F289978

General Info

Members Datasets Scaffolds Average Seq Length
188 122 376 159

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0001344|Ga0501031_0001344_13259_13798
Length 179
Sequence MRTDDAPADAGSHPLPSARADVPAPGRPDWSLARDAFGRLVLMRPGQADAPVTPVRGFPFAAPDECIALMGAQGTELAWIERLDALPAETRRLVDEELGQREFRPEILRIRHASTWATPSHWDVETDRGPTRLTLKAEEDIRRLPAASLLITDAHGVQFLVRDMAALDKASRRILDHFL

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
22 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
23 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
24 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
27 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
28 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
37 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
38 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
39 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
40 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
41 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
44 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
45 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
46 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
47 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
53 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
54 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
55 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
61 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
62 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
63 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
64 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
65 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
66 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
67 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
68 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
69 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
70 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
71 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
72 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
73 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
74 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
75 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
76 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
77 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
78 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
79 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
80 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
81 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
82 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
83 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
84 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
85 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
86 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
87 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
88 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
89 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
90 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
91 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
92 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
96 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
100 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
116 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
117 2547132512 Azospira oryzae 6a3 Isolate Unclassified
118 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
119 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
120 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
121 2941479691
122 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.28
Metatranscriptomes 0.53
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.51
Nodule 0
Rhizoplane 0
Rhizosphere 80.32
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0001344 3300049568 Bacteria 15143
2 JGI25155J39150_1000117 3300002704 Bacteria 39472
3 JGI25155J39150_1000227 3300002704 Bacteria 22140
4 JGI25162J39368_1003616 3300002737 Bacteria 4275
5 rootL2_10016633 3300003322 Bacteria 6737
6 rootL2_10035512 3300003322 Bacteria 2859
7 rootL2_10035513 3300003322 Bacteria 3466
