F291173

General Info

Members Datasets Scaffolds Average Seq Length
189 135 378 100

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100078246|Ga0307408_1000782463
Length 112
Sequence MDGISLLTITVLAVFVGFEVVSKVSSTLHTPLMSGANAIHGIILVGAIIVAGQAAHPWELAVALLAVVLATANLVGGFVVTDRMLEMFRGSRPKKQREEVPAGDSESKRSVQ

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
31 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
32 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
45 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
46 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
47 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
50 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
51 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
71 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
72 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
73 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
74 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
75 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
76 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
77 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
78 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
81 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
82 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
83 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
84 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
85 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
86 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
87 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
88 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
89 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
90 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
133 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
134 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
135 2919443155 Agromyces sp. 3263 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 3.17
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.76
Rhizosphere 92.06
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100078246 3300031548 Bacteria 2464
2 JGI24737J22298_10160061 3300001990 Bacteria 665
3 JGI25406J46586_10259482 3300003203 Bacteria 511
4 Ga0065714_10478427 3300005288 Bacteria 536
5 Ga0070658_10000084 3300005327 Bacteria 88205
6 Ga0070676_10233934 3300005328 Bacteria 1219
7 Ga0070683_100114716 3300005329 Bacteria 2543
8 Ga0070683_100467491 3300005329 Bacteria 1204
9 Ga0070680_100044557 3300005336 Bacteria 3605
10 Ga0070680_100084652 3300005336 Bacteria 2619
11 Ga0070659_100132326 3300005366 Bacteria 2026
12 Ga0070714_100954141 3300005435 Bacteria 834
13 Ga0070681_10000023 3300005458 Bacteria 112399
14 Ga0070679_100000004 3300005530 Bacteria 263662
15 Ga0070679_100218219 3300005530 Bacteria 1869
16 Ga0070679_100362324 3300005530 Bacteria 1397
17 Ga0070684_100780365 3300005535 Bacteria 893
18 Ga0070696_100019121 3300005546 Bacteria 4637
19 Ga0068857_101037841 3300005577 Bacteria 790
20 Ga0081539_10019267 3300005985 Bacteria 4680
21 Ga0070712_101226477 3300006175 Bacteria 653
22 Ga0105240_11349445 3300009093 Bacteria 751
23 Ga0105245_10825982 3300009098 Bacteria 966
24 Ga0105245_11643564 3300009098 Bacteria 694
25 Ga0105245_13248992 3300009098 Bacteria 503
26 Ga0114129_13267072 3300009147 Bacteria 525
27 Ga0105243_11000703 3300009148 Bacteria 838
28 Ga0105238_11021760 3300009551 Bacteria 848
29 Ga0105238_12694643 3300009551 Bacteria 533
30 Ga0157371_11317611 3300013102 Bacteria 559
31 Ga0157370_10213256 3300013104 Bacteria 1789
32 Ga0157374_11459564 3300013296 Bacteria 707
33 Ga0163162_11480644 3300013306 Bacteria 773
34 Ga0157372_10268196 3300013307 Bacteria 1983
35 Ga0157372_10682949 3300013307 Bacteria 1195
36 Ga0157372_11095126 3300013307 Unclassified 922
