 3300009177 Ga0105248_10027676 Ga0105248_100276765 546
104 3300009551 Ga0105238_10017521 Ga0105238_100175219 546
105 3300015265 Ga0182005_1001465 Ga0182005_10014657 546
106 3300021361 Ga0213872_10011704 Ga0213872_100117042 546
107 3300025224 Ga0209784_100020 Ga0209784_100020308 546
108 3300025225 Ga0209566_100020 Ga0209566_100020308 546
109 3300025226 Ga0209674_100035 Ga0209674_100035308 546
110 3300025230 Ga0209563_100038 Ga0209563_100038308 546
111 3300025231 Ga0207427_101044 Ga0207427_10104412 546
112 3300025233 Ga0209437_100066 Ga0209437_10006673 546
113 3300025253 Ga0209677_100031 Ga0209677_100031248 546
114 3300025261 Ga0209233_1000060 Ga0209233_1000060308 546
115 3300025295 Ga0209564_1000141 Ga0209564_1000141156 546
116 3300025919 Ga0207657_10021349 Ga0207657_100213495 546
117 3300025920 Ga0207649_10058892 Ga0207649_100588922 546
118 3300025923 Ga0207681_10011639 Ga0207681_100116393 546
119 3300025931 Ga0207644_10000060 Ga0207644_100000605 546
120 3300025945 Ga0207679_10003684 Ga0207679_100036848 546
121 3300025949 Ga0207667_10004711 Ga0207667_1000471114 546
122 3300025986 Ga0207658_10011857 Ga0207658_100118574 546
123 3300026023 Ga0207677_10011894 Ga0207677_100118942 546
124 3300026035 Ga0207703_10006019 Ga0207703_100060198 546
125 3300026035 Ga0207703_10056134 Ga0207703_100561342 546
126 3300028381 Ga0268264_10011793 Ga0268264_100117935 546
127 3300028666 Ga0265336_10000287 Ga0265336_100002876 546
128 3300029957 Ga0265324_10003796 Ga0265324_100037965 546
129 3300031239 Ga0265328_10000002 Ga0265328_10000002140 546
130 3300031241 Ga0265325_10016189 Ga0265325_100161891 546
131 3300031250 Ga0265331_10000012 Ga0265331_10000012123 546
132 3300031251 Ga0265327_10000173 Ga0265327_1000017310 546
133 3300031616 Ga0307508_10019925 Ga0307508_100199256 546
134 3300031711 Ga0265314_10004831 Ga0265314_100048316 546
135 3300031727 Ga0316576_10011511 Ga0316576_100115114 546
136 3300035398 Ga0316574_0008370 Ga0316574_0008370_1285_2952 546
137 3300036712 Ga0316584_0009730 Ga0316584_0009730_874_2541 546
138 3300036712 Ga0316584_0149270 Ga0316584_0149270_46_1713 546
139 3300037312 Ga0395899_0022800 Ga0395899_0022800_885_2579 546
140 3300037312 Ga0395899_0066286 Ga0395899_0066286_73_1767 546
141 3300037418 Ga0395900_0010624 Ga0395900_0010624_4747_6420 546
142 3300037418 Ga0395900_0014613 Ga0395900_0014613_1802_3499 546
143 3300037418 Ga0395900_0042657 Ga0395900_0042657_924_2618 546
144 3300037471 Ga0395905_0005259 Ga0395905_0005259_7393_9087 546
145 3300037471 Ga0395905_0022902 Ga0395905_0022902_891_2588 546
146 3300038443 Ga0395901_0005452 Ga0395901_0005452_4842_6536 546
147 3300038443 Ga0395901_0047248 Ga0395901_0047248_1136_2830 546
148 3300038443 Ga0395901_0163120 Ga0395901_0163120_88_1761 546
149 3300044658 Ga0466972_0000037 Ga0466972_0000037_45330_47024 546
150 3300044683 Ga0466965_0000474 Ga0466965_0000474_1335_3029 546
151 3300044706 Ga0466964_0010954 Ga0466964_0010954_1293_2987 546
152 3300044712 Ga0453684_0002678 Ga0453684_0002678_27381_29126 546
153 3300045049 Ga0466959_0010886 Ga0466959_0010886_1269_2966 546
154 3300045051 Ga0451576_0000013 Ga0451576_0000013_464855_466600 546
155 3300046457 Ga0495590_0000189 Ga0495590_0000189_26376_28076 546
156 3300046471 Ga0495650_0011548 Ga0495650_0011548_143_1843 546
157 3300046507 Ga0495606_0011913 Ga0495606_0011913_4536_6230 546
158 3300046511 Ga0495608_0013499 Ga0495608_0013499_2275_3972 546
159 3300046513 Ga0495616_0003895 Ga0495616_0003895_3039_4739 546
160 3300046522 Ga0495643_0019427 Ga0495643_0019427_1579_3279 546
161 3300046529 Ga0495652_0083840 Ga0495652_0083840_146_1843 546
162 3300046543 Ga0495645_0029765 Ga0495645_0029765_1661_3358 546
163 3300046680 Ga0495646_0013855 Ga0495646_0013855_2869_4566 546
164 3300047321 Ga0495676_0000133 Ga0495676_0000133_28672_30372 546
165 3300047469 Ga0495673_0000522 Ga0495673_0000522_31731_33431 546
166 3300048904 Ga0496101_0007023 Ga0496101_0007023_4802_6442 546
167 3300048905 Ga0496102_0110065 Ga0496102_0110065_157_1797 546
168 3300048908 Ga0496105_0026096 Ga0496105_0026096_1045_2685 546
169 3300048909 Ga0496106_0000441 Ga0496106_0000441_15000_16640 546
170 3300048910 Ga0496107_0002062 Ga0496107_0002062_5281_6921 546
171 3300048911 Ga0496108_0044880 Ga0496108_0044880_1267_2907 546
172 3300048912 Ga0496109_0026306 Ga0496109_0026306_789_2429 546
173 3300048914 Ga0496111_0013269 Ga0496111_0013269_1548_3188 546
174 3300048917 Ga0496114_0019707 Ga0496114_0019707_3003_4643 546
175 3300048929 Ga0496126_0015799 Ga0496126_0015799_3071_4711 546
176 3300049459 Ga0495678_003440 Ga0495678_003440_1902_3605 546
177 3300049569 Ga0501032_0001038 Ga0501032_0001038_7636_9378 546
178 3300049572 Ga0501036_0093606 Ga0501036_0093606_465_2204 546
179 3300049574 Ga0501038_0032987 Ga0501038_0032987_2271_4013 546
180 3300049679 Ga0501249_001374 Ga0501249_001374_1574_3274 546
181 3300049766 Ga0501269_000356 Ga0501269_000356_7159_8859 546
182 3300049776 Ga0501280_001360 Ga0501280_001360_2095_3777 546
183 3300049822 Ga0501035_0126599 Ga0501035_0126599_85_1824 546
184 3300053077 Ga0495601_0005458 Ga0495601_0005458_4963_6660 546
185 3300059493 Ga0587077_000860 Ga0587077_000860_780_2477 546
186 3300059511 Ga0587091_001058 Ga0587091_001058_302_1996 546
187 3300059513 Ga0587094_001281 Ga0587094_001281_492_2189 546
188 3300059641 Ga0587068_002407 Ga0587068_002407_138_1835 546
189 3300059645 Ga0587076_000670 Ga0587076_000670_476_2173 546
190 3300060344 Ga0587071_002532 Ga0587071_002532_746_2443 546
191 3300060346 Ga0587111_0001971 Ga0587111_0001971_439_2136 546

