F289602

General Info

Members Datasets Scaffolds Average Seq Length
188 126 376 95

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100000069|Ga0307408_10000006912
Length 112
Sequence MQRIFTISLSFTYLCTMNISDETIDHISNLAKLRFEGDAKEAIKKDLEKIIGFMGKLSEVPTDNVEPLIFMNEEKNVLRADIPEVTITQAEALKNAPKKDSDYFRIPKVLDK

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
75 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
76 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
77 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
78 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
79 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
93 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
96 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
97 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
98 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
99 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
100 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
101 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
102 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
103 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
104 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
105 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
106 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
107 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
108 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
109 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
110 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
111 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
112 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
115 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
116 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
117 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
118 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
119 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
122 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
123 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
124 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
125 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
126 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.34
Metatranscriptomes 1.06
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.17
Nodule 0
Rhizoplane 2.66
Rhizosphere 70.74
Stem 0
Stem Tuber 0
Unclassified 26.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100000069 3300031548 Bacteria 120480
2 rootH1_10013611 3300003316 Bacteria 14253
3 rootH2_10031646 3300003320 Bacteria 23569
4 rootH2_10113995 3300003320 Bacteria 2547
5 rootH2_10123072 3300003320 Bacteria 5153
6 rootH2_10151803 3300003320 Bacteria 4133
7 rootH2_10298798 3300003320 Unclassified 1840
8 rootL2_10029207 3300003322 Bacteria 14691
9 rootL2_10037924 3300003322 Unclassified 1933
10 rootL2_10075349 3300003322 Bacteria 21885
11 rootL2_10091549 3300003322 Unclassified 1419
12 rootL2_10098539 3300003322 Bacteria 10950
13 rootH1_10017540 3300003323 Bacteria 39177
14 rootH1_10027174 3300003323 Bacteria 6308
15 rootH1_10027175 3300003323 Unclassified 4104
