F289757

General Info

Members Datasets Scaffolds Average Seq Length
188 107 376 109

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0000023|Ga0451577_0000023_389307_389684
Length 125
Sequence MTRPPLARRVGGAQRRGTMSLPTEFSGVTVHTKANVYFDGKVVSHTVLFAGGAKKTLGLIYPGSYHFGTGAPERMEIVAGACRVQLDGATAGQDYAAGTYFDVPGKSGFTIEVKGGLCEYICSFL

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
29 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
38 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
39 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
40 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
41 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
42 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
43 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
46 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
47 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
48 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
49 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
50 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
51 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
58 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
69 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
73 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
74 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
75 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
76 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
77 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
78 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
105 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 1.06
Rhizosphere 90.96
Stem 0
Stem Tuber 0
Unclassified 13.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0000023 3300042876 Bacteria 419051
2 rootH2_10070941 3300003320 Bacteria 18619
3 rootL2_10057048 3300003322 Bacteria 12848
4 rootL2_10277371 3300003322 Bacteria 1226
5 Ga0070658_11741253 3300005327 Bacteria 539
6 Ga0070683_100136730 3300005329 Unclassified 2321
7 Ga0070677_10646940 3300005333 Unclassified 590
8 Ga0068869_100000092 3300005334 Bacteria 41548
9 Ga0068869_101235161 3300005334 Unclassified 658
10 Ga0068868_100011467 3300005338 Bacteria 6454
11 Ga0070689_100071480 3300005340 Bacteria 2711
12 Ga0070687_100708577 3300005343 Unclassified 704
13 Ga0070678_101839983 3300005456 Bacteria 571
14 Ga0068867_100000277 3300005459 Bacteria 33777
15 Ga0068853_100587584 3300005539 Bacteria 1057
16 Ga0068856_100030011 3300005614 Bacteria 5314
17 Ga0068859_101268718 3300005617 Unclassified 812
18 Ga0068861_101167311 3300005719 Unclassified 743
19 Ga0068858_101276263 3300005842 Unclassified 722
20 Ga0070717_10000079 3300006028 Bacteria 79689
21 Ga0070717_10603189 3300006028 Unclassified 996
22 Ga0070717_11407326 3300006028 Unclassified 633
23 Ga0097621_100252633 3300006237 Bacteria 1544
24 Ga0068871_100030145 3300006358 Bacteria 4269
25 Ga0075428_100407298 3300006844 Bacteria 1457
26 Ga0068865_100004023 3300006881 Bacteria 8833
27 Ga0068865_102164747 3300006881 Bacteria 506
28 Ga0097620_101268588 3300006931 Unclassified 812
29 Ga0105246_11680797 3300011119 Bacteria 603
30 Ga0157374_10222895 3300013296 Bacteria 1851
31 Ga0157378_11641586 3300013297 Bacteria 689
32 Ga0163162_10463005 3300013306 Bacteria 1399
33 Ga0157380_10954994 3300014326 Bacteria 887
34 Ga0157380_12243895 3300014326 Bacteria 610
35 Ga0207670_10052146 3300025936 Bacteria 2750
36 Ga0207704_10104901 3300025938 Bacteria 1895
37 Ga0207689_10000120 3300025942 Bacteria 65319
38 Ga0207689_10777383 3300025942 Unclassified 808
39 Ga0207661_10112263 3300025944 Unclassified 2307
40 Ga0207677_10030733 3300026023 Bacteria 3432
41 Ga0207648_10004413 3300026089 Bacteria 14450
42 Ga0207674_10529458 3300026116 Bacteria 1138