37 Ga0157375_13326222 3300013308 Bacteria 536
38 Ga0157380_11049618 3300014326 Bacteria 851
39 Ga0157377_11260038 3300014745 Bacteria 576
40 Ga0163161_11823343 3300017792 Bacteria 541
41 Ga0206354_10811367 3300020081 Bacteria 1061
42 Ga0206353_10254089 3300020082 Bacteria 5304
43 Ga0207688_10227306 3300025901 Bacteria 1126
44 Ga0207645_10288625 3300025907 Bacteria 1091
45 Ga0207705_10001265 3300025909 Bacteria 20292
46 Ga0207707_10000029 3300025912 Bacteria 162223
47 Ga0207707_10270118 3300025912 Bacteria 1474
48 Ga0207660_10033253 3300025917 Bacteria 3565
49 Ga0207652_10000049 3300025921 Bacteria 123521
50 Ga0207652_10092931 3300025921 Bacteria 2654
51 Ga0207652_10199568 3300025921 Bacteria 1800
52 Ga0207652_10582919 3300025921 Bacteria 1004
53 Ga0207690_10646111 3300025932 Bacteria 866
54 Ga0207661_10086084 3300025944 Bacteria 2607
55 Ga0207661_10090609 3300025944 Bacteria 2546
56 Ga0207639_10917228 3300026041 Bacteria 819
57 Ga0207648_12022549 3300026089 Bacteria 537
58 Ga0307513_10161905 3300031456 Bacteria 2129
59 Ga0307408_100094247 3300031548 Bacteria 2266
60 Ga0316579_10104183 3300031691 Bacteria 1360
61 Ga0316576_10001738 3300031727 Bacteria 11997
62 Ga0316578_10002418 3300031728 Bacteria 8180
63 Ga0307405_10017809 3300031731 Bacteria 3905
64 Ga0307405_11216260 3300031731 Bacteria 652
65 Ga0316577_10722429 3300031733 Bacteria 566
66 Ga0307413_10216289 3300031824 Bacteria 1396
67 Ga0307413_10345401 3300031824 Bacteria 1146
68 Ga0307518_10254909 3300031838 Bacteria 1111
69 Ga0307410_10052751 3300031852 Bacteria 2748
70 Ga0307410_10316013 3300031852 Bacteria 1237
71 Ga0307410_10635892 3300031852 Bacteria 894
72 Ga0307410_11012327 3300031852 Bacteria 717
73 Ga0307406_10688277 3300031901 Bacteria 852
74 Ga0307407_10534210 3300031903 Bacteria 864
75 Ga0307407_10657172 3300031903 Bacteria 786
76 Ga0307407_10671211 3300031903 Bacteria 778
77 Ga0307407_11517887 3300031903 Bacteria 530
78 Ga0307412_10096998 3300031911 Bacteria 2076
79 Ga0307412_10353568 3300031911 Bacteria 1180
80 Ga0307412_10418633 3300031911 Bacteria 1095
81 Ga0307409_100226103 3300031995 Bacteria 1693
82 Ga0307409_100568696 3300031995 Bacteria 1115
83 Ga0307409_100685808 3300031995 Bacteria 1022
84 Ga0307409_100706940 3300031995 Bacteria 1008
85 Ga0307409_101120742 3300031995 Bacteria 808
86 Ga0307409_101537533 3300031995 Bacteria 693
87 Ga0307416_100070072 3300032002 Bacteria 2905
88 Ga0307416_100159198 3300032002 Bacteria 2084
89 Ga0307416_100248378 3300032002 Bacteria 1730
90 Ga0307414_10137954 3300032004 Bacteria 1905
91 Ga0307414_11636770 3300032004 Bacteria 600
92 Ga0307411_11772313 3300032005 Bacteria 573
93 Ga0307415_100324821 3300032126 Bacteria 1285
94 Ga0307415_100594932 3300032126 Bacteria 983
95 Ga0307415_100823729 3300032126 Bacteria 849
96 Ga0316593_10051248 3300032168 Bacteria 1395
97 Ga0316592_1040185 3300033524 Bacteria 1034
98 Ga0316586_1031034 3300033527 Bacteria 916
99 Ga0316588_1017294 3300033528 Bacteria 1606
100 Ga0316574_0004758 3300035398 Bacteria 7168
101 Ga0316584_0015405 3300036712 Bacteria 5468
102 Ga0395899_0049788 3300037312 Bacteria 3113
103 Ga0395898_0062588 3300037466 Bacteria 3613
104 Ga0395898_0438339 3300037466 Bacteria 1245
105 Ga0395901_0430672 3300038443 Bacteria 1351
106 Ga0439436_0004897 3300041404 Bacteria 4108
107 Ga0439438_040406 3300041405 Bacteria 1212
108 Ga0439439_0016454 3300041406 Bacteria 1811
109 Ga0439447_043856 3300041407 Bacteria 1083
110 Ga0439466_0015731 3300041411 Bacteria 2747
111 Ga0439465_0030245 3300041413 Bacteria 1722
112 Ga0451797_1016953 3300041453 Bacteria 685
113 Ga0451797_1209596 3300041453 Bacteria 529
114 Ga0451800_1052155 3300041459 Bacteria 663
115 Ga0451833_0888977 3300041491 Bacteria 584
116 Ga0451853_0074186 3300041512 Bacteria 1074
117 Ga0439433_0000673 3300041999 Bacteria 6583
118 Ga0439433_0052787 3300041999 Bacteria 960
