F294218
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 191 | 157 | 184 | 558 |
Family's Representative Sequence
| Representative Sequence | 3300029957|Ga0265324_10003796|Ga0265324_100037965 |
| Length | 581 |
| Sequence | MYRYDNFDHRIAAERVAQFRDQVRRRLSGELKEDEFRVLRLQNGLYMQIHAYMMRIAVPYGLISARQLRKLANIARKYDRNFGHFTTRQNIQFNWVKLQDAPDILADLAAVEMHANQTSGNCIRNTTTDEFAGVAPDEIVDPRPYAEILRQWSTFHPEFAYLPRKFKFSITGATTDRAAIEVNDVGLQVVRNAQGEIGFRVLVGGGLGRTPVIGTEIAAFIPWQHILTYAESIVRVFNEYGRRDNLYKARIKILVKAIGIDEFRRQVEADWKFTKDGPGTITQSELNRVSACFTAPDYEKLPENDAVVAALLQSNKSFANWHQRNVSAHKVPGYAAVTFSCKRTGVAPGDISAEQMEAAADLADRYSFGELRVTHMQNLVLADVKQADLLALWEAAKANGLATPNIGLLTDIICCPGGDYCTLANARSITLAKAIAERFDDIDYLQDIGDLDLNISGCVNACSHHHVAHIGILGVDKSGEEWYQVTIGGNKGSPASVGKIIGRSFSFAQIPNVIERLLQVYARERDEGERFIDTVRRTGIEPFVEFVYATPVAVDEKLLLPDYEAQGKGLPYAVSLYSPRF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 2 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 3 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 4 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 5 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 6 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 54 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 55 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 88 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 89 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 90 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 91 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 92 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 93 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 94 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 95 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 97 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 98 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 99 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 100 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 101 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 102 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 103 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 104 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 105 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 106 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 107 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 108 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 109 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 110 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 111 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 112 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 113 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 114 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 115 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 116 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 128 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 129 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 130 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 131 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 132 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 135 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 136 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 137 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 138 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 143 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 144 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 145 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 148 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 149 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 157 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.67 |
| Metatranscriptomes | 3.66 |
| Isolates | 3.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.52 |