16 rootH1_10027193 3300003323 Bacteria 2635
17 rootH1_10036213 3300003323 Bacteria 11740
18 rootH1_10049268 3300003323 Bacteria 9583
19 rootH1_10058946 3300003323 Bacteria 3366
20 Ga0055530_10025341 3300003791 Bacteria 1659
21 Ga0055530_10079639 3300003791 Bacteria 690
22 Ga0065165_1000604 3300005262 Bacteria 52497
23 Ga0065165_1035688 3300005262 Bacteria 1524
24 Ga0065715_10000486 3300005293 Bacteria 12729
25 Ga0070682_100279750 3300005337 Unclassified 1216
26 Ga0070682_100510315 3300005337 Bacteria 933
27 Ga0070682_100657073 3300005337 Bacteria 835
28 Ga0070682_100715583 3300005337 Bacteria 804
29 Ga0070714_100926500 3300005435 Bacteria 846
30 Ga0070701_10936351 3300005438 Bacteria 600
31 Ga0070694_101102637 3300005444 Bacteria 662
32 Ga0070672_100603408 3300005543 Bacteria 956
33 Ga0070665_100616458 3300005548 Bacteria 1098
34 Ga0070704_101544109 3300005549 Bacteria 611
35 Ga0068855_100390792 3300005563 Bacteria 1526
36 Ga0068855_102267041 3300005563 Bacteria 544
37 Ga0068857_101009381 3300005577 Unclassified 801
38 Ga0068857_101403615 3300005577 Unclassified 679
39 Ga0068856_100077016 3300005614 Bacteria 3304
40 Ga0068856_102022066 3300005614 Bacteria 586
41 Ga0068852_101022841 3300005616 Unclassified 845
42 Ga0068859_101349107 3300005617 Unclassified 786
43 Ga0068863_100209672 3300005841 Bacteria 1876
44 Ga0068862_101928299 3300005844 Unclassified 601
45 Ga0070717_10290281 3300006028 Bacteria 1452
46 Ga0070717_10631166 3300006028 Bacteria 972
47 Ga0070716_100113200 3300006173 Bacteria 1685
48 Ga0070712_100224315 3300006175 Bacteria 1489
49 Ga0075366_10891111 3300006195 Bacteria 554
50 Ga0068871_100263468 3300006358 Unclassified 1504
51 Ga0075428_100065790 3300006844 Bacteria 3969
52 Ga0075428_100515334 3300006844 Unclassified 1279
53 Ga0075431_101852518 3300006847 Bacteria 559
54 Ga0097620_101349337 3300006931 Unclassified 786
55 Ga0111539_10005601 3300009094 Bacteria 16243
56 Ga0105237_12654235 3300009545 Bacteria 512
57 Ga0157371_10019183 3300013102 Bacteria 5046
58 Ga0157372_10341998 3300013307 Bacteria 1743
59 Ga0157372_10519225 3300013307 Bacteria 1388
60 Ga0157372_12026569 3300013307 Bacteria 661
61 Ga0157372_12221548 3300013307 Bacteria 630
62 Ga0157380_10005906 3300014326 Bacteria 8564
63 Ga0157380_10484971 3300014326 Bacteria 1196
64 Ga0157380_10501437 3300014326 Bacteria 1179
65 Ga0157380_11313068 3300014326 Bacteria 771
66 Ga0157380_11319857 3300014326 Unclassified 769
67 Ga0157380_13173098 3300014326 Unclassified 525
68 Ga0157376_10871007 3300014969 Unclassified 917
69 Ga0209050_1001591 3300025298 Bacteria 23468
70 Ga0209050_1033773 3300025298 Bacteria 1544
71 Ga0209050_1080250 3300025298 Bacteria 697
72 Ga0209257_1081067 3300025304 Bacteria 832
73 Ga0207671_11054998 3300025914 Bacteria 639
74 Ga0207700_11348959 3300025928 Bacteria 635
75 Ga0207664_10316650 3300025929 Bacteria 1376
76 Ga0207689_10870383 3300025942 Unclassified 760
77 Ga0207702_10022312 3300026078 Bacteria 5248
78 Ga0207702_10056364 3300026078 Bacteria 3336
79 Ga0207641_10142691 3300026088 Unclassified 2163
80 Ga0207641_12011552 3300026088 Unclassified 579
81 Ga0207674_11835026 3300026116 Unclassified 573