43 Ga0207683_10077521 3300026121 Bacteria 2943
44 Ga0265326_10087692 3300028558 Bacteria 881
45 Ga0265319_1000148 3300028563 Bacteria 52147
46 Ga0265319_1001516 3300028563 Bacteria 13782
47 Ga0265319_1036117 3300028563 Bacteria 1692
48 Ga0265334_10001154 3300028573 Bacteria 12920
49 Ga0265318_10000022 3300028577 Bacteria 162885
50 Ga0265318_10001301 3300028577 Bacteria 15020
51 Ga0265318_10001649 3300028577 Bacteria 12856
52 Ga0265318_10162233 3300028577 Bacteria 819
53 Ga0265323_10000004 3300028653 Bacteria 197761
54 Ga0265323_10002830 3300028653 Bacteria 7806
55 Ga0265323_10011732 3300028653 Bacteria 3528
56 Ga0265323_10036280 3300028653 Bacteria 1813
57 Ga0265323_10043047 3300028653 Bacteria 1632
58 Ga0265323_10060350 3300028653 Bacteria 1320
59 Ga0265322_10000721 3300028654 Bacteria 12088
60 Ga0265322_10060541 3300028654 Bacteria 1074
61 Ga0265336_10052181 3300028666 Bacteria 1233
62 Ga0265338_10448553 3300028800 Bacteria 914
63 Ga0265338_10651380 3300028800 Bacteria 730
64 Ga0265330_10012019 3300031235 Bacteria 4050
65 Ga0265330_10077833 3300031235 Bacteria 1431
66 Ga0265330_10152037 3300031235 Bacteria 983
67 Ga0265330_10190864 3300031235 Bacteria 867
68 Ga0265332_10084413 3300031238 Bacteria 1346
69 Ga0265320_10002888 3300031240 Bacteria 11783
70 Ga0265320_10005901 3300031240 Bacteria 7795
71 Ga0265320_10012059 3300031240 Bacteria 5054
72 Ga0265320_10026207 3300031240 Bacteria 3054
73 Ga0265320_10152032 3300031240 Bacteria 1045
74 Ga0265325_10382687 3300031241 Bacteria 618
75 Ga0265329_10262506 3300031242 Bacteria 578
76 Ga0265339_10113653 3300031249 Bacteria 1398
77 Ga0265339_10242577 3300031249 Bacteria 874
78 Ga0265331_10042363 3300031250 Bacteria 2208
79 Ga0265331_10121581 3300031250 Bacteria 1194
80 Ga0265331_10150013 3300031250 Bacteria 1059
81 Ga0265327_10000029 3300031251 Bacteria 352607
82 Ga0265327_10013006 3300031251 Bacteria 5563
83 Ga0265327_10415696 3300031251 Bacteria 583
84 Ga0265316_10011385 3300031344 Bacteria 8027
85 Ga0265316_10012056 3300031344 Bacteria 7768
86 Ga0265316_10059120 3300031344 Bacteria 2982
87 Ga0265316_10095556 3300031344 Bacteria 2263
88 Ga0265316_10262501 3300031344 Bacteria 1266
89 Ga0265316_10483379 3300031344 Bacteria 886
90 Ga0307513_10480583 3300031456 Bacteria 962
91 Ga0307509_10592784 3300031507 Bacteria 782
92 Ga0307408_100000011 3300031548 Bacteria 414737
93 Ga0265313_10006390 3300031595 Bacteria 8359
94 Ga0265313_10023064 3300031595 Bacteria 3360
95 Ga0307508_10000068 3300031616 Bacteria 119901
96 Ga0265314_10000432 3300031711 Bacteria 56071
97 Ga0265314_10000613 3300031711 Bacteria 43883
98 Ga0265314_10292476 3300031711 Archaea 917
99 Ga0265342_10002343 3300031712 Bacteria 16450
100 Ga0265342_10014678 3300031712 Bacteria 5191
101 Ga0265342_10060766 3300031712 Bacteria 2227
102 Ga0265342_10176673 3300031712 Bacteria 1171
103 Ga0307413_10470955 3300031824 Bacteria 1002
104 Ga0307407_10018965 3300031903 Bacteria 3492
105 Ga0307412_10005085 3300031911 Bacteria 7356
106 Ga0307409_100000072 3300031995 Bacteria 36405
107 Ga0307416_100000062 3300032002 Bacteria 99295
108 Ga0307414_10494523 3300032004 Bacteria 1081
109 Ga0307414_12277790 3300032004 Bacteria 506
110 Ga0307411_10052385 3300032005 Bacteria 2668
111 Ga0373951_0005436 3300035091 Bacteria 2960
112 Ga0373960_0360730 3300035121 Bacteria 553
113 Ga0373931_0739593 3300035691 Bacteria 652
114 Ga0395905_0000026 3300037471 Bacteria 315051
115 Ga0451802_1724911 3300041460 Bacteria 514
116 Ga0451804_0269814 3300041463 Bacteria 519
117 Ga0451841_1329775 3300041498 Bacteria 522
118 Ga0451847_0727801 3300041503 Bacteria 875
119 Ga0451843_0048062 3300041509 Bacteria 651
120 Ga0451843_0808386 3300041509 Bacteria 602
121 Ga0451853_0035096 3300041512 Bacteria 1190