8 JGI25160J50197_1084716 3300003354 Bacteria 583
9 Ga0055529_1000095 3300003763 Bacteria 134030
10 Ga0055524_1000241 3300003775 Bacteria 57262
11 Ga0055543_1003454 3300004625 Bacteria 4666
12 Ga0065165_1000524 3300005262 Bacteria 58631
13 Ga0070660_100000336 3300005339 Bacteria 31165
14 Ga0070668_100487683 3300005347 Bacteria 1065
15 Ga0070659_100024849 3300005366 Bacteria 4596
16 Ga0070659_100602329 3300005366 Bacteria 944
17 Ga0070662_100741740 3300005457 Bacteria 832
18 Ga0068855_100152846 3300005563 Bacteria 2624
19 Ga0070664_100066919 3300005564 Bacteria 3069
20 Ga0070664_100738220 3300005564 Bacteria 918
21 Ga0075364_10557699 3300006051 Bacteria 783
22 Ga0105240_10060740 3300009093 Bacteria 4711
23 Ga0105239_11532016 3300010375 Bacteria 771
24 Ga0157371_10122234 3300013102 Bacteria 1851
25 Ga0163162_10486539 3300013306 Bacteria 1365
26 Ga0163161_10878284 3300017792 Bacteria 758
27 Ga0213872_10001407 3300021361 Bacteria 15816
28 Ga0213872_10003085 3300021361 Bacteria 9384
29 Ga0213872_10086099 3300021361 Bacteria 1408
30 Ga0209437_112869 3300025233 Bacteria 1210
31 Ga0209565_1004308 3300025263 Bacteria 4373
32 Ga0209455_1000121 3300025272 Bacteria 173350
33 Ga0209130_1000046 3300025284 Bacteria 236658
34 Ga0209564_1055349 3300025295 Bacteria 929
35 Ga0209256_1000007 3300025299 Bacteria 1136599
36 Ga0207426_1043095 3300025302 Bacteria 1388
37 Ga0207693_10170507 3300025915 Bacteria 1714
38 Ga0207657_10001256 3300025919 Bacteria 27132
39 Ga0207649_10005512 3300025920 Bacteria 6852
40 Ga0207690_10015390 3300025932 Bacteria 4635
41 Ga0207679_10003738 3300025945 Bacteria 9438
42 Ga0207679_10244613 3300025945 Bacteria 1522
43 Ga0207667_10053304 3300025949 Bacteria 4257
44 Ga0265323_10045695 3300028653 Bacteria 1572
45 Ga0265332_10000125 3300031238 Bacteria 63932
46 Ga0265328_10218077 3300031239 Bacteria 726
47 Ga0265331_10261651 3300031250 Unclassified 776
48 Ga0265327_10022415 3300031251 Bacteria 3776
49 Ga0265327_10053126 3300031251 Bacteria 2105
50 Ga0265316_10126901 3300031344 Bacteria 1923
51 Ga0265314_10051646 3300031711 Bacteria 2863
52 Ga0307412_10001534 3300031911 Bacteria 12776
53 Ga0307414_10279418 3300032004 Bacteria 1402
54 Ga0373939_0062048 3300035114 Bacteria 1193
55 Ga0373927_0587508 3300035695 Bacteria 736
56 Ga0373925_0583938 3300037068 Bacteria 920
57 Ga0395899_0007127 3300037312 Bacteria 8649
58 Ga0395899_0009595 3300037312 Bacteria 7430
59 Ga0395900_0010165 3300037418 Bacteria 9624
60 Ga0395905_0000111 3300037471 Bacteria 136345
61 Ga0395901_0179652 3300038443 Bacteria 2219
62 Ga0436361_0360225 3300039447 Bacteria 8555
63 Ga0436361_0369200 3300039447 Bacteria 1006
64 Ga0436361_0568666 3300039447 Bacteria 34601
65 Ga0436361_0633651 3300039447 Bacteria 1491
66 Ga0436361_0789400 3300039447 Bacteria 14582
67 Ga0439436_0085978 3300041404 Bacteria 875
68 Ga0451577_0000186 3300042876 Bacteria 131630
69 Ga0451577_0012040 3300042876 Bacteria 8138
70 Ga0451577_0032666 3300042876 Bacteria 4689
71 Ga0451577_0075135 3300042876 Bacteria 3013
72 Ga0451577_0107518 3300042876 Bacteria 2493
73 Ga0451577_0175652 3300042876 Bacteria 1931
74 Ga0451577_0502173 3300042876 Bacteria 1101
75 Ga0451577_1010612 3300042876 Bacteria 746
76 Ga0453683_0041744 3300044673 Bacteria 2881
77 Ga0453683_0127388 3300044673 Bacteria 1603
78 Ga0453683_0281096 3300044673 Bacteria 1063
79 Ga0466966_0012273 3300044684 Bacteria 5677
80 Ga0453684_0000069 3300044712 Bacteria 456439
81 Ga0453684_0000121 3300044712 Bacteria 341067
82 Ga0453684_0013411 3300044712 Bacteria 13311
83 Ga0453684_0053139 3300044712 Bacteria 5290
84 Ga0453684_0065690 3300044712 Bacteria 4625
85 Ga0453684_0096944 3300044712 Bacteria 3620
86 Ga0453684_0114202 3300044712 Bacteria 3274
87 Ga0453684_0289660 3300044712 Bacteria 1865
88 Ga0453684_0290916 3300044712 Bacteria 1860
89 Ga0453684_0776566 3300044712 Bacteria 1035
90 Ga0453684_0853517 3300044712 Bacteria 978
91 Ga0466959_0093622 3300045049 Bacteria 2156
92 Ga0451576_0011310 3300045051 Bacteria 10155
93 Ga0451576_0026268 3300045051 Bacteria 6264
94 Ga0451576_0028902 3300045051 Bacteria 5938
95 Ga0451576_0040091 3300045051 Bacteria 4958
96 Ga0451576_0040118 3300045051 Bacteria 4957
97 Ga0451576_0112193 3300045051 Bacteria 2837
98 Ga0451576_0142074 3300045051 Bacteria 2503