82 Ga0209981_1076389 3300027378 Bacteria 520
83 Ga0209974_10315975 3300027876 Bacteria 600
84 Ga0207428_10074781 3300027907 Bacteria 2656
85 Ga0268266_10284781 3300028379 Bacteria 1538
86 Ga0268265_11704557 3300028380 Unclassified 636
87 Ga0307515_10155013 3300028794 Bacteria 2370
88 Ga0307515_10661425 3300028794 Bacteria 658
89 Ga0265320_10547970 3300031240 Unclassified 511
90 Ga0265327_10136050 3300031251 Unclassified 1152
91 Ga0265327_10474340 3300031251 Bacteria 540
92 Ga0307513_10260969 3300031456 Bacteria 1522
93 Ga0307513_10481427 3300031456 Unclassified 961
94 Ga0307513_10666827 3300031456 Unclassified 747
95 Ga0307509_10011471 3300031507 Bacteria 10720
96 Ga0307509_10096735 3300031507 Bacteria 3003
97 Ga0316576_10163218 3300031727 Bacteria 1681
98 Ga0307405_10161941 3300031731 Bacteria 1586
99 Ga0307413_10228341 3300031824 Bacteria 1365
100 Ga0307410_10086452 3300031852 Bacteria 2215
101 Ga0307406_10421859 3300031901 Bacteria 1063
102 Ga0307406_12005204 3300031901 Unclassified 517
103 Ga0307412_10088724 3300031911 Bacteria 2158
104 Ga0307409_100290122 3300031995 Bacteria 1517
105 Ga0307416_100110847 3300032002 Bacteria 2417
106 Ga0307416_101142626 3300032002 Bacteria 884
107 Ga0307414_10000228 3300032004 Bacteria 36801
108 Ga0307414_10244286 3300032004 Bacteria 1488
109 Ga0307414_11871025 3300032004 Bacteria 560
110 Ga0307411_11380611 3300032005 Unclassified 644
111 Ga0307415_100184251 3300032126 Bacteria 1641
112 Ga0307415_102116080 3300032126 Bacteria 550
113 Ga0373956_0187612 3300035119 Bacteria 979
114 Ga0373935_0367776 3300035692 Bacteria 1028
115 Ga0373933_0421984 3300035724 Bacteria 871
116 Ga0316582_0505246 3300036647 Bacteria 833
117 Ga0316584_0159984 3300036712 Bacteria 1673
118 Ga0395905_0033655 3300037471 Bacteria 4813
119 Ga0395901_0000230 3300038443 Bacteria 70153
120 Ga0451793_1476421 3300041452 Bacteria 765
121 Ga0451798_0202492 3300041458 Bacteria 981
122 Ga0451807_1099171 3300041486 Bacteria 882
123 Ga0451807_2234220 3300041486 Bacteria 578
124 Ga0451847_0789094 3300041503 Unclassified 555
125 Ga0451851_0852456 3300041507 Unclassified 1523
126 Ga0439435_0328506 3300042436 Bacteria 528
127 Ga0451577_0043042 3300042876 Bacteria 4046
128 Ga0451577_1580402 3300042876 Bacteria 579
129 Ga0466982_0234102 3300044672 Bacteria 1083
130 Ga0453684_0004110 3300044712 Bacteria 31557
131 Ga0453684_1724187 3300044712 Unclassified 639
132 Ga0451576_0055502 3300045051 Unclassified 4144
133 Ga0451576_2323688 3300045051 Unclassified 549
134 Ga0451576_2519394 3300045051 Bacteria 525
135 Ga0495638_0000013 3300046460 Bacteria 430133
136 Ga0495610_0076511 3300046512 Bacteria 1548
137 Ga0495632_0034312 3300046519 Bacteria 2598
138 Ga0495657_0341913 3300046675 Unclassified 887
139 Ga0495676_0655439 3300047321 Bacteria 681
140 Ga0496110_0158390 3300048913 Bacteria 2052
141 Ga0501308_027591 3300049128 Unclassified 747
142 Ga0501305_112648 3300049161 Unclassified 516
143 Ga0501297_094093 3300049520 Unclassified 502
144 Ga0501071_1146072 3300049587 Bacteria 601
145 Ga0501076_0810097 3300049592 Unclassified 773
146 Ga0501198_000847 3300049649 Bacteria 3838