122 Ga0451853_1986527 3300041512 Bacteria 569
123 Ga0439441_081769 3300042001 Bacteria 704
124 Ga0451577_0000734 3300042876 Bacteria 50721
125 Ga0451577_0000846 3300042876 Bacteria 45685
126 Ga0451577_0050022 3300042876 Bacteria 3731
127 Ga0451577_0181443 3300042876 Bacteria 1898
128 Ga0451577_0221210 3300042876 Bacteria 1711
129 Ga0451577_0341777 3300042876 Bacteria 1357
130 Ga0451577_0839110 3300042876 Bacteria 829
131 Ga0453683_0029499 3300044673 Bacteria 3468
132 Ga0453683_0338101 3300044673 Unclassified 966
133 Ga0453684_0000019 3300044712 Bacteria 908702
134 Ga0453684_0005578 3300044712 Bacteria 24799
135 Ga0453684_0012369 3300044712 Bacteria 14093
136 Ga0453684_0035896 3300044712 Bacteria 6841
137 Ga0453684_0060719 3300044712 Bacteria 4858
138 Ga0453684_0283112 3300044712 Bacteria 1890
139 Ga0453684_0297812 3300044712 Bacteria 1834
140 Ga0453684_2234680 3300044712 Unclassified 545
141 Ga0451576_0000098 3300045051 Bacteria 220454
142 Ga0451576_0000379 3300045051 Bacteria 104282
143 Ga0451576_0005624 3300045051 Bacteria 15650
144 Ga0451576_0082763 3300045051 Bacteria 3338
145 Ga0451576_0399833 3300045051 Bacteria 1440
146 Ga0451576_2547808 3300045051 Bacteria 522
147 Ga0501032_0001188 3300049569 Bacteria 20866
148 Ga0501032_0003696 3300049569 Bacteria 11615
149 Ga0501033_0015821 3300049570 Bacteria 5716
150 Ga0501034_0003369 3300049571 Bacteria 18243
151 Ga0501034_0034773 3300049571 Bacteria 5109
152 Ga0501036_0002558 3300049572 Bacteria 14302
153 Ga0501036_0174042 3300049572 Bacteria 1813
154 Ga0501037_0017042 3300049573 Bacteria 5344
155 Ga0501037_0380297 3300049573 Unclassified 970
156 Ga0501038_0000717 3300049574 Bacteria 29617
157 Ga0501038_0397295 3300049574 Unclassified 1067
158 Ga0501038_0667105 3300049574 Unclassified 781
159 Ga0501039_0002533 3300049575 Bacteria 13633
160 Ga0501040_1383404 3300049576 Unclassified 511
161 Ga0501042_0006472 3300049578 Bacteria 7606
162 Ga0501043_0028679 3300049579 Unclassified 4369
163 Ga0501043_0035885 3300049579 Bacteria 3901
164 Ga0501043_0328236 3300049579 Unclassified 1165
165 Ga0501046_0011004 3300049580 Bacteria 7754
166 Ga0501046_0043610 3300049580 Bacteria 3570
167 Ga0501046_0199631 3300049580 Bacteria 1488
168 Ga0501046_0335969 3300049580 Unclassified 1098
169 Ga0501047_0005851 3300049581 Bacteria 11574
170 Ga0501047_0119425 3300049581 Bacteria 2518
171 Ga0501048_0065250 3300049582 Bacteria 2574
172 Ga0501067_0162394 3300049583 Bacteria 1244
173 Ga0501068_0339479 3300049584 Bacteria 964
174 Ga0501069_0343568 3300049585 Unclassified 879
175 Ga0501243_000168 3300049675 Bacteria 7652
176 Ga0501080_0065913 3300049742 Bacteria 3368
177 Ga0501080_0075047 3300049742 Unclassified 3145
178 Ga0501083_0002828 3300049744 Bacteria 11990
179 Ga0501035_0001895 3300049822 Bacteria 21033
180 Ga0501044_0002504 3300049823 Bacteria 20948
181 Ga0501044_0579581 3300049823 Unclassified 1016
182 Ga0501044_0647945 3300049823 Unclassified 945
183 Ga0501044_0966035 3300049823 Bacteria 725
184 Ga0501045_0160188 3300049824 Bacteria 1675
185 Ga0500642_0440968 3300053130 Bacteria 561
186 Ga0500573_0450531 3300053140 Unclassified 595
187 Ga0501082_0121132 3300060353 Bacteria 2268
188 2788435428 2786546940 Bacteria 6396474
189 Ga0451577_0000023
190 rootH2_10070941
191 rootL2_10057048
192 rootL2_10277371
193 Ga0070658_11741253
194 Ga0070683_100136730
195 Ga0070677_10646940
196 Ga0068869_100000092
197 Ga0068869_101235161
198 Ga0068868_100011467
199 Ga0070689_100071480
200 Ga0070687_100708577
201 Ga0070678_101839983
202 Ga0068867_100000277
203 Ga0068853_100587584
204 Ga0068856_100030011
205 Ga0068859_101268718
206 Ga0068861_101167311
207 Ga0068858_101276263
208 Ga0070717_10000079
209 Ga0070717_10603189
210 Ga0070717_11407326
211 Ga0097621_100252633
212 Ga0068871_100030145
