F290545

General Info

Members Datasets Scaffolds Average Seq Length
189 122 378 111

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101695416|Ga0070708_1016954161
Length 121
Sequence MKESHVEGLATHGGPESCGVSRKGRAEALTGVRAGRAIEPRKKLSSGRRRCRNKRKASLGASPSRDAFGSCAVEDPGTYGNTTHENREVLGSPAAAGAAGRVGKSKDARRRCTSPGSRTVS

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
16 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
31 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
32 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
44 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
47 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
48 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
57 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
58 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
59 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
60 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
63 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
64 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
65 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
66 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
71 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
72 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
73 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
74 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
75 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
76 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
77 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
78 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
85 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
86 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
100 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 2.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.12
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 13.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_101695416 3300005445 Bacteria 587
2 Ga0065704_10262970 3300005289 Bacteria 961
3 Ga0065707_10309233 3300005295 Bacteria 977
4 Ga0065707_10390587 3300005295 Bacteria 850
5 Ga0070682_100514584 3300005337 Bacteria 930
6 Ga0070703_10108651 3300005406 Bacteria 989
7 Ga0070709_10443795 3300005434 Bacteria 976
8 Ga0070713_100000425 3300005436 Bacteria 26954
9 Ga0070710_10299245 3300005437 Bacteria 1049
10 Ga0070708_100127052 3300005445 Bacteria 2357
11 Ga0070706_100693139 3300005467 Bacteria 945
12 Ga0070706_101287808 3300005467 Bacteria 670
13 Ga0070698_100089859 3300005471 Bacteria 3055
14 Ga0070697_100005176 3300005536 Bacteria 10020
15 Ga0070697_100071008 3300005536 Bacteria 2855
16 Ga0081455_10769426 3300005937 Unclassified 607
17 Ga0081455_10901284 3300005937 Bacteria 550
18 Ga0081540_1024619 3300005983 Unclassified 3488
19 Ga0070717_10728231 3300006028 Bacteria 901
20 Ga0070717_11394316 3300006028 Bacteria 636
21 Ga0070717_11747336 3300006028 Bacteria 563
22 Ga0070715_10407213 3300006163 Bacteria 757
23 Ga0070716_100024651 3300006173 Bacteria 3204
24 Ga0070716_100030730 3300006173 Bacteria 2917