119 Ga0439442_001974 3300042002 Bacteria 4037
120 Ga0439445_0089571 3300042004 Bacteria 866
121 Ga0439449_0000544 3300042007 Bacteria 14118
122 Ga0439449_0023022 3300042007 Bacteria 2332
123 Ga0439457_006850 3300042014 Bacteria 2759
124 Ga0439462_0006483 3300042015 Bacteria 2910
125 Ga0439463_071881 3300042016 Bacteria 887
126 Ga0450907_039369 3300042146 Bacteria 809
127 Ga0439434_0038023 3300042435 Bacteria 1474
128 Ga0450918_099724 3300042531 Bacteria 567
129 Ga0451577_1204897 3300042876 Unclassified 675
130 Ga0466969_0052252 3300044656 Bacteria 2008
131 Ga0466972_0080678 3300044658 Bacteria 1549
132 Ga0466965_0046891 3300044683 Bacteria 2139
133 Ga0466966_0012150 3300044684 Bacteria 5704
134 Ga0466966_0473902 3300044684 Bacteria 753
135 Ga0466961_0007428 3300044693 Bacteria 6975
136 Ga0466961_0077547 3300044693 Bacteria 2105
137 Ga0466963_0052407 3300044694 Bacteria 2707
138 Ga0466964_0071637 3300044706 Bacteria 1467
139 Ga0466971_0027678 3300044719 Bacteria 2540
140 Ga0466971_0086377 3300044719 Bacteria 1434
141 Ga0466968_0149006 3300044735 Bacteria 1075
142 Ga0466970_0049194 3300044765 Bacteria 2248
143 Ga0466957_0045211 3300044842 Bacteria 2670
144 Ga0466960_0039467 3300044901 Bacteria 2227
145 Ga0466960_0363301 3300044901 Bacteria 828
146 Ga0466959_0022388 3300045049 Bacteria 4671
147 Ga0466959_0662010 3300045049 Bacteria 701
148 Ga0466958_0004065 3300045836 Bacteria 7675
149 Ga0466958_0173398 3300045836 Bacteria 1366
150 Ga0466967_0023151 3300045976 Bacteria 5086
151 Ga0466967_1903915 3300045976 Bacteria 591
152 Ga0495656_0050541 3300046615 Bacteria 1776
153 Ga0495613_0825640 3300046689 Bacteria 604
154 Ga0495685_134639 3300047447 Bacteria 807
155 Ga0496105_0229408 3300048908 Bacteria 1509
156 Ga0496105_0928868 3300048908 Bacteria 654
157 Ga0496106_1063603 3300048909 Bacteria 635
158 Ga0496107_0741138 3300048910 Bacteria 721
159 Ga0496114_0169977 3300048917 Bacteria 1899
160 Ga0496114_0529404 3300048917 Bacteria 1042
161 Ga0496124_0816610 3300048927 Bacteria 576
162 Ga0496126_0223148 3300048929 Bacteria 1582
163 Ga0501031_0164498 3300049568 Bacteria 1450
164 Ga0501032_0001400 3300049569 Bacteria 19172
165 Ga0501034_0000038 3300049571 Bacteria 237795
166 Ga0501034_0023363 3300049571 Bacteria 6300
167 Ga0501034_0866354 3300049571 Bacteria 793
168 Ga0501037_0048059 3300049573 Bacteria 3127
169 Ga0501038_0113369 3300049574 Bacteria 2244
170 Ga0501038_0146685 3300049574 Bacteria 1926
171 Ga0501041_0056613 3300049577 Bacteria 2396
172 Ga0501048_0424130 3300049582 Bacteria 952
173 Ga0501067_0067805 3300049583 Bacteria 1976
174 Ga0501069_0308633 3300049585 Bacteria 928
175 Ga0501070_0164814 3300049586 Bacteria 1827
176 Ga0501072_0074074 3300049588 Bacteria 2692
177 Ga0501072_0316293 3300049588 Bacteria 1241
178 Ga0501074_0467475 3300049590 Bacteria 894
179 Ga0501076_0040055 3300049592 Bacteria 3681
180 Ga0501044_1424565 3300049823 Bacteria 558
181 Ga0501084_0226768 3300054114 Bacteria 1577
182 Ga0501082_0247228 3300060353 Bacteria 1552
183 Ga0466962_0014781 3300061719 Bacteria 3762
184 Ga0466962_0203992 3300061719 Bacteria 966
185 Ga0530510_0519514 3300061734 Bacteria 903
186 Ga0530510_1411896 3300061734 Bacteria 534
187 2791916958 2791354901 Bacteria 8322202
188 2837274435 2837268691 Bacteria 7850704
189 2919444727 2919443155 Bacteria 4072969
190 Ga0307408_100078246
191 JGI24737J22298_10160061
192 JGI25406J46586_10259482
193 Ga0065714_10478427
194 Ga0070658_10000084
195 Ga0070676_10233934
196 Ga0070683_100114716
197 Ga0070683_100467491
198 Ga0070680_100044557
199 Ga0070680_100084652
200 Ga0070659_100132326
201 Ga0070714_100954141
202 Ga0070681_10000023
203 Ga0070679_100000004
204 Ga0070679_100218219
205 Ga0070679_100362324
206 Ga0070684_100780365
207 Ga0070696_100019121
208 Ga0068857_101037841
209 Ga0081539_10019267
210 Ga0070712_101226477