213 Ga0075428_100407298
214 Ga0068865_100004023
215 Ga0068865_102164747
216 Ga0097620_101268588
217 Ga0105246_11680797
218 Ga0157374_10222895
219 Ga0157378_11641586
220 Ga0163162_10463005
221 Ga0157380_10954994
222 Ga0157380_12243895
223 Ga0207670_10052146
224 Ga0207704_10104901
225 Ga0207689_10000120
226 Ga0207689_10777383
227 Ga0207661_10112263
228 Ga0207677_10030733
229 Ga0207648_10004413
230 Ga0207674_10529458
231 Ga0207683_10077521
232 Ga0265326_10087692
233 Ga0265319_1000148
234 Ga0265319_1001516
235 Ga0265319_1036117
236 Ga0265334_10001154
237 Ga0265318_10000022
238 Ga0265318_10001301
239 Ga0265318_10001649
240 Ga0265318_10162233
241 Ga0265323_10000004
242 Ga0265323_10002830
243 Ga0265323_10011732
244 Ga0265323_10036280
245 Ga0265323_10043047
246 Ga0265323_10060350
247 Ga0265322_10000721
248 Ga0265322_10060541
249 Ga0265336_10052181
250 Ga0265338_10448553
251 Ga0265338_10651380
252 Ga0265330_10012019
253 Ga0265330_10077833
254 Ga0265330_10152037
255 Ga0265330_10190864
256 Ga0265332_10084413
257 Ga0265320_10002888
258 Ga0265320_10005901
259 Ga0265320_10012059
260 Ga0265320_10026207
261 Ga0265320_10152032
262 Ga0265325_10382687
263 Ga0265329_10262506
264 Ga0265339_10113653
265 Ga0265339_10242577
266 Ga0265331_10042363
267 Ga0265331_10121581
268 Ga0265331_10150013
269 Ga0265327_10000029
270 Ga0265327_10013006
271 Ga0265327_10415696
272 Ga0265316_10011385
273 Ga0265316_10012056
274 Ga0265316_10059120
275 Ga0265316_10095556
276 Ga0265316_10262501
277 Ga0265316_10483379
278 Ga0307513_10480583
279 Ga0307509_10592784
280 Ga0307408_100000011
281 Ga0265313_10006390
282 Ga0265313_10023064
283 Ga0307508_10000068
284 Ga0265314_10000432
285 Ga0265314_10000613
286 Ga0265314_10292476
287 Ga0265342_10002343
288 Ga0265342_10014678
289 Ga0265342_10060766
290 Ga0265342_10176673
291 Ga0307413_10470955
292 Ga0307407_10018965
293 Ga0307412_10005085
294 Ga0307409_100000072
295 Ga0307416_100000062
296 Ga0307414_10494523
297 Ga0307414_12277790
298 Ga0307411_10052385
299 Ga0373951_0005436
300 Ga0373960_0360730
301 Ga0373931_0739593
302 Ga0395905_0000026
303 Ga0451802_1724911
304 Ga0451804_0269814
305 Ga0451841_1329775
306 Ga0451847_0727801
307 Ga0451843_0048062
308 Ga0451843_0808386
309 Ga0451853_0035096
310 Ga0451853_1986527
311 Ga0439441_081769
312 Ga0451577_0000734
313 Ga0451577_0000846
314 Ga0451577_0050022
315 Ga0451577_0181443
316 Ga0451577_0221210
317 Ga0451577_0341777
318 Ga0451577_0839110
319 Ga0453683_0029499
320 Ga0453683_0338101
321 Ga0453684_0000019
322 Ga0453684_0005578
323 Ga0453684_0012369
324 Ga0453684_0035896
325 Ga0453684_0060719
326 Ga0453684_0283112
327 Ga0453684_0297812
328 Ga0453684_2234680
329 Ga0451576_0000098
330 Ga0451576_0000379
331 Ga0451576_0005624
332 Ga0451576_0082763
333 Ga0451576_0399833
334 Ga0451576_2547808
335 Ga0501032_0001188
336 Ga0501032_0003696
337 Ga0501033_0015821
338 Ga0501034_0003369
339 Ga0501034_0034773
340 Ga0501036_0002558
341 Ga0501036_0174042
342 Ga0501037_0017042
343 Ga0501037_0380297
344 Ga0501038_0000717
345 Ga0501038_0397295
346 Ga0501038_0667105
347 Ga0501039_0002533
348 Ga0501040_1383404
349 Ga0501042_0006472
350 Ga0501043_0028679
351 Ga0501043_0035885
352 Ga0501043_0328236
353 Ga0501046_0011004
354 Ga0501046_0043610
355 Ga0501046_0199631
356 Ga0501046_0335969
357 Ga0501047_0005851
358 Ga0501047_0119425
359 Ga0501048_0065250
360 Ga0501067_0162394
361 Ga0501068_0339479
362 Ga0501069_0343568
363 Ga0501243_000168
364 Ga0501080_0065913
365 Ga0501080_0075047
366 Ga0501083_0002828
367 Ga0501035_0001895
368 Ga0501044_0002504
369 Ga0501044_0579581
370 Ga0501044_0647945
371 Ga0501044_0966035
372 Ga0501045_0160188
373 Ga0500642_0440968
374 Ga0500573_0450531
375 Ga0501082_0121132
376 2788435428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06865