| Nodule | 0.52 |
| Rhizoplane | 5.76 |
| Rhizosphere | 76.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000586 | 3300002459 | Bacteria | 9794 |
| 2 | JGI25163J39215_1001713 | 3300002771 | Bacteria | 3105 |
| 3 | JGI25165J46597_1001005 | 3300003214 | Bacteria | 18693 |
| 4 | Ga0055538_1000368 | 3300003751 | Bacteria | 18693 |
| 5 | Ga0055539_1000374 | 3300003752 | Bacteria | 18693 |
| 6 | Ga0055533_1000368 | 3300003756 | Bacteria | 18693 |
| 7 | Ga0055525_1000516 | 3300003759 | Bacteria | 18693 |
| 8 | Ga0055526_1000060 | 3300003771 | Bacteria | 106424 |
| 9 | Ga0055541_1000258 | 3300003841 | Bacteria | 18693 |
| 10 | Ga0068869_100025842 | 3300005334 | Bacteria | 4081 |
| 11 | Ga0070666_10041416 | 3300005335 | Bacteria | 3078 |
| 12 | Ga0070682_100069288 | 3300005337 | Bacteria | 2252 |
| 13 | Ga0068868_100019955 | 3300005338 | Bacteria | 5028 |
| 14 | Ga0070660_100012454 | 3300005339 | Bacteria | 6073 |
| 15 | Ga0070687_100056499 | 3300005343 | Bacteria | 2054 |
| 16 | Ga0070661_100005725 | 3300005344 | Bacteria | 8564 |
| 17 | Ga0070669_100014394 | 3300005353 | Bacteria | 5630 |
| 18 | Ga0070671_100000145 | 3300005355 | Bacteria | 46029 |
| 19 | Ga0070659_100005960 | 3300005366 | Bacteria | 8787 |
| 20 | Ga0070667_100002775 | 3300005367 | Bacteria | 15131 |
| 21 | Ga0070667_100064224 | 3300005367 | Bacteria | 3114 |
| 22 | Ga0070714_100037910 | 3300005435 | Bacteria | 4053 |
| 23 | Ga0070700_100008672 | 3300005441 | Bacteria | 5545 |
| 24 | Ga0068867_100017040 | 3300005459 | Bacteria | 5162 |
| 25 | Ga0068867_100044168 | 3300005459 | Bacteria | 3264 |
| 26 | Ga0070697_100017360 | 3300005536 | Bacteria | 5662 |
| 27 | Ga0068853_100041459 | 3300005539 | Bacteria | 3933 |
| 28 | Ga0070672_100159879 | 3300005543 | Bacteria | 1868 |
| 29 | Ga0070665_100151523 | 3300005548 | Bacteria | 2321 |
| 30 | Ga0068855_100002757 | 3300005563 | Bacteria | 21625 |
| 31 | Ga0068855_100006389 | 3300005563 | Bacteria | 14354 |
| 32 | Ga0070664_100013547 | 3300005564 | Bacteria | 6645 |
| 33 | Ga0068859_100033410 | 3300005617 | Bacteria | 5165 |
| 34 | Ga0068861_100002396 | 3300005719 | Bacteria | 12220 |
| 35 | Ga0068861_100107129 | 3300005719 | Bacteria | 2234 |
| 36 | Ga0068851_10001368 | 3300005834 | Bacteria | 10630 |
| 37 | Ga0068858_100001295 | 3300005842 | Bacteria | 25828 |
| 38 | Ga0068862_100021350 | 3300005844 | Bacteria | 5409 |
| 39 | Ga0068862_100028708 | 3300005844 | Bacteria | 4685 |
| 40 | Ga0081539_10005657 | 3300005985 | Bacteria | 12557 |
| 41 | Ga0081539_10043004 | 3300005985 | Bacteria | 2624 |
| 42 | Ga0075362_10003942 | 3300006177 | Bacteria | 5272 |
| 43 | Ga0097621_100033489 | 3300006237 | Bacteria | 4092 |
| 44 | Ga0097620_100033407 | 3300006931 | Bacteria | 5165 |
| 45 | Ga0105244_10000745 | 3300009036 | Bacteria | 27842 |
| 46 | Ga0105244_10012212 | 3300009036 | Bacteria | 5092 |
| 47 | Ga0105240_10017875 | 3300009093 | Bacteria | 9540 |
| 48 | Ga0105247_10036409 | 3300009101 | Bacteria | 3000 |
| 49 | Ga0105248_10013622 | 3300009177 | Bacteria | 8952 |
| 50 | Ga0105248_10027676 | 3300009177 | Bacteria | 6315 |
| 51 | Ga0105238_10017521 | 3300009551 | Bacteria | 7284 |
| 52 | Ga0163163_10097662 | 3300014325 | Bacteria | 2958 |
| 53 | Ga0157379_10010334 | 3300014968 | Bacteria | 8128 |
| 54 | Ga0182005_1001465 | 3300015265 | Bacteria | 9464 |
| 55 | Ga0183365_10001 | 3300015684 | Bacteria | 2090444 |
| 56 | Ga0213872_10011704 | 3300021361 | Bacteria | 4147 |
| 57 | Ga0209784_100020 | 3300025224 | Bacteria | 412353 |
| 58 | Ga0209566_100020 | 3300025225 | Bacteria | 412353 |
| 59 | Ga0209674_100035 | 3300025226 | Bacteria | 412353 |
| 60 | Ga0209563_100038 | 3300025230 | Bacteria | 412353 |
| 61 | Ga0207427_101044 | 3300025231 | Bacteria | 11509 |
| 62 | Ga0209437_100066 | 3300025233 | Bacteria | 327883 |
| 63 | Ga0209677_100031 | 3300025253 | Bacteria | 329719 |