99 Ga0451576_0776070 3300045051 Bacteria 1006
100 Ga0451576_0894373 3300045051 Bacteria 932
101 Ga0495617_006569 3300046452 Bacteria 4072
102 Ga0495590_0310286 3300046457 Bacteria 594
103 Ga0495638_0001289 3300046460 Bacteria 23375
104 Ga0495605_0000773 3300046474 Bacteria 23060
105 Ga0495584_0000249 3300046491 Bacteria 38940
106 Ga0495585_0005781 3300046492 Bacteria 7757
107 Ga0495585_0103700 3300046492 Bacteria 1518
108 Ga0495607_0011627 3300046501 Bacteria 5850
109 Ga0495607_0033926 3300046501 Bacteria 3102
110 Ga0495607_0048879 3300046501 Bacteria 2470
111 Ga0495583_0000113 3300046506 Bacteria 136475
112 Ga0495610_0075672 3300046512 Bacteria 1558
113 Ga0495616_0001763 3300046513 Bacteria 14731
114 Ga0495616_0003019 3300046513 Bacteria 10927
115 Ga0495644_0000746 3300046523 Bacteria 13420
116 Ga0495644_0009647 3300046523 Bacteria 3717
117 Ga0495648_0000403 3300046524 Bacteria 47579
118 Ga0495609_0003082 3300046538 Bacteria 9771
119 Ga0495609_0015216 3300046538 Bacteria 3603
120 Ga0495633_0001110 3300046558 Bacteria 21652
121 Ga0495633_0008230 3300046558 Bacteria 5900
122 Ga0495656_0002649 3300046615 Bacteria 5969
123 Ga0495656_0134322 3300046615 Bacteria 1180
124 Ga0495611_0000847 3300046648 Bacteria 16785
125 Ga0495611_0002042 3300046648 Bacteria 9524
126 Ga0495611_0004768 3300046648 Bacteria 5827
127 Ga0495625_0016808 3300046660 Bacteria 5745
128 Ga0495625_0030800 3300046660 Bacteria 3998
129 Ga0495659_0000101 3300046664 Bacteria 37957
130 Ga0495661_0055796 3300046665 Bacteria 2366
131 Ga0495670_0014137 3300046691 Bacteria 3927
132 Ga0495670_0021964 3300046691 Bacteria 3150
133 Ga0495671_0005341 3300046692 Bacteria 7540
134 Ga0495671_0263811 3300046692 Bacteria 830
135 Ga0495636_0002428 3300047318 Bacteria 7140
136 Ga0495672_0035567 3300047320 Bacteria 3067
137 Ga0495683_0003539 3300047323 Bacteria 9088
138 Ga0495687_000807 3300047443 Bacteria 33697
139 Ga0495677_0001126 3300047445 Bacteria 10691
140 Ga0495685_000112 3300047447 Bacteria 28941
141 Ga0495673_0015967 3300047469 Bacteria 3852
142 Ga0496116_0033289 3300048919 Bacteria 3659
143 Ga0496118_0058397 3300048921 Bacteria 2883
144 Ga0496119_0079595 3300048922 Bacteria 1892
145 Ga0496120_0032237 3300048923 Bacteria 3161
146 Ga0496121_0001120 3300048924 Bacteria 47128
147 Ga0496121_0511055 3300048924 Bacteria 760
148 Ga0496122_0302134 3300048925 Bacteria 862
149 Ga0496123_0069844 3300048926 Bacteria 2202
150 Ga0496124_0071774 3300048927 Bacteria 2868
151 Ga0496125_0000011 3300048928 Bacteria 655895
152 Ga0496126_0007327 3300048929 Bacteria 12115
153 Ga0501310_011627 3300049130 Bacteria 998
154 Ga0495678_000436 3300049459 Bacteria 41678
155 Ga0495682_0000522 3300049460 Bacteria 26585
156 Ga0495682_0000532 3300049460 Bacteria 26301
157 Ga0501031_0272587 3300049568 Bacteria 1098
158 Ga0501032_0001898 3300049569 Bacteria 16499
159 Ga0501033_0005344 3300049570 Bacteria 10179
160 Ga0501034_0042364 3300049571 Bacteria 4608
161 Ga0501034_0191093 3300049571 Bacteria 2010
162 Ga0501034_0557729 3300049571 Bacteria 1054
163 Ga0501034_0631174 3300049571 Bacteria 974
164 Ga0501034_0993330 3300049571 Bacteria 723
165 Ga0501036_0000319 3300049572 Bacteria 33522
166 Ga0501037_0001674 3300049573 Bacteria 16119
167 Ga0501037_0089236 3300049573 Bacteria 2231
168 Ga0501038_0001134 3300049574 Bacteria 24160
169 Ga0501039_0459348 3300049575 Bacteria 1000
170 Ga0501043_0002846 3300049579 Bacteria 14452
171 Ga0501043_0050836 3300049579 Bacteria 3258
172 Ga0501043_0173494 3300049579 Bacteria 1682
173 Ga0501046_0004743 3300049580 Bacteria 12270
174 Ga0501046_0303116 3300049580 Bacteria 1166
175 Ga0501047_0046539 3300049581 Bacteria 4192
176 Ga0501279_012771 3300049775 Bacteria 1144
177 Ga0501035_0002071 3300049822 Bacteria 19950
178 Ga0501035_0157227 3300049822 Bacteria 1970
179 Ga0501044_0000322 3300049823 Bacteria 60519
180 nmdc:mga00v17_467964_c1 3300050491 Bacteria 818
181 Ga0500636_0082018 3300053177 Bacteria 1857
182 Ga0466962_0072853 3300061719 Bacteria 1641
183 2548847652 2547132512 Bacteria 3416496
184 2739613702 2739367655 Bacteria 4051151
185 2842721666 2842718218 Bacteria 4560148
186 2939636668 2939631187 Bacteria 6118131
187 2941482065
188 2974322241 2974320154 Bacteria 4571377