147 Ga0501202_009206 3300049652 Bacteria 1811
148 Ga0501202_129205 3300049652 Unclassified 642
149 Ga0501217_087697 3300049661 Unclassified 870
150 Ga0501222_003804 3300049662 Unclassified 2052
151 Ga0501223_000812 3300049663 Bacteria 7386
152 Ga0501236_003161 3300049670 Bacteria 1911
153 Ga0501236_110914 3300049670 Bacteria 548
154 Ga0501238_007846 3300049671 Bacteria 1394
155 Ga0501242_003593 3300049674 Bacteria 1685
156 Ga0501247_001927 3300049677 Bacteria 2098
157 Ga0501253_223853 3300049683 Unclassified 504
158 Ga0501257_009812 3300049686 Bacteria 2164
159 Ga0501257_062892 3300049686 Bacteria 940
160 Ga0501257_069837 3300049686 Bacteria 896
161 Ga0501258_015063 3300049687 Unclassified 863
162 Ga0501259_001221 3300049688 Bacteria 4275
163 Ga0501259_187147 3300049688 Unclassified 526
164 Ga0501221_252810 3300049704 Unclassified 507
165 Ga0501225_0015804 3300049705 Bacteria 2098
166 Ga0501234_044526 3300049707 Bacteria 731
167 Ga0501241_003180 3300049758 Bacteria 3119
168 Ga0501264_001024 3300049761 Unclassified 3375
169 Ga0501264_036762 3300049761 Bacteria 585
170 nmdc:mga08y16_1194983_c1 3300050511 Bacteria 731
171 nmdc:mga08y16_24321_c1 3300050511 Bacteria 6394
172 nmdc:mga08y16_266129_c1 3300050511 Bacteria 1770
173 Ga0500578_0207403 3300053086 Bacteria 1197
174 Ga0500557_010770 3300053105 Bacteria 2305
175 Ga0500562_026364 3300053108 Bacteria 1523
176 Ga0500655_052168 3300053133 Unclassified 816
177 Ga0500588_0401007 3300053146 Unclassified 522
178 Ga0500604_0005028 3300053151 Bacteria 3502
179 Ga0500616_0000013 3300053153 Bacteria 674172
180 Ga0500616_0173038 3300053153 Bacteria 979
181 Ga0500622_0000041 3300053156 Bacteria 170067
182 Ga0500622_0000045 3300053156 Bacteria 158316
183 Ga0500622_0012475 3300053156 Bacteria 4599
184 Ga0500627_0372723 3300053158 Unclassified 613
185 Ga0590071_184785 3300059421 Unclassified 547
186 2839989866 2839989709 Bacteria 3773432
187 2890807624 2890804823 Bacteria 3717572
188 2910249547 2910245624 Bacteria 6935613
189 Ga0307408_100000069
190 rootH1_10013611
191 rootH2_10031646
192 rootH2_10113995
193 rootH2_10123072
194 rootH2_10151803
195 rootH2_10298798
196 rootL2_10029207
197 rootL2_10037924
198 rootL2_10075349
199 rootL2_10091549
200 rootL2_10098539
201 rootH1_10017540
202 rootH1_10027174
203 rootH1_10027175
204 rootH1_10027193
205 rootH1_10036213
206 rootH1_10049268
207 rootH1_10058946
208 Ga0055530_10025341
209 Ga0055530_10079639
210 Ga0065165_1000604
211 Ga0065165_1035688
212 Ga0065715_10000486
213 Ga0070682_100279750
214 Ga0070682_100510315
215 Ga0070682_100657073
216 Ga0070682_100715583
217 Ga0070714_100926500
218 Ga0070701_10936351
219 Ga0070694_101102637
220 Ga0070672_100603408
221 Ga0070665_100616458
222 Ga0070704_101544109
223 Ga0068855_100390792
224 Ga0068855_102267041
225 Ga0068857_101009381
226 Ga0068857_101403615
227 Ga0068856_100077016
228 Ga0068856_102022066
229 Ga0068852_101022841
230 Ga0068859_101349107
231 Ga0068863_100209672
232 Ga0068862_101928299
233 Ga0070717_10290281
234 Ga0070717_10631166
235 Ga0070716_100113200
236 Ga0070712_100224315
237 Ga0075366_10891111
238 Ga0068871_100263468
239 Ga0075428_100065790
240 Ga0075428_100515334