| 64 | Ga0209233_1000060 | 3300025261 | Bacteria | 412379 |
| 65 | Ga0209565_1006693 | 3300025263 | Bacteria | 3202 |
| 66 | Ga0209675_1003181 | 3300025291 | Bacteria | 7971 |
| 67 | Ga0209564_1000141 | 3300025295 | Bacteria | 179852 |
| 68 | Ga0207657_10021349 | 3300025919 | Bacteria | 6097 |
| 69 | Ga0207649_10058892 | 3300025920 | Bacteria | 2407 |
| 70 | Ga0207681_10011639 | 3300025923 | Bacteria | 5407 |
| 71 | Ga0207644_10000060 | 3300025931 | Bacteria | 79209 |
| 72 | Ga0207706_10131512 | 3300025933 | Bacteria | 2201 |
| 73 | Ga0207691_10020355 | 3300025940 | Bacteria | 6271 |
| 74 | Ga0207711_10176529 | 3300025941 | Bacteria | 1941 |
| 75 | Ga0207689_10000171 | 3300025942 | Bacteria | 56716 |
| 76 | Ga0207679_10003684 | 3300025945 | Bacteria | 9498 |
| 77 | Ga0207667_10000073 | 3300025949 | Bacteria | 174391 |
| 78 | Ga0207667_10000076 | 3300025949 | Bacteria | 166704 |
| 79 | Ga0207667_10004711 | 3300025949 | Bacteria | 16696 |
| 80 | Ga0207658_10011857 | 3300025986 | Bacteria | 5941 |
| 81 | Ga0207677_10011894 | 3300026023 | Bacteria | 4982 |
| 82 | Ga0207703_10006019 | 3300026035 | Bacteria | 9705 |
| 83 | Ga0207703_10056134 | 3300026035 | Bacteria | 3206 |
| 84 | Ga0207703_10078682 | 3300026035 | Bacteria | 2740 |
| 85 | Ga0207675_100004385 | 3300026118 | Bacteria | 13640 |
| 86 | Ga0209968_1004194 | 3300027526 | Bacteria | 2165 |
| 87 | Ga0209982_1002535 | 3300027552 | Bacteria | 2570 |
| 88 | Ga0209971_1000492 | 3300027682 | Bacteria | 10463 |
| 89 | Ga0209974_10003543 | 3300027876 | Bacteria | 5614 |
| 90 | Ga0268266_10113238 | 3300028379 | Bacteria | 2406 |
| 91 | Ga0268265_10010245 | 3300028380 | Bacteria | 6331 |
| 92 | Ga0268264_10011793 | 3300028381 | Bacteria | 7205 |
| 93 | Ga0268264_10051095 | 3300028381 | Bacteria | 3444 |
| 94 | Ga0265336_10000287 | 3300028666 | Bacteria | 34809 |
| 95 | Ga0265324_10003796 | 3300029957 | Bacteria | 7058 |
| 96 | Ga0265328_10000002 | 3300031239 | Bacteria | 275819 |
| 97 | Ga0265325_10016189 | 3300031241 | Bacteria | 4171 |
| 98 | Ga0265331_10000012 | 3300031250 | Bacteria | 297201 |
| 99 | Ga0265327_10000173 | 3300031251 | Bacteria | 138925 |
| 100 | Ga0307408_100000709 | 3300031548 | Bacteria | 27106 |
| 101 | Ga0307408_100004480 | 3300031548 | Bacteria | 9482 |
| 102 | Ga0307508_10019925 | 3300031616 | Bacteria | 6094 |
| 103 | Ga0265314_10004831 | 3300031711 | Bacteria | 12327 |
| 104 | Ga0265314_10025866 | 3300031711 | Bacteria | 4419 |
| 105 | Ga0316576_10011511 | 3300031727 | Bacteria | 5801 |
| 106 | Ga0307416_100012578 | 3300032002 | Bacteria | 5710 |
| 107 | Ga0316574_0008370 | 3300035398 | Bacteria | 5743 |
| 108 | Ga0316574_0053922 | 3300035398 | Bacteria | 2511 |
| 109 | Ga0316584_0009730 | 3300036712 | Bacteria | 6688 |
| 110 | Ga0316584_0029788 | 3300036712 | Bacteria | 4030 |
| 111 | Ga0316584_0149270 | 3300036712 | Bacteria | 1741 |
| 112 | Ga0395899_0000128 | 3300037312 | Bacteria | 119014 |
| 113 | Ga0395899_0022800 | 3300037312 | Bacteria | 4743 |
| 114 | Ga0395899_0066286 | 3300037312 | Bacteria | 2651 |
| 115 | Ga0395900_0010624 | 3300037418 | Bacteria | 9415 |
| 116 | Ga0395900_0014613 | 3300037418 | Bacteria | 8009 |
| 117 | Ga0395900_0042657 | 3300037418 | Bacteria | 4674 |
| 118 | Ga0395905_0000283 | 3300037471 | Bacteria | 74377 |
| 119 | Ga0395905_0005259 | 3300037471 | Bacteria | 13240 |
| 120 | Ga0395905_0022902 | 3300037471 | Bacteria | 5904 |
| 121 | Ga0395905_0240318 | 3300037471 | Bacteria | 1692 |
| 122 | Ga0395901_0005452 | 3300038443 | Bacteria | 12875 |
| 123 | Ga0395901_0047248 | 3300038443 | Bacteria | 4469 |
| 124 | Ga0395901_0163120 | 3300038443 | Bacteria | 2340 |
| 125 | Ga0400483_023861 | 3300039062 | Bacteria | 3345 |
| 126 | Ga0400483_150587 | 3300039062 | Bacteria | 9815 |
| 127 | Ga0436361_0254571 | 3300039447 | Bacteria | 4176 |
| 128 | Ga0466969_0013378 | 3300044656 | Bacteria | 4320 |