25 Ga0070716_100069907 3300006173 Bacteria 2059
26 Ga0070712_100121823 3300006175 Bacteria 1963
27 Ga0070712_100934422 3300006175 Bacteria 749
28 Ga0075428_100090342 3300006844 Bacteria 3341
29 Ga0075433_10147803 3300006852 Bacteria 2090
30 Ga0075433_11343983 3300006852 Bacteria 619
31 Ga0075434_100302321 3300006871 Bacteria 1620
32 Ga0075434_102629597 3300006871 Bacteria 503
33 Ga0075429_100199536 3300006880 Unclassified 1753
34 Ga0075436_100344739 3300006914 Unclassified 1073
35 Ga0075436_100816751 3300006914 Bacteria 695
36 Ga0075435_100751085 3300007076 Bacteria 849
37 Ga0075435_100793116 3300007076 Bacteria 825
38 Ga0099794_10040714 3300007265 Bacteria 2211
39 Ga0099794_10645024 3300007265 Bacteria 562
40 Ga0105245_11910591 3300009098 Bacteria 647
41 Ga0114129_10747195 3300009147 Bacteria 1252
42 Ga0157378_10868126 3300013297 Bacteria 931
43 Ga0184601_110542 3300019183 Bacteria 603
44 Ga0247554_103504 3300023547 Bacteria 617
45 Ga0224572_1007584 3300024225 Bacteria 1990
46 Ga0224572_1051064 3300024225 Bacteria 770
47 Ga0224572_1062046 3300024225 Bacteria 691
48 Ga0228598_1003230 3300024227 Bacteria 3513
49 Ga0228598_1004702 3300024227 Bacteria 2883
50 Ga0228598_1004732 3300024227 Bacteria 2875
51 Ga0228598_1004735 3300024227 Bacteria 2874
52 Ga0228598_1009274 3300024227 Bacteria 1975
53 Ga0228598_1041318 3300024227 Unclassified 910
54 Ga0228598_1084712 3300024227 Unclassified 636
55 Ga0207685_10092438 3300025905 Bacteria 1277
56 Ga0207685_10334282 3300025905 Bacteria 759
57 Ga0207699_10611234 3300025906 Bacteria 794
58 Ga0207684_10124498 3300025910 Unclassified 2211
59 Ga0207684_10397898 3300025910 Unclassified 1184
60 Ga0207684_10421244 3300025910 Bacteria 1147
61 Ga0207684_10761613 3300025910 Bacteria 820
62 Ga0207684_11178005 3300025910 Bacteria 635
63 Ga0207693_10017982 3300025915 Bacteria 5634
64 Ga0207693_10296546 3300025915 Bacteria 1267
65 Ga0207663_10072334 3300025916 Bacteria 2228
66 Ga0207663_11344948 3300025916 Bacteria 575
67 Ga0207646_10018176 3300025922 Bacteria 6561
68 Ga0207646_10080789 3300025922 Bacteria 2907
69 Ga0207646_10380449 3300025922 Bacteria 1275
70 Ga0207646_10937542 3300025922 Bacteria 767
71 Ga0207646_11411857 3300025922 Bacteria 605
72 Ga0207700_10077861 3300025928 Bacteria 2577
73 Ga0207700_10139350 3300025928 Bacteria 1991
74 Ga0207665_10004319 3300025939 Bacteria 9442
75 Ga0209588_1009376 3300027671 Bacteria 2925
76 Ga0265356_1000712 3300028017 Bacteria 5680
77 Ga0265356_1008122 3300028017 Bacteria 1199
78 Ga0265338_10042751 3300028800 Bacteria 4214
79 Ga0265338_10118991 3300028800 Bacteria 2110
80 Ga0265338_10124738 3300028800 Bacteria 2045
81 Ga0265324_10010122 3300029957 Bacteria 3653
82 Ga0265763_1009889 3300030763 Bacteria 873
83 Ga0265760_10004497 3300031090 Bacteria 4000
84 Ga0265760_10276293 3300031090 Bacteria 589
85 Ga0265330_10033801 3300031235 Unclassified 2285
86 Ga0265332_10037607 3300031238 Bacteria 2098
87 Ga0265328_10398933 3300031239 Bacteria 539
88 Ga0265320_10037422 3300031240 Bacteria 2443
89 Ga0265320_10108356 3300031240 Bacteria 1274