189 Ga0501031_0001344
190 JGI25155J39150_1000117
191 JGI25155J39150_1000227
192 JGI25162J39368_1003616
193 rootL2_10016633
194 rootL2_10035512
195 rootL2_10035513
196 JGI25160J50197_1084716
197 Ga0055529_1000095
198 Ga0055524_1000241
199 Ga0055543_1003454
200 Ga0065165_1000524
201 Ga0070660_100000336
202 Ga0070668_100487683
203 Ga0070659_100024849
204 Ga0070659_100602329
205 Ga0070662_100741740
206 Ga0068855_100152846
207 Ga0070664_100066919
208 Ga0070664_100738220
209 Ga0075364_10557699
210 Ga0105240_10060740
211 Ga0105239_11532016
212 Ga0157371_10122234
213 Ga0163162_10486539
214 Ga0163161_10878284
215 Ga0213872_10001407
216 Ga0213872_10003085
217 Ga0213872_10086099
218 Ga0209437_112869
219 Ga0209565_1004308
220 Ga0209455_1000121
221 Ga0209130_1000046
222 Ga0209564_1055349
223 Ga0209256_1000007
224 Ga0207426_1043095
225 Ga0207693_10170507
226 Ga0207657_10001256
227 Ga0207649_10005512
228 Ga0207690_10015390
229 Ga0207679_10003738
230 Ga0207679_10244613
231 Ga0207667_10053304
232 Ga0265323_10045695
233 Ga0265332_10000125
234 Ga0265328_10218077
235 Ga0265331_10261651
236 Ga0265327_10022415
237 Ga0265327_10053126
238 Ga0265316_10126901
239 Ga0265314_10051646
240 Ga0307412_10001534
241 Ga0307414_10279418
242 Ga0373939_0062048
243 Ga0373927_0587508
244 Ga0373925_0583938
245 Ga0395899_0007127
246 Ga0395899_0009595
247 Ga0395900_0010165
248 Ga0395905_0000111
249 Ga0395901_0179652
250 Ga0436361_0360225
251 Ga0436361_0369200
252 Ga0436361_0568666
253 Ga0436361_0633651
254 Ga0436361_0789400
255 Ga0439436_0085978
256 Ga0451577_0000186
257 Ga0451577_0012040
258 Ga0451577_0032666
259 Ga0451577_0075135
260 Ga0451577_0107518
261 Ga0451577_0175652
262 Ga0451577_0502173
263 Ga0451577_1010612
264 Ga0453683_0041744
265 Ga0453683_0127388
266 Ga0453683_0281096
267 Ga0466966_0012273
268 Ga0453684_0000069
269 Ga0453684_0000121
270 Ga0453684_0013411
271 Ga0453684_0053139
272 Ga0453684_0065690
273 Ga0453684_0096944
274 Ga0453684_0114202
275 Ga0453684_0289660
276 Ga0453684_0290916
277 Ga0453684_0776566
278 Ga0453684_0853517
279 Ga0466959_0093622
280 Ga0451576_0011310
281 Ga0451576_0026268
282 Ga0451576_0028902
283 Ga0451576_0040091
284 Ga0451576_0040118
285 Ga0451576_0112193
286 Ga0451576_0142074
287 Ga0451576_0776070
288 Ga0451576_0894373
289 Ga0495617_006569
290 Ga0495590_0310286
291 Ga0495638_0001289
292 Ga0495605_0000773
293 Ga0495584_0000249
294 Ga0495585_0005781
295 Ga0495585_0103700
296 Ga0495607_0011627
297 Ga0495607_0033926
298 Ga0495607_0048879
299 Ga0495583_0000113
300 Ga0495610_0075672
301 Ga0495616_0001763
302 Ga0495616_0003019
303 Ga0495644_0000746
304 Ga0495644_0009647
305 Ga0495648_0000403
306 Ga0495609_0003082
307 Ga0495609_0015216
308 Ga0495633_0001110
309 Ga0495633_0008230
310 Ga0495656_0002649
311 Ga0495656_0134322
312 Ga0495611_0000847
313 Ga0495611_0002042
314 Ga0495611_0004768
315 Ga0495625_0016808
316 Ga0495625_0030800
317 Ga0495659_0000101
318 Ga0495661_0055796
319 Ga0495670_0014137
320 Ga0495670_0021964
321 Ga0495671_0005341
322 Ga0495671_0263811
323 Ga0495636_0002428
324 Ga0495672_0035567
325 Ga0495683_0003539
326 Ga0495687_000807
327 Ga0495677_0001126
328 Ga0495685_000112
329 Ga0495673_0015967
330 Ga0496116_0033289
331 Ga0496118_0058397
332 Ga0496119_0079595
333 Ga0496120_0032237
334 Ga0496121_0001120
335 Ga0496121_0511055
336 Ga0496122_0302134
337 Ga0496123_0069844
338 Ga0496124_0071774
339 Ga0496125_0000011
340 Ga0496126_0007327
341 Ga0501310_011627
342 Ga0495678_000436
343 Ga0495682_0000522
344 Ga0495682_0000532
345 Ga0501031_0272587
346 Ga0501032_0001898
347 Ga0501033_0005344
348 Ga0501034_0042364
349 Ga0501034_0191093
350 Ga0501034_0557729
351 Ga0501034_0631174
352 Ga0501034_0993330
353 Ga0501036_0000319
354 Ga0501037_0001674
355 Ga0501037_0089236
356 Ga0501038_0001134
357 Ga0501039_0459348
358 Ga0501043_0002846
359 Ga0501043_0050836
360 Ga0501043_0173494
361 Ga0501046_0004743
362 Ga0501046_0303116
363 Ga0501047_0046539
364 Ga0501279_012771
365 Ga0501035_0002071
366 Ga0501035_0157227
367 Ga0501044_0000322
368 nmdc:mga00v17_467964_c1
369 Ga0500636_0082018
370 Ga0466962_0072853
371 2548847652
372 2739613702
373 2842721666
374 2939636668
375 2941482065
376 2974322241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08909