| 129 | Ga0466972_0000037 | 3300044658 | Bacteria | 137184 |
| 130 | Ga0466965_0000474 | 3300044683 | Bacteria | 14203 |
| 131 | Ga0466966_0000188 | 3300044684 | Bacteria | 41105 |
| 132 | Ga0466961_0004996 | 3300044693 | Bacteria | 8337 |
| 133 | Ga0466961_0026962 | 3300044693 | Bacteria | 3695 |
| 134 | Ga0466964_0010954 | 3300044706 | Bacteria | 3426 |
| 135 | Ga0453684_0002678 | 3300044712 | Bacteria | 42425 |
| 136 | Ga0466957_0005917 | 3300044842 | Bacteria | 6895 |
| 137 | Ga0466959_0000086 | 3300045049 | Bacteria | 59057 |
| 138 | Ga0466959_0010886 | 3300045049 | Bacteria | 6521 |
| 139 | Ga0466959_0107470 | 3300045049 | Bacteria | 1994 |
| 140 | Ga0451576_0000013 | 3300045051 | Bacteria | 665120 |
| 141 | Ga0451576_0002024 | 3300045051 | Bacteria | 32030 |
| 142 | Ga0495590_0000189 | 3300046457 | Bacteria | 35045 |
| 143 | Ga0495650_0011548 | 3300046471 | Bacteria | 4827 |
| 144 | Ga0495606_0011913 | 3300046507 | Bacteria | 7034 |
| 145 | Ga0495608_0013499 | 3300046511 | Bacteria | 5665 |
| 146 | Ga0495616_0003895 | 3300046513 | Bacteria | 9511 |
| 147 | Ga0495643_0019427 | 3300046522 | Bacteria | 3931 |
| 148 | Ga0495652_0083840 | 3300046529 | Bacteria | 2622 |
| 149 | Ga0495645_0029765 | 3300046543 | Bacteria | 3974 |
| 150 | Ga0495646_0013855 | 3300046680 | Bacteria | 5127 |
| 151 | Ga0495676_0000133 | 3300047321 | Bacteria | 56165 |
| 152 | Ga0495673_0000522 | 3300047469 | Bacteria | 40373 |
| 153 | Ga0496101_0007023 | 3300048904 | Bacteria | 7276 |
| 154 | Ga0496102_0110065 | 3300048905 | Bacteria | 2567 |
| 155 | Ga0496105_0026096 | 3300048908 | Bacteria | 4761 |
| 156 | Ga0496106_0000441 | 3300048909 | Bacteria | 29625 |
| 157 | Ga0496107_0002062 | 3300048910 | Bacteria | 12845 |
| 158 | Ga0496108_0044880 | 3300048911 | Bacteria | 3690 |
| 159 | Ga0496109_0026306 | 3300048912 | Bacteria | 5188 |
| 160 | Ga0496109_0034780 | 3300048912 | Bacteria | 4541 |
| 161 | Ga0496111_0013269 | 3300048914 | Bacteria | 5601 |
| 162 | Ga0496114_0010016 | 3300048917 | Bacteria | 7536 |
| 163 | Ga0496114_0019707 | 3300048917 | Bacteria | 5467 |
| 164 | Ga0496125_0002083 | 3300048928 | Bacteria | 26953 |
| 165 | Ga0496126_0015799 | 3300048929 | Bacteria | 7582 |
| 166 | Ga0495678_003440 | 3300049459 | Bacteria | 9806 |
| 167 | Ga0501032_0001038 | 3300049569 | Bacteria | 22303 |
| 168 | Ga0501036_0093606 | 3300049572 | Bacteria | 2539 |
| 169 | Ga0501038_0032987 | 3300049574 | Bacteria | 4562 |
| 170 | Ga0501249_001374 | 3300049679 | Bacteria | 5021 |
| 171 | Ga0501269_000356 | 3300049766 | Bacteria | 11512 |
| 172 | Ga0501280_001360 | 3300049776 | Bacteria | 4624 |
| 173 | Ga0501035_0126599 | 3300049822 | Bacteria | 2230 |
| 174 | Ga0495601_0005458 | 3300053077 | Bacteria | 7407 |
| 175 | Ga0500635_0000331 | 3300053080 | Bacteria | 16279 |
| 176 | Ga0500608_000537 | 3300053122 | Bacteria | 14200 |
| 177 | Ga0587077_000860 | 3300059493 | Bacteria | 2972 |
| 178 | Ga0587091_001058 | 3300059511 | Bacteria | 2815 |
| 179 | Ga0587094_001281 | 3300059513 | Bacteria | 2324 |
| 180 | Ga0587068_002407 | 3300059641 | Bacteria | 2269 |
| 181 | Ga0587076_000670 | 3300059645 | Bacteria | 3002 |
| 182 | Ga0587071_002532 | 3300060344 | Bacteria | 2492 |
| 183 | Ga0587111_0001971 | 3300060346 | Bacteria | 2631 |
| 184 | Ga0466962_0000678 | 3300061719 | Bacteria | 15141 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0240318 | Ga0395905_0240318_113_1672 | 500 |
| 2 | 3300002771 | JGI25163J39215_1001713 | JGI25163J39215_10017132 | 503 |
| 3 | 3300037471 | Ga0395905_0000283 | Ga0395905_0000283_33230_34873 | 529 |
| 4 | 3300039447 | Ga0436361_0254571 | Ga0436361_0254571_2409_4124 | 533 |
| 5 | 3300025949 | Ga0207667_10000073 | Ga0207667_1000007349 | 534 |
| 6 | 3300025949 | Ga0207667_10000076 | Ga0207667_1000007643 | 534 |
| 7 | 3300005985 | Ga0081539_10005657 | Ga0081539_100056577 | 535 |