90 Ga0265320_10328023 3300031240 Bacteria 676
91 Ga0265325_10014884 3300031241 Unclassified 4386
92 Ga0265329_10019319 3300031242 Unclassified 2315
93 Ga0265340_10123515 3300031247 Bacteria 1190
94 Ga0265340_10156083 3300031247 Bacteria 1038
95 Ga0265339_10163510 3300031249 Bacteria 1118
96 Ga0265339_10281224 3300031249 Bacteria 797
97 Ga0265331_10018998 3300031250 Unclassified 3552
98 Ga0265331_10151557 3300031250 Bacteria 1052
99 Ga0265316_10068837 3300031344 Unclassified 2732
100 Ga0265316_10098375 3300031344 Bacteria 2226
101 Ga0265313_10018258 3300031595 Bacteria 3947
102 Ga0265313_10126932 3300031595 Bacteria 1108
103 Ga0265314_10040474 3300031711 Bacteria 3344
104 Ga0265342_10513161 3300031712 Bacteria 610
105 Ga0307516_10011467 3300031730 Bacteria 9623
106 Ga0316214_1034002 3300033545 Bacteria 727
107 Ga0395901_0749515 3300038443 Bacteria 970
108 Ga0436360_1228032 3300039438 Bacteria 3704
109 Ga0436361_0331183 3300039447 Bacteria 1579
110 Ga0436361_1112446 3300039447 Bacteria 2688
111 Ga0436362_0981289 3300039453 Bacteria 937
112 Ga0439441_106647 3300042001 Unclassified 632
113 Ga0439435_0113870 3300042436 Bacteria 842
114 Ga0451577_0062697 3300042876 Unclassified 3315
115 Ga0453683_0359688 3300044673 Bacteria 935
116 Ga0453683_0711356 3300044673 Bacteria 658
117 Ga0453684_0039922 3300044712 Bacteria 6383
118 Ga0495580_0409085 3300046472 Bacteria 914
119 Ga0495582_0108321 3300046473 Bacteria 1560
120 Ga0495664_0101612 3300046477 Bacteria 1732
121 Ga0495609_0352921 3300046538 Bacteria 593
122 Ga0495667_0047345 3300046559 Unclassified 2841
123 Ga0495667_0081685 3300046559 Bacteria 2100
124 Ga0495659_0163706 3300046664 Bacteria 899
125 Ga0495623_0479529 3300046679 Unclassified 659
126 Ga0495658_0825511 3300046683 Unclassified 593
127 Ga0495600_0671985 3300046809 Bacteria 625
128 Ga0495604_0263987 3300047317 Unclassified 1169
129 Ga0495636_0363301 3300047318 Bacteria 685
130 Ga0495680_0115060 3300047322 Unclassified 1990
131 Ga0496100_0618352 3300048903 Bacteria 842
132 Ga0496101_0277207 3300048904 Bacteria 1310
133 Ga0496106_1190946 3300048909 Bacteria 594
134 Ga0496107_0448271 3300048910 Bacteria 959
135 Ga0501031_0263991 3300049568 Bacteria 1118
136 Ga0501032_0392558 3300049569 Unclassified 892
137 Ga0501033_0028639 3300049570 Bacteria 4184
138 Ga0501036_0346817 3300049572 Bacteria 1240
139 Ga0501036_0367090 3300049572 Bacteria 1201
140 Ga0501037_0056568 3300049573 Bacteria 2864
141 Ga0501038_0071415 3300049574 Bacteria 2944
142 Ga0501039_0011108 3300049575 Bacteria 6864
143 Ga0501039_1408659 3300049575 Bacteria 536
144 Ga0501040_0019441 3300049576 Bacteria 4517
145 Ga0501040_0142263 3300049576 Bacteria 1690
146 Ga0501041_0010830 3300049577 Bacteria 5379
147 Ga0501042_0002875 3300049578 Bacteria 10681
148 Ga0501042_1041872 3300049578 Bacteria 596
149 Ga0501043_0058261 3300049579 Bacteria 3032
150 Ga0501046_0021929 3300049580 Bacteria 5264
151 Ga0501046_0114843 3300049580 Bacteria 2054
152 Ga0501046_0316314 3300049580 Unclassified 1138
153 Ga0501048_0011073 3300049582 Bacteria 6724
154 Ga0501068_0074686 3300049584 Bacteria 2072