211 Ga0105240_11349445
212 Ga0105245_10825982
213 Ga0105245_11643564
214 Ga0105245_13248992
215 Ga0114129_13267072
216 Ga0105243_11000703
217 Ga0105238_11021760
218 Ga0105238_12694643
219 Ga0157371_11317611
220 Ga0157370_10213256
221 Ga0157374_11459564
222 Ga0163162_11480644
223 Ga0157372_10268196
224 Ga0157372_10682949
225 Ga0157372_11095126
226 Ga0157375_13326222
227 Ga0157380_11049618
228 Ga0157377_11260038
229 Ga0163161_11823343
230 Ga0206354_10811367
231 Ga0206353_10254089
232 Ga0207688_10227306
233 Ga0207645_10288625
234 Ga0207705_10001265
235 Ga0207707_10000029
236 Ga0207707_10270118
237 Ga0207660_10033253
238 Ga0207652_10000049
239 Ga0207652_10092931
240 Ga0207652_10199568
241 Ga0207652_10582919
242 Ga0207690_10646111
243 Ga0207661_10086084
244 Ga0207661_10090609
245 Ga0207639_10917228
246 Ga0207648_12022549
247 Ga0307513_10161905
248 Ga0307408_100094247
249 Ga0316579_10104183
250 Ga0316576_10001738
251 Ga0316578_10002418
252 Ga0307405_10017809
253 Ga0307405_11216260
254 Ga0316577_10722429
255 Ga0307413_10216289
256 Ga0307413_10345401
257 Ga0307518_10254909
258 Ga0307410_10052751
259 Ga0307410_10316013
260 Ga0307410_10635892
261 Ga0307410_11012327
262 Ga0307406_10688277
263 Ga0307407_10534210
264 Ga0307407_10657172
265 Ga0307407_10671211
266 Ga0307407_11517887
267 Ga0307412_10096998
268 Ga0307412_10353568
269 Ga0307412_10418633
270 Ga0307409_100226103
271 Ga0307409_100568696
272 Ga0307409_100685808
273 Ga0307409_100706940
274 Ga0307409_101120742
275 Ga0307409_101537533
276 Ga0307416_100070072
277 Ga0307416_100159198
278 Ga0307416_100248378
279 Ga0307414_10137954
280 Ga0307414_11636770
281 Ga0307411_11772313
282 Ga0307415_100324821
283 Ga0307415_100594932
284 Ga0307415_100823729
285 Ga0316593_10051248
286 Ga0316592_1040185
287 Ga0316586_1031034
288 Ga0316588_1017294
289 Ga0316574_0004758
290 Ga0316584_0015405
291 Ga0395899_0049788
292 Ga0395898_0062588
293 Ga0395898_0438339
294 Ga0395901_0430672
295 Ga0439436_0004897
296 Ga0439438_040406
297 Ga0439439_0016454
298 Ga0439447_043856
299 Ga0439466_0015731
300 Ga0439465_0030245
301 Ga0451797_1016953
302 Ga0451797_1209596
303 Ga0451800_1052155
304 Ga0451833_0888977
305 Ga0451853_0074186
306 Ga0439433_0000673
307 Ga0439433_0052787
308 Ga0439442_001974
309 Ga0439445_0089571
310 Ga0439449_0000544
311 Ga0439449_0023022
312 Ga0439457_006850
313 Ga0439462_0006483
314 Ga0439463_071881
315 Ga0450907_039369
316 Ga0439434_0038023
317 Ga0450918_099724
318 Ga0451577_1204897
319 Ga0466969_0052252
320 Ga0466972_0080678
321 Ga0466965_0046891
322 Ga0466966_0012150
323 Ga0466966_0473902
324 Ga0466961_0007428
325 Ga0466961_0077547
326 Ga0466963_0052407
327 Ga0466964_0071637
328 Ga0466971_0027678
329 Ga0466971_0086377
330 Ga0466968_0149006
331 Ga0466970_0049194
332 Ga0466957_0045211
333 Ga0466960_0039467
334 Ga0466960_0363301
335 Ga0466959_0022388
336 Ga0466959_0662010
337 Ga0466958_0004065
338 Ga0466958_0173398
339 Ga0466967_0023151
340 Ga0466967_1903915
341 Ga0495656_0050541
342 Ga0495613_0825640
343 Ga0495685_134639
344 Ga0496105_0229408
345 Ga0496105_0928868
346 Ga0496106_1063603
347 Ga0496107_0741138
348 Ga0496114_0169977
349 Ga0496114_0529404
350 Ga0496124_0816610
351 Ga0496126_0223148
352 Ga0501031_0164498
353 Ga0501032_0001400
354 Ga0501034_0000038
355 Ga0501034_0023363
356 Ga0501034_0866354
357 Ga0501037_0048059
358 Ga0501038_0113369
359 Ga0501038_0146685
360 Ga0501041_0056613
361 Ga0501048_0424130
362 Ga0501067_0067805
363 Ga0501069_0308633
364 Ga0501070_0164814
365 Ga0501072_0074074
366 Ga0501072_0316293
367 Ga0501074_0467475
368 Ga0501076_0040055
369 Ga0501044_1424565
370 Ga0501084_0226768
371 Ga0501082_0247228
372 Ga0466962_0014781
373 Ga0466962_0203992
374 Ga0530510_0519514
375 Ga0530510_1411896
376 2791916958
377 2837274435
378 2919444727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12769