| 8 | iso_pu_bacteria | 2739367756 | 2739790934 | 535 |
| 9 | iso_pu_bacteria | 8057160832 | 8057161659 | 538 |
| 10 | 3300015684 | Ga0183365_10001 | Ga0183365_10001454 | 539 |
| 11 | 3300044656 | Ga0466969_0013378 | Ga0466969_0013378_300_1943 | 539 |
| 12 | 3300044684 | Ga0466966_0000188 | Ga0466966_0000188_27820_29463 | 539 |
| 13 | 3300044693 | Ga0466961_0004996 | Ga0466961_0004996_5383_7026 | 539 |
| 14 | 3300044693 | Ga0466961_0026962 | Ga0466961_0026962_325_1968 | 539 |
| 15 | 3300044842 | Ga0466957_0005917 | Ga0466957_0005917_1962_3605 | 539 |
| 16 | 3300045049 | Ga0466959_0000086 | Ga0466959_0000086_49358_51001 | 539 |
| 17 | 3300045049 | Ga0466959_0107470 | Ga0466959_0107470_115_1758 | 539 |
| 18 | 3300053080 | Ga0500635_0000331 | Ga0500635_0000331_4806_6449 | 539 |
| 19 | 3300053122 | Ga0500608_000537 | Ga0500608_000537_7577_9220 | 539 |
| 20 | 3300061719 | Ga0466962_0000678 | Ga0466962_0000678_6426_8069 | 539 |
| 21 | 3300005536 | Ga0070697_100017360 | Ga0070697_1000173606 | 541 |
| 22 | 3300048917 | Ga0496114_0010016 | Ga0496114_0010016_523_2217 | 542 |
| 23 | 3300048928 | Ga0496125_0002083 | Ga0496125_0002083_16802_18496 | 542 |
| 24 | iso_pu_bacteria | 2643221603 | 2644027698 | 542 |
| 25 | iso_pu_bacteria | 2765235838 | 2765568765 | 542 |
| 26 | iso_pu_bacteria | 2818991436 | 2819542935 | 542 |
| 27 | iso_pu_bacteria | 2839094727 | 2839096352 | 542 |
| 28 | iso_pu_bacteria | 2904424332 | 2904430430 | 542 |
| 29 | 3300025263 | Ga0209565_1006693 | Ga0209565_10066934 | 543 |
| 30 | 3300031548 | Ga0307408_100000709 | Ga0307408_10000070918 | 543 |
| 31 | 3300031548 | Ga0307408_100004480 | Ga0307408_1000044803 | 543 |
| 32 | 3300032002 | Ga0307416_100012578 | Ga0307416_1000125783 | 543 |
| 33 | 3300037312 | Ga0395899_0000128 | Ga0395899_0000128_102149_103837 | 543 |
| 34 | 3300045051 | Ga0451576_0002024 | Ga0451576_0002024_3920_5656 | 543 |
| 35 | 3300025291 | Ga0209675_1003181 | Ga0209675_10031815 | 544 |
| 36 | 3300031711 | Ga0265314_10025866 | Ga0265314_100258663 | 544 |
| 37 | 3300005334 | Ga0068869_100025842 | Ga0068869_1000258421 | 545 |
| 38 | 3300005367 | Ga0070667_100002775 | Ga0070667_1000027755 | 545 |
| 39 | 3300005367 | Ga0070667_100064224 | Ga0070667_1000642243 | 545 |
| 40 | 3300005441 | Ga0070700_100008672 | Ga0070700_1000086724 | 545 |
| 41 | 3300005459 | Ga0068867_100017040 | Ga0068867_1000170402 | 545 |
| 42 | 3300005459 | Ga0068867_100044168 | Ga0068867_1000441682 | 545 |
| 43 | 3300005543 | Ga0070672_100159879 | Ga0070672_1001598791 | 545 |
| 44 | 3300005548 | Ga0070665_100151523 | Ga0070665_1001515232 | 545 |
| 45 | 3300005617 | Ga0068859_100033410 | Ga0068859_1000334106 | 545 |
| 46 | 3300005719 | Ga0068861_100002396 | Ga0068861_1000023966 | 545 |
| 47 | 3300005719 | Ga0068861_100107129 | Ga0068861_1001071292 | 545 |
| 48 | 3300005842 | Ga0068858_100001295 | Ga0068858_10000129519 | 545 |
| 49 | 3300005844 | Ga0068862_100021350 | Ga0068862_1000213503 | 545 |
| 50 | 3300005844 | Ga0068862_100028708 | Ga0068862_1000287084 | 545 |
| 51 | 3300006931 | Ga0097620_100033407 | Ga0097620_1000334073 | 545 |
| 52 | 3300009101 | Ga0105247_10036409 | Ga0105247_100364092 | 545 |
| 53 | 3300009177 | Ga0105248_10013622 | Ga0105248_100136229 | 545 |
| 54 | 3300014325 | Ga0163163_10097662 | Ga0163163_100976623 | 545 |
| 55 | 3300014968 | Ga0157379_10010334 | Ga0157379_100103341 | 545 |
| 56 | 3300025933 | Ga0207706_10131512 | Ga0207706_101315122 | 545 |
| 57 | 3300025940 | Ga0207691_10020355 | Ga0207691_100203553 | 545 |
| 58 | 3300025941 | Ga0207711_10176529 | Ga0207711_101765292 | 545 |
| 59 | 3300025942 | Ga0207689_10000171 | Ga0207689_1000017117 | 545 |
| 60 | 3300026035 | Ga0207703_10078682 | Ga0207703_100786823 | 545 |
| 61 | 3300026118 | Ga0207675_100004385 | Ga0207675_1000043855 | 545 |
| 62 | 3300027526 | Ga0209968_1004194 | Ga0209968_10041942 | 545 |