155 Ga0501068_0093455 3300049584 Bacteria 1858
156 Ga0501069_0242582 3300049585 Unclassified 1050
157 Ga0501071_0041722 3300049587 Bacteria 3286
158 Ga0501072_0081956 3300049588 Bacteria 2557
159 Ga0501073_0634539 3300049589 Unclassified 737
160 Ga0501074_0026946 3300049590 Bacteria 4165
161 Ga0501075_0001940 3300049591 Bacteria 13643
162 Ga0501075_0304544 3300049591 Plasmid 1214
163 Ga0501076_0002864 3300049592 Bacteria 11938
164 Ga0501076_0853966 3300049592 Bacteria 751
165 Ga0501077_0020394 3300049593 Bacteria 4195
166 Ga0501077_0386489 3300049593 Plasmid 894
167 Ga0501079_0289609 3300049741 Bacteria 1280
168 Ga0501080_0013671 3300049742 Bacteria 7474
169 Ga0501081_0008162 3300049743 Bacteria 6794
170 Ga0501081_0246562 3300049743 Bacteria 1303
171 Ga0501083_0152389 3300049744 Bacteria 1513
172 Ga0501035_0320427 3300049822 Bacteria 1302
173 Ga0501045_0043067 3300049824 Bacteria 3287
174 Ga0501045_0094312 3300049824 Bacteria 2213
175 nmdc:mga05p37_11837_c1 3300050507 Bacteria 10396
176 nmdc:mga06r32_197216_c1 3300050510 Bacteria 2001
177 nmdc:mga0n895_1910083_c1 3300050512 Bacteria 553
178 nmdc:mga0n895_272479_c1 3300050512 Bacteria 1717
179 nmdc:mga0rr50_246548_c1 3300050513 Bacteria 1482
180 nmdc:mga0rr50_489220_c1 3300050513 Bacteria 1045
181 nmdc:mga0rr50_720161_c1 3300050513 Bacteria 852
182 nmdc:mga08x19_1178028_c1 3300050514 Bacteria 543
183 nmdc:mga08x19_366229_c1 3300050514 Unclassified 1008
184 nmdc:mga0a205_171465_c1 3300050515 Bacteria 2066
185 nmdc:mga0a205_922111_c1 3300050515 Bacteria 720
186 Ga0501084_0010251 3300054114 Bacteria 7755
187 Ga0501082_0004814 3300060353 Bacteria 11772
188 Ga0530510_0001001 3300061734 Bacteria 18765
189 Ga0530510_0110891 3300061734 Bacteria 2009
190 Ga0070708_101695416
191 Ga0065704_10262970
192 Ga0065707_10309233
193 Ga0065707_10390587
194 Ga0070682_100514584
195 Ga0070703_10108651
196 Ga0070709_10443795
197 Ga0070713_100000425
198 Ga0070710_10299245
199 Ga0070708_100127052
200 Ga0070706_100693139
201 Ga0070706_101287808
202 Ga0070698_100089859
203 Ga0070697_100005176
204 Ga0070697_100071008
205 Ga0081455_10769426
206 Ga0081455_10901284
207 Ga0081540_1024619
208 Ga0070717_10728231
209 Ga0070717_11394316
210 Ga0070717_11747336
211 Ga0070715_10407213
212 Ga0070716_100024651
213 Ga0070716_100030730
214 Ga0070716_100069907
215 Ga0070712_100121823
216 Ga0070712_100934422
217 Ga0075428_100090342
218 Ga0075433_10147803
219 Ga0075433_11343983
220 Ga0075434_100302321
221 Ga0075434_102629597
222 Ga0075429_100199536
223 Ga0075436_100344739
224 Ga0075436_100816751
225 Ga0075435_100751085
226 Ga0075435_100793116
227 Ga0099794_10040714
228 Ga0099794_10645024
229 Ga0105245_11910591
230 Ga0114129_10747195
231 Ga0157378_10868126
232 Ga0184601_110542
233 Ga0247554_103504
234 Ga0224572_1007584
235 Ga0224572_1051064
236 Ga0224572_1062046
237 Ga0228598_1003230
238 Ga0228598_1004702
239 Ga0228598_1004732
240 Ga0228598_1004735
241 Ga0228598_1009274
242 Ga0228598_1041318
243 Ga0228598_1084712
244 Ga0207685_10092438
245 Ga0207685_10334282
246 Ga0207699_10611234