241 Ga0075431_101852518
242 Ga0097620_101349337
243 Ga0111539_10005601
244 Ga0105237_12654235
245 Ga0157371_10019183
246 Ga0157372_10341998
247 Ga0157372_10519225
248 Ga0157372_12026569
249 Ga0157372_12221548
250 Ga0157380_10005906
251 Ga0157380_10484971
252 Ga0157380_10501437
253 Ga0157380_11313068
254 Ga0157380_11319857
255 Ga0157380_13173098
256 Ga0157376_10871007
257 Ga0209050_1001591
258 Ga0209050_1033773
259 Ga0209050_1080250
260 Ga0209257_1081067
261 Ga0207671_11054998
262 Ga0207700_11348959
263 Ga0207664_10316650
264 Ga0207689_10870383
265 Ga0207702_10022312
266 Ga0207702_10056364
267 Ga0207641_10142691
268 Ga0207641_12011552
269 Ga0207674_11835026
270 Ga0209981_1076389
271 Ga0209974_10315975
272 Ga0207428_10074781
273 Ga0268266_10284781
274 Ga0268265_11704557
275 Ga0307515_10155013
276 Ga0307515_10661425
277 Ga0265320_10547970
278 Ga0265327_10136050
279 Ga0265327_10474340
280 Ga0307513_10260969
281 Ga0307513_10481427
282 Ga0307513_10666827
283 Ga0307509_10011471
284 Ga0307509_10096735
285 Ga0316576_10163218
286 Ga0307405_10161941
287 Ga0307413_10228341
288 Ga0307410_10086452
289 Ga0307406_10421859
290 Ga0307406_12005204
291 Ga0307412_10088724
292 Ga0307409_100290122
293 Ga0307416_100110847
294 Ga0307416_101142626
295 Ga0307414_10000228
296 Ga0307414_10244286
297 Ga0307414_11871025
298 Ga0307411_11380611
299 Ga0307415_100184251
300 Ga0307415_102116080
301 Ga0373956_0187612
302 Ga0373935_0367776
303 Ga0373933_0421984
304 Ga0316582_0505246
305 Ga0316584_0159984
306 Ga0395905_0033655
307 Ga0395901_0000230
308 Ga0451793_1476421
309 Ga0451798_0202492
310 Ga0451807_1099171
311 Ga0451807_2234220
312 Ga0451847_0789094
313 Ga0451851_0852456
314 Ga0439435_0328506
315 Ga0451577_0043042
316 Ga0451577_1580402
317 Ga0466982_0234102
318 Ga0453684_0004110
319 Ga0453684_1724187
320 Ga0451576_0055502
321 Ga0451576_2323688
322 Ga0451576_2519394
323 Ga0495638_0000013
324 Ga0495610_0076511
325 Ga0495632_0034312
326 Ga0495657_0341913
327 Ga0495676_0655439
328 Ga0496110_0158390
329 Ga0501308_027591
330 Ga0501305_112648
331 Ga0501297_094093
332 Ga0501071_1146072
333 Ga0501076_0810097
334 Ga0501198_000847
335 Ga0501202_009206
336 Ga0501202_129205
337 Ga0501217_087697
338 Ga0501222_003804
339 Ga0501223_000812
340 Ga0501236_003161
341 Ga0501236_110914
342 Ga0501238_007846
343 Ga0501242_003593
344 Ga0501247_001927
345 Ga0501253_223853
346 Ga0501257_009812
347 Ga0501257_062892
348 Ga0501257_069837
349 Ga0501258_015063
350 Ga0501259_001221
351 Ga0501259_187147
352 Ga0501221_252810
353 Ga0501225_0015804
354 Ga0501234_044526
355 Ga0501241_003180
356 Ga0501264_001024
357 Ga0501264_036762
358 nmdc:mga08y16_1194983_c1
359 nmdc:mga08y16_24321_c1
360 nmdc:mga08y16_266129_c1
361 Ga0500578_0207403
362 Ga0500557_010770
363 Ga0500562_026364
364 Ga0500655_052168
365 Ga0500588_0401007
366 Ga0500604_0005028
367 Ga0500616_0000013
368 Ga0500616_0173038
369 Ga0500622_0000041
370 Ga0500622_0000045
371 Ga0500622_0012475
372 Ga0500627_0372723
373 Ga0590071_184785
374 2839989866
375 2890807624
376 2910249547

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02686

GatC

Glu-tRNAGln amidotransferase C subunit

35

106

0.92

Map