Ppnp

Pyrimidine/purine nucleoside phosphorylase

32

124

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oyz-assembly1.cif.gz_A-2 crystal structure of unknown function protein vpa0057 from vibrio parahaemolyticus (targeted domain 2-94) 0.9578 13 107
7eym-assembly1.cif.gz_B crystal structure of vibrio cholerae ppnp 0.9536 13 107
2oyz-assembly1.cif.gz_A-2 crystal structure of unknown function protein vpa0057 from vibrio parahaemolyticus (targeted domain 2-94) 0.9383 13 107
7eyj-assembly1.cif.gz_A crystal structure of escherichia coli ppnp 0.9366 13 107
7eym-assembly1.cif.gz_B crystal structure of vibrio cholerae ppnp 0.9342 13 107
ID Description Score Start End Superfamily
2oyzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9557 13 107 2.60.120.10
af_P0C037_1_93_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9513 13 106 2.60.120.10
af_P0C037_1_93_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9415 13 106 2.60.120.10
2oyzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9358 13 107 2.60.120.10
3hqxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8997 6 107 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A836TFZ2-F1-model_v4 Pyrimidine/purine nucleoside phosphorylase 0.9788 19 107 GO:0004731
GO:0005829
GO:0016154
AF-A0A432DCA5-F1-model_v4 deleted 0.9779 13 107
AF-A0A2N0XZJ2-F1-model_v4 Pyrimidine/purine nucleoside phosphorylase (EC 2.4.2.1) (EC 2.4.2.2) (Adenosine phosphorylase) (Cytidine phosphorylase) (Guanosine phosphorylase) (Inosine phosphorylase) (Thymidine phosphorylase) (Uridine phosphorylase) (Xanthosine phosphorylase) 0.9775 13 107 GO:0004731
GO:0004850
GO:0005829
GO:0009032
GO:0047847
GO:0047975
AF-A0A3D2UJL5-F1-model_v4 deleted 0.9753 26 107
AF-A0A2X2UYK1-F1-model_v4 Uncharacterized protein conserved in bacteria 0.9709 42 107 GO:0004731
GO:0005829
GO:0016154

Map