PNTB_4TM

4TM region of pyridine nucleotide transhydrogenase, mitoch

6

90

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s5c-assembly1.cif.gz_J m. xanthus ferritin-like protein encb 0.9186 31 85
5l31-assembly1.cif.gz_B crystal structure of an engineered metal-free ridc1 variant containing five disulfide bonds. 0.8633 40 74
7s5c-assembly1.cif.gz_J m. xanthus ferritin-like protein encb 0.8467 31 85
7a0g-assembly1.cif.gz_JJJ structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. 0.7901 34 87
5ffc-assembly2.cif.gz_B copm in the cu(ii)-bound form 0.7791 22 83
ID Description Score Start End Superfamily
af_Q2FX96_176_237_1.20.5.1930 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9735 40 79 1.20.5.1930
5ffcA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7887 22 84 1.20.1260.10
5ffcB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7791 22 83 1.20.1260.10
af_D4A584_1_269_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.7674 18 81 1.20.1270.60
af_Q9XVN7_42_241_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.7383 24 99 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A1V5IG65-F1-model_v4 proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) 0.8174 28 96 GO:0005886
GO:0006740
GO:0008750
GO:0016491
GO:0050661
AF-A0A2E7NKF7-F1-model_v4 deleted 0.7364 13 86
AF-A0A3B8PMG8-F1-model_v4 BIG2 domain-containing protein 0.715 14 97
AF-A0A830HCB6-F1-model_v4 Uncharacterized protein 0.6687 1 98
AF-A0A242JXE0-F1-model_v4 Uncharacterized protein 0.6568 3 91

Map