| 63 | 3300027552 | Ga0209982_1002535 | Ga0209982_10025353 | 545 |
| 64 | 3300027682 | Ga0209971_1000492 | Ga0209971_10004926 | 545 |
| 65 | 3300027876 | Ga0209974_10003543 | Ga0209974_100035435 | 545 |
| 66 | 3300028379 | Ga0268266_10113238 | Ga0268266_101132381 | 545 |
| 67 | 3300028380 | Ga0268265_10010245 | Ga0268265_100102452 | 545 |
| 68 | 3300028381 | Ga0268264_10051095 | Ga0268264_100510952 | 545 |
| 69 | 3300035398 | Ga0316574_0053922 | Ga0316574_0053922_381_2045 | 545 |
| 70 | 3300036712 | Ga0316584_0029788 | Ga0316584_0029788_2216_3880 | 545 |
| 71 | 3300039062 | Ga0400483_023861 | Ga0400483_023861_1577_3241 | 545 |
| 72 | 3300039062 | Ga0400483_150587 | Ga0400483_150587_997_2661 | 545 |
| 73 | 3300048912 | Ga0496109_0034780 | Ga0496109_0034780_911_2569 | 545 |
| 74 | 3300002459 | JGI24751J29686_10000586 | JGI24751J29686_100005866 | 546 |
| 75 | 3300003214 | JGI25165J46597_1001005 | JGI25165J46597_10010053 | 546 |
| 76 | 3300003751 | Ga0055538_1000368 | Ga0055538_10003683 | 546 |
| 77 | 3300003752 | Ga0055539_1000374 | Ga0055539_10003743 | 546 |
| 78 | 3300003756 | Ga0055533_1000368 | Ga0055533_10003683 | 546 |
| 79 | 3300003759 | Ga0055525_1000516 | Ga0055525_10005163 | 546 |
| 80 | 3300003771 | Ga0055526_1000060 | Ga0055526_10000608 | 546 |
| 81 | 3300003841 | Ga0055541_1000258 | Ga0055541_10002583 | 546 |
| 82 | 3300005335 | Ga0070666_10041416 | Ga0070666_100414161 | 546 |
| 83 | 3300005337 | Ga0070682_100069288 | Ga0070682_1000692881 | 546 |
| 84 | 3300005338 | Ga0068868_100019955 | Ga0068868_1000199554 | 546 |
| 85 | 3300005339 | Ga0070660_100012454 | Ga0070660_1000124545 | 546 |
| 86 | 3300005343 | Ga0070687_100056499 | Ga0070687_1000564992 | 546 |
| 87 | 3300005344 | Ga0070661_100005725 | Ga0070661_1000057259 | 546 |
| 88 | 3300005353 | Ga0070669_100014394 | Ga0070669_1000143945 | 546 |
| 89 | 3300005355 | Ga0070671_100000145 | Ga0070671_10000014540 | 546 |
| 90 | 3300005366 | Ga0070659_100005960 | Ga0070659_1000059607 | 546 |
| 91 | 3300005435 | Ga0070714_100037910 | Ga0070714_1000379102 | 546 |
| 92 | 3300005539 | Ga0068853_100041459 | Ga0068853_1000414594 | 546 |
| 93 | 3300005563 | Ga0068855_100002757 | Ga0068855_10000275719 | 546 |
| 94 | 3300005563 | Ga0068855_100006389 | Ga0068855_10000638915 | 546 |
| 95 | 3300005564 | Ga0070664_100013547 | Ga0070664_1000135478 | 546 |
| 96 | 3300005834 | Ga0068851_10001368 | Ga0068851_1000136812 | 546 |
| 97 | 3300005985 | Ga0081539_10043004 | Ga0081539_100430042 | 546 |
| 98 | 3300006177 | Ga0075362_10003942 | Ga0075362_100039422 | 546 |
| 99 | 3300006237 | Ga0097621_100033489 | Ga0097621_1000334892 | 546 |
| 100 | 3300009036 | Ga0105244_10000745 | Ga0105244_1000074522 | 546 |
| 101 | 3300009036 | Ga0105244_10012212 | Ga0105244_100122121 | 546 |
| 102 | 3300009093 | Ga0105240_10017875 | Ga0105240_100178758 | 546 |
| 103 | 3300009177 | Ga0105248_10027676 | Ga0105248_100276765 | 546 |
| 104 | 3300009551 | Ga0105238_10017521 | Ga0105238_100175219 | 546 |
| 105 | 3300015265 | Ga0182005_1001465 | Ga0182005_10014657 | 546 |
| 106 | 3300021361 | Ga0213872_10011704 | Ga0213872_100117042 | 546 |
| 107 | 3300025224 | Ga0209784_100020 | Ga0209784_100020308 | 546 |
| 108 | 3300025225 | Ga0209566_100020 | Ga0209566_100020308 | 546 |
| 109 | 3300025226 | Ga0209674_100035 | Ga0209674_100035308 | 546 |
| 110 | 3300025230 | Ga0209563_100038 | Ga0209563_100038308 | 546 |
| 111 | 3300025231 | Ga0207427_101044 | Ga0207427_10104412 | 546 |
| 112 | 3300025233 | Ga0209437_100066 | Ga0209437_10006673 | 546 |
| 113 | 3300025253 | Ga0209677_100031 | Ga0209677_100031248 | 546 |
| 114 | 3300025261 | Ga0209233_1000060 | Ga0209233_1000060308 | 546 |
| 115 | 3300025295 | Ga0209564_1000141 | Ga0209564_1000141156 | 546 |
| 116 | 3300025919 | Ga0207657_10021349 | Ga0207657_100213495 | 546 |
| 117 | 3300025920 | Ga0207649_10058892 | Ga0207649_100588922 | 546 |