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01077

NIR_SIR

Nitrite and sulphite reductase 4Fe-4S domain

119

275

0.99

PF03460

NIR_SIR_ferr

Nitrite/Sulfite reductase ferredoxin-like half domain

47

111

0.96

PF03460

NIR_SIR_ferr

Nitrite/Sulfite reductase ferredoxin-like half domain

337

399

0.94

PF01077

NIR_SIR

Nitrite and sulphite reductase 4Fe-4S domain

409

553

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g39-assembly1.cif.gz_A mutational analysis of sulfite reductase hemoprotein reveals the mechanism for coordinated electron and proton transfer 0.8054 53 530
1zj9-assembly2.cif.gz_B structure of mycobacterium tuberculosis nira protein 0.8043 29 533
3b0h-assembly1.cif.gz_A assimilatory nitrite reductase (nii4) from tobbaco root 0.8025 5 504
5gep-assembly1.cif.gz_A sulfite reductase hemoprotein carbon monoxide complex reduced with crii edta 0.8021 55 530
6c3z-assembly1.cif.gz_A t477a sirhp 0.7977 54 530
ID Description Score Start End Superfamily
1zj8B02 Alpha Beta;Alpha-Beta Complex;Sulfite Reductase Hemoprotein; domain 2;Sulfite Reductase Hemoprotein;Domain 2 0.969 53 112 3.90.480.10
af_P17846_72_140_3.90.480.10 Alpha Beta;Alpha-Beta Complex;Sulfite Reductase Hemoprotein; domain 2;Sulfite Reductase Hemoprotein;Domain 2 0.9135 50 111 3.90.480.10
af_Q60EA3_125_197_3.90.480.10 Alpha Beta;Alpha-Beta Complex;Sulfite Reductase Hemoprotein; domain 2;Sulfite Reductase Hemoprotein;Domain 2 0.9072 50 112 3.90.480.10
af_P08201_545_638_3.90.480.10 Alpha Beta;Alpha-Beta Complex;Sulfite Reductase Hemoprotein; domain 2;Sulfite Reductase Hemoprotein;Domain 2 0.901 52 114 3.90.480.10
af_Q2FVL8_631_763_3.30.413.10 Alpha Beta;2-Layer Sandwich;Sulfite Reductase Hemoprotein; domain 1;Sulfite Reductase Hemoprotein, domain 1 0.8931 408 542 3.30.413.10
ID Description Score Start End GO Terms
AF-A0A7Y7M8B7-F1-model_v4 Nitrite/sulfite reductase 0.9909 309 538 GO:0016491
GO:0020037
GO:0046872
GO:0051539
AF-A0A529XNW5-F1-model_v4 Nitrite/sulfite reductase 0.9899 16 108 GO:0016491
AF-A0A3D0WAW8-F1-model_v4 Sulfite reductase 0.9864 461 541 GO:0016491
GO:0020037
GO:0046872
GO:0051536
AF-A0A7M3BPL3-F1-model_v4 Nitrite/sulfite reductase 0.9848 314 538 GO:0016491
GO:0020037
GO:0046872
GO:0051539
AF-A0A529ZFC8-F1-model_v4 deleted 0.9841 336 540

Feature Viewer

pLDDT pTM Quality
91.05 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map