DUF1854

Domain of unknown function (DUF1854)

50

178

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n58-assembly1.cif.gz_B crystal structure of s-adenosyl-l-homocysteine hydrolase from brucella melitensis in ternary complex with nad and adenosine, orthorhombic form 0.82 125 145
5ygq-assembly1.cif.gz_B crystal structure of ferredoxin nadp+ oxidoreductase from rhodopseudomonas palustris 0.8122 125 145
6i4p-assembly1.cif.gz_A crystal structure of the disease-causing g194c mutant of the human dihydrolipoamide dehydrogenase 0.7913 125 148
4ech-assembly1.cif.gz_A yeast polyamine oxidase fms1, h67q mutant 0.7863 125 145
3bnu-assembly1.cif.gz_A crystal structure of polyamine oxidase fms1 from saccharomyces cerevisiae in complex with bis-(3s,3's)-methylated spermine 0.7852 125 145
ID Description Score Start End Superfamily
af_Q9M305_27_76_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.8265 9 35 3.30.160.60
af_G5EDG8_2_147_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8117 14 34 3.50.50.60
3we0A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7885 15 37 3.50.50.60
af_Q8H191_31_475_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7784 125 144 3.50.50.60
3urhB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7703 120 148 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7V6L7D5-F1-model_v4 DUF1854 domain-containing protein 0.9439 123 163
AF-A0A259CIC6-F1-model_v4 DUF1854 domain-containing protein 0.9394 13 67
AF-A0A7V3RP26-F1-model_v4 DUF1854 domain-containing protein 0.9297 81 163
AF-A0A3L7SDE4-F1-model_v4 DUF1854 domain-containing protein 0.9214 11 163
AF-A0A3D4AYQ1-F1-model_v4 DUF1854 domain-containing protein 0.9202 85 163

Map