| 118 | 3300025923 | Ga0207681_10011639 | Ga0207681_100116393 | 546 |
| 119 | 3300025931 | Ga0207644_10000060 | Ga0207644_100000605 | 546 |
| 120 | 3300025945 | Ga0207679_10003684 | Ga0207679_100036848 | 546 |
| 121 | 3300025949 | Ga0207667_10004711 | Ga0207667_1000471114 | 546 |
| 122 | 3300025986 | Ga0207658_10011857 | Ga0207658_100118574 | 546 |
| 123 | 3300026023 | Ga0207677_10011894 | Ga0207677_100118942 | 546 |
| 124 | 3300026035 | Ga0207703_10006019 | Ga0207703_100060198 | 546 |
| 125 | 3300026035 | Ga0207703_10056134 | Ga0207703_100561342 | 546 |
| 126 | 3300028381 | Ga0268264_10011793 | Ga0268264_100117935 | 546 |
| 127 | 3300028666 | Ga0265336_10000287 | Ga0265336_100002876 | 546 |
| 128 | 3300029957 | Ga0265324_10003796 | Ga0265324_100037965 | 546 |
| 129 | 3300031239 | Ga0265328_10000002 | Ga0265328_10000002140 | 546 |
| 130 | 3300031241 | Ga0265325_10016189 | Ga0265325_100161891 | 546 |
| 131 | 3300031250 | Ga0265331_10000012 | Ga0265331_10000012123 | 546 |
| 132 | 3300031251 | Ga0265327_10000173 | Ga0265327_1000017310 | 546 |
| 133 | 3300031616 | Ga0307508_10019925 | Ga0307508_100199256 | 546 |
| 134 | 3300031711 | Ga0265314_10004831 | Ga0265314_100048316 | 546 |
| 135 | 3300031727 | Ga0316576_10011511 | Ga0316576_100115114 | 546 |
| 136 | 3300035398 | Ga0316574_0008370 | Ga0316574_0008370_1285_2952 | 546 |
| 137 | 3300036712 | Ga0316584_0009730 | Ga0316584_0009730_874_2541 | 546 |
| 138 | 3300036712 | Ga0316584_0149270 | Ga0316584_0149270_46_1713 | 546 |
| 139 | 3300037312 | Ga0395899_0022800 | Ga0395899_0022800_885_2579 | 546 |
| 140 | 3300037312 | Ga0395899_0066286 | Ga0395899_0066286_73_1767 | 546 |
| 141 | 3300037418 | Ga0395900_0010624 | Ga0395900_0010624_4747_6420 | 546 |
| 142 | 3300037418 | Ga0395900_0014613 | Ga0395900_0014613_1802_3499 | 546 |
| 143 | 3300037418 | Ga0395900_0042657 | Ga0395900_0042657_924_2618 | 546 |
| 144 | 3300037471 | Ga0395905_0005259 | Ga0395905_0005259_7393_9087 | 546 |
| 145 | 3300037471 | Ga0395905_0022902 | Ga0395905_0022902_891_2588 | 546 |
| 146 | 3300038443 | Ga0395901_0005452 | Ga0395901_0005452_4842_6536 | 546 |
| 147 | 3300038443 | Ga0395901_0047248 | Ga0395901_0047248_1136_2830 | 546 |
| 148 | 3300038443 | Ga0395901_0163120 | Ga0395901_0163120_88_1761 | 546 |
| 149 | 3300044658 | Ga0466972_0000037 | Ga0466972_0000037_45330_47024 | 546 |
| 150 | 3300044683 | Ga0466965_0000474 | Ga0466965_0000474_1335_3029 | 546 |
| 151 | 3300044706 | Ga0466964_0010954 | Ga0466964_0010954_1293_2987 | 546 |
| 152 | 3300044712 | Ga0453684_0002678 | Ga0453684_0002678_27381_29126 | 546 |
| 153 | 3300045049 | Ga0466959_0010886 | Ga0466959_0010886_1269_2966 | 546 |
| 154 | 3300045051 | Ga0451576_0000013 | Ga0451576_0000013_464855_466600 | 546 |
| 155 | 3300046457 | Ga0495590_0000189 | Ga0495590_0000189_26376_28076 | 546 |
| 156 | 3300046471 | Ga0495650_0011548 | Ga0495650_0011548_143_1843 | 546 |
| 157 | 3300046507 | Ga0495606_0011913 | Ga0495606_0011913_4536_6230 | 546 |
| 158 | 3300046511 | Ga0495608_0013499 | Ga0495608_0013499_2275_3972 | 546 |
| 159 | 3300046513 | Ga0495616_0003895 | Ga0495616_0003895_3039_4739 | 546 |
| 160 | 3300046522 | Ga0495643_0019427 | Ga0495643_0019427_1579_3279 | 546 |
| 161 | 3300046529 | Ga0495652_0083840 | Ga0495652_0083840_146_1843 | 546 |
| 162 | 3300046543 | Ga0495645_0029765 | Ga0495645_0029765_1661_3358 | 546 |
| 163 | 3300046680 | Ga0495646_0013855 | Ga0495646_0013855_2869_4566 | 546 |
| 164 | 3300047321 | Ga0495676_0000133 | Ga0495676_0000133_28672_30372 | 546 |
| 165 | 3300047469 | Ga0495673_0000522 | Ga0495673_0000522_31731_33431 | 546 |
| 166 | 3300048904 | Ga0496101_0007023 | Ga0496101_0007023_4802_6442 | 546 |
| 167 | 3300048905 | Ga0496102_0110065 | Ga0496102_0110065_157_1797 | 546 |
| 168 | 3300048908 | Ga0496105_0026096 | Ga0496105_0026096_1045_2685 | 546 |
| 169 | 3300048909 | Ga0496106_0000441 | Ga0496106_0000441_15000_16640 | 546 |