247 Ga0207684_10124498
248 Ga0207684_10397898
249 Ga0207684_10421244
250 Ga0207684_10761613
251 Ga0207684_11178005
252 Ga0207693_10017982
253 Ga0207693_10296546
254 Ga0207663_10072334
255 Ga0207663_11344948
256 Ga0207646_10018176
257 Ga0207646_10080789
258 Ga0207646_10380449
259 Ga0207646_10937542
260 Ga0207646_11411857
261 Ga0207700_10077861
262 Ga0207700_10139350
263 Ga0207665_10004319
264 Ga0209588_1009376
265 Ga0265356_1000712
266 Ga0265356_1008122
267 Ga0265338_10042751
268 Ga0265338_10118991
269 Ga0265338_10124738
270 Ga0265324_10010122
271 Ga0265763_1009889
272 Ga0265760_10004497
273 Ga0265760_10276293
274 Ga0265330_10033801
275 Ga0265332_10037607
276 Ga0265328_10398933
277 Ga0265320_10037422
278 Ga0265320_10108356
279 Ga0265320_10328023
280 Ga0265325_10014884
281 Ga0265329_10019319
282 Ga0265340_10123515
283 Ga0265340_10156083
284 Ga0265339_10163510
285 Ga0265339_10281224
286 Ga0265331_10018998
287 Ga0265331_10151557
288 Ga0265316_10068837
289 Ga0265316_10098375
290 Ga0265313_10018258
291 Ga0265313_10126932
292 Ga0265314_10040474
293 Ga0265342_10513161
294 Ga0307516_10011467
295 Ga0316214_1034002
296 Ga0395901_0749515
297 Ga0436360_1228032
298 Ga0436361_0331183
299 Ga0436361_1112446
300 Ga0436362_0981289
301 Ga0439441_106647
302 Ga0439435_0113870
303 Ga0451577_0062697
304 Ga0453683_0359688
305 Ga0453683_0711356
306 Ga0453684_0039922
307 Ga0495580_0409085
308 Ga0495582_0108321
309 Ga0495664_0101612
310 Ga0495609_0352921
311 Ga0495667_0047345
312 Ga0495667_0081685
313 Ga0495659_0163706
314 Ga0495623_0479529
315 Ga0495658_0825511
316 Ga0495600_0671985
317 Ga0495604_0263987
318 Ga0495636_0363301
319 Ga0495680_0115060
320 Ga0496100_0618352
321 Ga0496101_0277207
322 Ga0496106_1190946
323 Ga0496107_0448271
324 Ga0501031_0263991
325 Ga0501032_0392558
326 Ga0501033_0028639
327 Ga0501036_0346817
328 Ga0501036_0367090
329 Ga0501037_0056568
330 Ga0501038_0071415
331 Ga0501039_0011108
332 Ga0501039_1408659
333 Ga0501040_0019441
334 Ga0501040_0142263
335 Ga0501041_0010830
336 Ga0501042_0002875
337 Ga0501042_1041872
338 Ga0501043_0058261
339 Ga0501046_0021929
340 Ga0501046_0114843
341 Ga0501046_0316314
342 Ga0501048_0011073
343 Ga0501068_0074686
344 Ga0501068_0093455
345 Ga0501069_0242582
346 Ga0501071_0041722
347 Ga0501072_0081956
348 Ga0501073_0634539
349 Ga0501074_0026946
350 Ga0501075_0001940
351 Ga0501075_0304544
352 Ga0501076_0002864
353 Ga0501076_0853966
354 Ga0501077_0020394
355 Ga0501077_0386489
356 Ga0501079_0289609
357 Ga0501080_0013671
358 Ga0501081_0008162
359 Ga0501081_0246562
360 Ga0501083_0152389
361 Ga0501035_0320427
362 Ga0501045_0043067
363 Ga0501045_0094312
364 nmdc:mga05p37_11837_c1
365 nmdc:mga06r32_197216_c1
366 nmdc:mga0n895_1910083_c1
367 nmdc:mga0n895_272479_c1
368 nmdc:mga0rr50_246548_c1
369 nmdc:mga0rr50_489220_c1
370 nmdc:mga0rr50_720161_c1
371 nmdc:mga08x19_1178028_c1
372 nmdc:mga08x19_366229_c1
373 nmdc:mga0a205_171465_c1
374 nmdc:mga0a205_922111_c1
375 Ga0501084_0010251
376 Ga0501082_0004814
377 Ga0530510_0001001
378 Ga0530510_0110891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map