| 170 | 3300048910 | Ga0496107_0002062 | Ga0496107_0002062_5281_6921 | 546 |
| 171 | 3300048911 | Ga0496108_0044880 | Ga0496108_0044880_1267_2907 | 546 |
| 172 | 3300048912 | Ga0496109_0026306 | Ga0496109_0026306_789_2429 | 546 |
| 173 | 3300048914 | Ga0496111_0013269 | Ga0496111_0013269_1548_3188 | 546 |
| 174 | 3300048917 | Ga0496114_0019707 | Ga0496114_0019707_3003_4643 | 546 |
| 175 | 3300048929 | Ga0496126_0015799 | Ga0496126_0015799_3071_4711 | 546 |
| 176 | 3300049459 | Ga0495678_003440 | Ga0495678_003440_1902_3605 | 546 |
| 177 | 3300049569 | Ga0501032_0001038 | Ga0501032_0001038_7636_9378 | 546 |
| 178 | 3300049572 | Ga0501036_0093606 | Ga0501036_0093606_465_2204 | 546 |
| 179 | 3300049574 | Ga0501038_0032987 | Ga0501038_0032987_2271_4013 | 546 |
| 180 | 3300049679 | Ga0501249_001374 | Ga0501249_001374_1574_3274 | 546 |
| 181 | 3300049766 | Ga0501269_000356 | Ga0501269_000356_7159_8859 | 546 |
| 182 | 3300049776 | Ga0501280_001360 | Ga0501280_001360_2095_3777 | 546 |
| 183 | 3300049822 | Ga0501035_0126599 | Ga0501035_0126599_85_1824 | 546 |
| 184 | 3300053077 | Ga0495601_0005458 | Ga0495601_0005458_4963_6660 | 546 |
| 185 | 3300059493 | Ga0587077_000860 | Ga0587077_000860_780_2477 | 546 |
| 186 | 3300059511 | Ga0587091_001058 | Ga0587091_001058_302_1996 | 546 |
| 187 | 3300059513 | Ga0587094_001281 | Ga0587094_001281_492_2189 | 546 |
| 188 | 3300059641 | Ga0587068_002407 | Ga0587068_002407_138_1835 | 546 |
| 189 | 3300059645 | Ga0587076_000670 | Ga0587076_000670_476_2173 | 546 |
| 190 | 3300060344 | Ga0587071_002532 | Ga0587071_002532_746_2443 | 546 |
| 191 | 3300060346 | Ga0587111_0001971 | Ga0587111_0001971_439_2136 | 546 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4g39-assembly1.cif.gz_A | mutational analysis of sulfite reductase hemoprotein reveals the mechanism for coordinated electron and proton transfer | 0.8054 | 53 | 530 |
| 1zj9-assembly2.cif.gz_B | structure of mycobacterium tuberculosis nira protein | 0.8043 | 29 | 533 |
| 3b0h-assembly1.cif.gz_A | assimilatory nitrite reductase (nii4) from tobbaco root | 0.8025 | 5 | 504 |
| 5gep-assembly1.cif.gz_A | sulfite reductase hemoprotein carbon monoxide complex reduced with crii edta | 0.8021 | 55 | 530 |
| 6c3z-assembly1.cif.gz_A | t477a sirhp | 0.7977 | 54 | 530 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1zj8B02 | Alpha Beta;Alpha-Beta Complex;Sulfite Reductase Hemoprotein; domain 2;Sulfite Reductase Hemoprotein;Domain 2 | 0.969 | 53 | 112 | 3.90.480.10 |
| af_P17846_72_140_3.90.480.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Reductase Hemoprotein; domain 2;Sulfite Reductase Hemoprotein;Domain 2 | 0.9135 | 50 | 111 | 3.90.480.10 |
| af_Q60EA3_125_197_3.90.480.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Reductase Hemoprotein; domain 2;Sulfite Reductase Hemoprotein;Domain 2 | 0.9072 | 50 | 112 | 3.90.480.10 |
| af_P08201_545_638_3.90.480.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Reductase Hemoprotein; domain 2;Sulfite Reductase Hemoprotein;Domain 2 | 0.901 | 52 | 114 | 3.90.480.10 |
| af_Q2FVL8_631_763_3.30.413.10 | Alpha Beta;2-Layer Sandwich;Sulfite Reductase Hemoprotein; domain 1;Sulfite Reductase Hemoprotein, domain 1 | 0.8931 | 408 | 542 | 3.30.413.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y7M8B7-F1-model_v4 | Nitrite/sulfite reductase | 0.9909 | 309 | 538 |
GO:0016491
GO:0020037 GO:0046872 GO:0051539 |
| AF-A0A529XNW5-F1-model_v4 | Nitrite/sulfite reductase | 0.9899 | 16 | 108 |
GO:0016491
|
| AF-A0A3D0WAW8-F1-model_v4 | Sulfite reductase | 0.9864 | 461 | 541 |
GO:0016491
GO:0020037 GO:0046872 GO:0051536 |
| AF-A0A7M3BPL3-F1-model_v4 | Nitrite/sulfite reductase | 0.9848 | 314 | 538 |
GO:0016491
GO:0020037 GO:0046872 GO:0051539 |
| AF-A0A529ZFC8-F1-model_v4 | deleted | 0.9841 | 336 | 540 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar