F289392

General Info

Members Datasets Scaffolds Average Seq Length
188 136 188 138

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_11779600|Ga0157372_117796001
Length 162
Sequence MILEKNATAAGGQGDGRTTDERTHMKNSAMEAGDTPSRRIDAKIKELGGWRGETLARVRAIIRDADPDVVEETKWQKPSNPSGVPVWEHDGIICTGETYKDKVKLTFLRGASLADPSGLFNSSLEGGTRRAIDFFEGDRIDEKALKALVRAAVEANVSARKK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
133 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.19
Nodule 0
Rhizoplane 3.72
Rhizosphere 87.77
Stem 0
Stem Tuber 0
Unclassified 5.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10013005 3300003320 Bacteria 23234
2 rootH1_10077715 3300003323 Bacteria 1953
3 Ga0070658_10240181 3300005327 Bacteria 1535
4 Ga0070658_10895461 3300005327 Bacteria 771
5 Ga0070676_10180002 3300005328 Bacteria 1374
6 Ga0068869_100956742 3300005334 Bacteria 744
7 Ga0070682_101027727 3300005337 Bacteria 686
8 Ga0070660_100009259 3300005339 Bacteria 6921
9 Ga0070661_100007217 3300005344 Bacteria 7661
10 Ga0070661_100421937 3300005344 Bacteria 1058
11 Ga0070661_100620944 3300005344 Bacteria 875
12 Ga0070692_10950693 3300005345 Bacteria 597
13 Ga0070668_100219109 3300005347 Bacteria 1569
14 Ga0070671_100291872 3300005355 Bacteria 1388
15 Ga0070659_101456475 3300005366 Bacteria 609
16 Ga0070709_10108243 3300005434 Bacteria 1864
17 Ga0070713_100096856 3300005436 Bacteria 2548
18 Ga0070694_100737358 3300005444 Bacteria 804
19 Ga0070663_100136644 3300005455 Bacteria 1867
20 Ga0070663_100204555 3300005455 Bacteria 1542
21 Ga0070663_101969058 3300005455 Bacteria 525
22 Ga0070679_100451874 3300005530 Bacteria 1230
23 Ga0070684_100239115 3300005535 Bacteria 1659
24 Ga0068853_100224747 3300005539 Bacteria 1716
25 Ga0068853_100350002 3300005539 Bacteria 1374
26 Ga0070672_100315105 3300005543 Bacteria 1329
27 Ga0070695_100607513 3300005545 Bacteria 859
28 Ga0070665_100158764 3300005548 Bacteria 2263
29 Ga0068855_100060887 3300005563 Bacteria 4412
30 Ga0070664_100191258 3300005564 Bacteria 1823
31 Ga0070664_100563197 3300005564 Bacteria 1054
32 Ga0068854_100194211 3300005578 Bacteria 1592
33 Ga0068856_100920626 3300005614 Bacteria 893
34 Ga0068856_102183642 3300005614 Bacteria 563
35 Ga0068852_100019488 3300005616 Bacteria 5371
36 Ga0068852_100036248 3300005616 Bacteria 4125
37 Ga0068852_100142254 3300005616 Bacteria 2221
38 Ga0068864_100672446 3300005618 Bacteria 1009
39 Ga0068851_10724590 3300005834 Bacteria 614
40 Ga0068858_100129871 3300005842 Bacteria 2362
41 Ga0068860_100287206 3300005843 Bacteria 1609
42 Ga0068862_100364669 3300005844 Bacteria 1343
43 Ga0081455_10169817 3300005937 Bacteria 1663
44 Ga0075363_100137308 3300006048 Bacteria 1375
45 Ga0075369_10046306 3300006186 Bacteria 1872
46 Ga0097621_100061523 3300006237 Bacteria 3079
47 Ga0097621_101259754 3300006237 Bacteria 698
48 Ga0075433_10909414 3300006852 Bacteria 767
49 Ga0075434_100324721 3300006871 Bacteria 1559
50 Ga0075436_100345526 3300006914 Bacteria 1071
51 Ga0075435_101232264 3300007076 Unclassified 655
52 Ga0105240_11744702 3300009093 Bacteria 649
53 Ga0105247_10125009 3300009101 Bacteria 1671
54 Ga0105237_10101665 3300009545 Bacteria 2866
55 Ga0105238_10023870 3300009551 Bacteria 6233
56 Ga0105249_11988948 3300009553 Bacteria 654
57 Ga0157371_10110687 3300013102 Bacteria 1949
58 Ga0157370_10010844 3300013104 Bacteria 9571
59 Ga0157369_10270507 3300013105 Bacteria 1771
60 Ga0157374_10077555 3300013296 Bacteria 3145
61 Ga0163162_11566598 3300013306 Bacteria 751
62 Ga0157372_11779600 3300013307 Bacteria 709
63 Ga0182008_10827479 3300014497 Bacteria 539
64 Ga0206356_11869657 3300020070 Bacteria 2753
65 Ga0206350_11260576 3300020080 Bacteria 598
66 Ga0213873_10000025 3300021358 Bacteria 86171
67 Ga0213876_10000004 3300021384 Bacteria 943822
68 Ga0213876_10064326 3300021384 Bacteria 1936
69 Ga0207656_10001921 3300025321 Bacteria 6911
70 Ga0207705_10125367 3300025909 Bacteria 1908
71 Ga0207671_10048140 3300025914 Bacteria 3155
72 Ga0207657_10260301 3300025919 Bacteria 1381
73 Ga0207649_10028121 3300025920 Bacteria 3308
74 Ga0207700_10519266 3300025928 Bacteria 1055
75 Ga0207664_10147306 3300025929 Bacteria 1997
76 Ga0207690_10445061 3300025932 Bacteria 1040
77 Ga0207679_10023034 3300025945 Bacteria 4251
78 Ga0207667_10123145 3300025949 Bacteria 2672
79 Ga0207667_10218136 3300025949 Bacteria 1955
80 Ga0207640_11639070 3300025981 Bacteria 580
81 Ga0207640_11776465 3300025981 Bacteria 557
82 Ga0207677_10450745 3300026023 Bacteria 1102
83 Ga0207703_11824799 3300026035 Bacteria 584
84 Ga0207639_10125132 3300026041 Bacteria 2119
85 Ga0207639_10187012 3300026041 Bacteria 1766
86 Ga0207678_10009726 3300026067 Bacteria 8455
87 Ga0207678_10097879 3300026067 Bacteria 2507
88 Ga0207698_10019161 3300026142 Bacteria 4679
89 Ga0207698_10374139 3300026142 Bacteria 1353
90 Ga0209813_10198119 3300027866 Bacteria 742
91 Ga0268266_10160740 3300028379 Bacteria 2032
92 Ga0265336_10132418 3300028666 Bacteria 742
93 Ga0307408_100232513 3300031548 Bacteria 1511
94 Ga0307408_100476234 3300031548 Bacteria 1088
95 Ga0307405_11491871 3300031731 Bacteria 594
96 Ga0307413_10832513 3300031824 Bacteria 778
97 Ga0307413_11450063 3300031824 Bacteria 605
98 Ga0307413_11588887 3300031824 Bacteria 580
99 Ga0307410_10000365 3300031852 Bacteria 17643
100 Ga0307410_11001649 3300031852 Bacteria 720
101 Ga0307406_11038512 3300031901 Bacteria 705
102 Ga0307407_10159525 3300031903 Bacteria 1475
103 Ga0307407_10543931 3300031903 Bacteria 857
104 Ga0307412_10174577 3300031911 Bacteria 1610
105 Ga0307412_10448609 3300031911 Bacteria 1062
106 Ga0307409_100023340 3300031995 Bacteria 4284
107 Ga0307409_100048080 3300031995 Bacteria 3243
108 Ga0307409_100179216 3300031995 Bacteria 1874
109 Ga0307409_101569085 3300031995 Bacteria 686
110 Ga0307409_101866317 3300031995 Bacteria 630
111 Ga0307416_100003438 3300032002 Bacteria 9303
112 Ga0307416_100097368 3300032002 Bacteria 2547
113 Ga0307416_101087323 3300032002 Bacteria 904
114 Ga0307414_10074306 3300032004 Bacteria 2462
115 Ga0307414_10840202 3300032004 Bacteria 839
116 Ga0307411_10023791 3300032005 Bacteria 3637
117 Ga0307411_10610800 3300032005 Bacteria 939
118 Ga0307411_10907994 3300032005 Bacteria 783
119 Ga0307411_11267221 3300032005 Bacteria 670
120 Ga0307415_100007038 3300032126 Bacteria 6119
121 Ga0307415_100392623 3300032126 Bacteria 1182
122 Ga0395899_0039958 3300037312 Bacteria 3510
123 Ga0395900_0020952 3300037418 Bacteria 6681
124 Ga0395900_0451493 3300037418 Bacteria 1242
125 Ga0395900_0465493 3300037418 Bacteria 1218
126 Ga0395898_0043133 3300037466 Bacteria 4446
127 Ga0395898_0302161 3300037466 Bacteria 1527
128 Ga0395905_0004866 3300037471 Bacteria 13842
129 Ga0395905_0137915 3300037471 Bacteria 2295
130 Ga0436364_1114142 3300037853 Bacteria 2039
131 Ga0436364_1136035 3300037853 Bacteria 1168
132 Ga0395901_0034766 3300038443 Bacteria 5206
133 Ga0436365_0025430 3300039437 Bacteria 855
134 Ga0436365_0401005 3300039437 Bacteria 54951
135 Ga0436365_1608922 3300039437 Bacteria 2094
136 Ga0450908_042846 3300042184 Bacteria 785
137 Ga0466969_0083951 3300044656 Bacteria 1516
138 Ga0466965_0123193 3300044683 Bacteria 1340
139 Ga0466961_0046841 3300044693 Bacteria 2765
140 Ga0466963_0267117 3300044694 Bacteria 1202
141 Ga0466964_0094548 3300044706 Bacteria 1306
142 Ga0466968_0023870 3300044735 Bacteria 2495
143 Ga0466970_0036421 3300044765 Bacteria 2606
144 Ga0466957_0161155 3300044842 Bacteria 1457
145 Ga0466957_0280486 3300044842 Bacteria 1115
146 Ga0466957_0579189 3300044842 Bacteria 784
147 Ga0466960_0021124 3300044901 Bacteria 2894
148 Ga0466959_0238258 3300045049 Bacteria 1257
149 Ga0466958_0017346 3300045836 Bacteria 4159
150 Ga0466958_0076270 3300045836 Bacteria 2058
151 Ga0466967_0068172 3300045976 Bacteria 3176
152 Ga0466967_0135797 3300045976 Bacteria 2287
153 Ga0466967_0231924 3300045976 Bacteria 1758
154 Ga0466967_2091289 3300045976 Bacteria 562
155 Ga0495629_0255583 3300046459 Bacteria 1205
156 Ga0495580_0094557 3300046472 Bacteria 2079
157 Ga0495630_0022763 3300046517 Bacteria 4629
158 Ga0495615_0188080 3300048090 Bacteria 632
159 Ga0496102_0628919 3300048905 Bacteria 997
160 Ga0496107_0067133 3300048910 Bacteria 2602
161 Ga0496110_0381068 3300048913 Bacteria 1285
162 Ga0496110_0529326 3300048913 Bacteria 1072
163 Ga0496112_0107653 3300048915 Bacteria 2758
164 Ga0496112_0477534 3300048915 Bacteria 1183
165 Ga0496114_0000092 3300048917 Bacteria 64974
166 Ga0496121_0222848 3300048924 Bacteria 1327
167 Ga0501303_015639 3300049526 Bacteria 761
168 Ga0501034_0401372 3300049571 Bacteria 1293
169 Ga0501034_0454935 3300049571 Bacteria 1198
170 Ga0501034_1153933 3300049571 Bacteria 654
171 Ga0501047_0258791 3300049581 Bacteria 1588
172 Ga0501069_0454548 3300049585 Bacteria 761
173 Ga0501070_0443715 3300049586 Bacteria 1047
174 Ga0501071_1006855 3300049587 Bacteria 644
175 Ga0501075_0488325 3300049591 Bacteria 940
176 Ga0501080_1088827 3300049742 Bacteria 690
177 Ga0501080_1808044 3300049742 Bacteria 513
178 Ga0501035_0211745 3300049822 Bacteria 1658
179 Ga0501044_0699632 3300049823 Bacteria 899
180 nmdc:mga0n895_350298_c1 3300050512 Bacteria 1496
181 nmdc:mga08x19_468036_c1 3300050514 Bacteria 888
182 nmdc:mga0a205_571489_c1 3300050515 Unclassified 985
183 Ga0495619_0607040 3300053085 Bacteria 748
184 Ga0500595_004588 3300053119 Bacteria 6163
185 Ga0500607_010417 3300053121 Bacteria 5533
186 Ga0500616_0178393 3300053153 Bacteria 958
187 Ga0501082_0265621 3300060353 Bacteria 1493
188 Ga0466962_0737614 3300061719 Bacteria 506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100158764 Ga0070665_1001587644 111
2 3300005563 Ga0068855_100060887 Ga0068855_1000608875 111
3 3300009545 Ga0105237_10101665 Ga0105237_101016652 111
4 3300009551 Ga0105238_10023870 Ga0105238_100238706 111
5 3300013296 Ga0157374_10077555 Ga0157374_100775555 111
6 3300025914 Ga0207671_10048140 Ga0207671_100481402 111
7 3300025949 Ga0207667_10123145 Ga0207667_101231452 111
8 3300028379 Ga0268266_10160740 Ga0268266_101607402 111
9 3300005434 Ga0070709_10108243 Ga0070709_101082434 123
10 3300006237 Ga0097621_100061523 Ga0097621_1000615232 123
11 3300020080 Ga0206350_11260576 Ga0206350_112605762 123
12 3300037853 Ga0436364_1136035 Ga0436364_1136035_271_759 123
13 3300046517 Ga0495630_0022763 Ga0495630_0022763_1224_1655 123
14 3300005328 Ga0070676_10180002 Ga0070676_101800023 130
15 3300005344 Ga0070661_100421937 Ga0070661_1004219372 130
16 3300005355 Ga0070671_100291872 Ga0070671_1002918721 130
17 3300005564 Ga0070664_100191258 Ga0070664_1001912581 130
18 3300005539 Ga0068853_100350002 Ga0068853_1003500022 131
19 3300005616 Ga0068852_100142254 Ga0068852_1001422544 131
20 3300009093 Ga0105240_11744702 Ga0105240_117447021 131
21 3300013102 Ga0157371_10110687 Ga0157371_101106873 131
22 3300013104 Ga0157370_10010844 Ga0157370_100108444 131
23 3300020070 Ga0206356_11869657 Ga0206356_118696576 131
24 3300025932 Ga0207690_10445061 Ga0207690_104450612 131
25 3300025949 Ga0207667_10218136 Ga0207667_102181364 131
26 3300026041 Ga0207639_10125132 Ga0207639_101251324 131
27 3300026142 Ga0207698_10019161 Ga0207698_100191617 131
28 3300044656 Ga0466969_0083951 Ga0466969_0083951_313_711 131
29 3300044693 Ga0466961_0046841 Ga0466961_0046841_801_1199 131
30 3300044694 Ga0466963_0267117 Ga0466963_0267117_34_429 131
31 3300044842 Ga0466957_0280486 Ga0466957_0280486_289_684 131
32 3300044842 Ga0466957_0579189 Ga0466957_0579189_366_761 131
33 3300045049 Ga0466959_0238258 Ga0466959_0238258_607_1005 131
34 3300045976 Ga0466967_2091289 Ga0466967_2091289_117_512 131
35 3300048917 Ga0496114_0000092 Ga0496114_0000092_8821_9216 131
36 3300061719 Ga0466962_0737614 Ga0466962_0737614_74_472 131
37 3300005344 Ga0070661_100620944 Ga0070661_1006209442 132
38 3300014497 Ga0182008_10827479 Ga0182008_108274791 132
39 3300021358 Ga0213873_10000025 Ga0213873_1000002587 132
40 3300021384 Ga0213876_10000004 Ga0213876_1000000411 132
41 3300025981 Ga0207640_11776465 Ga0207640_117764651 132
42 3300031548 Ga0307408_100476234 Ga0307408_1004762342 132
43 3300031911 Ga0307412_10174577 Ga0307412_101745774 132
44 3300032002 Ga0307416_100003438 Ga0307416_10000343812 132
45 3300032126 Ga0307415_100007038 Ga0307415_1000070384 132
46 3300042184 Ga0450908_042846 Ga0450908_042846_207_617 132
47 3300045836 Ga0466958_0076270 Ga0466958_0076270_1114_1512 132
48 3300046472 Ga0495580_0094557 Ga0495580_0094557_281_694 132
49 3300048090 Ga0495615_0188080 Ga0495615_0188080_67_465 132
50 3300049742 Ga0501080_1088827 Ga0501080_1088827_46_444 132
51 3300053121 Ga0500607_010417 Ga0500607_010417_3363_3776 132
52 3300005436 Ga0070713_100096856 Ga0070713_1000968562 133
53 3300005614 Ga0068856_100920626 Ga0068856_1009206262 133
54 3300025928 Ga0207700_10519266 Ga0207700_105192662 133
55 3300025929 Ga0207664_10147306 Ga0207664_101473062 133
56 3300032005 Ga0307411_11267221 Ga0307411_112672211 133
57 3300037312 Ga0395899_0039958 Ga0395899_0039958_656_1057 133
58 3300037418 Ga0395900_0020952 Ga0395900_0020952_2053_2454 133
59 3300037466 Ga0395898_0043133 Ga0395898_0043133_1393_1794 133
60 3300037471 Ga0395905_0004866 Ga0395905_0004866_9090_9491 133
61 3300038443 Ga0395901_0034766 Ga0395901_0034766_190_591 133
62 3300044901 Ga0466960_0021124 Ga0466960_0021124_357_758 133
63 3300045976 Ga0466967_0231924 Ga0466967_0231924_1092_1493 133
64 3300048910 Ga0496107_0067133 Ga0496107_0067133_949_1350 133
65 3300049585 Ga0501069_0454548 Ga0501069_0454548_336_737 133
66 3300005327 Ga0070658_10240181 Ga0070658_102401812 134
67 3300005327 Ga0070658_10895461 Ga0070658_108954612 134
68 3300005337 Ga0070682_101027727 Ga0070682_1010277272 134
69 3300005339 Ga0070660_100009259 Ga0070660_1000092592 134
70 3300005344 Ga0070661_100007217 Ga0070661_1000072175 134
71 3300005366 Ga0070659_101456475 Ga0070659_1014564752 134
72 3300005455 Ga0070663_100136644 Ga0070663_1001366442 134
73 3300005455 Ga0070663_101969058 Ga0070663_1019690581 134
74 3300005530 Ga0070679_100451874 Ga0070679_1004518742 134
75 3300005535 Ga0070684_100239115 Ga0070684_1002391153 134
76 3300005539 Ga0068853_100224747 Ga0068853_1002247472 134
77 3300005578 Ga0068854_100194211 Ga0068854_1001942112 134
78 3300005616 Ga0068852_100019488 Ga0068852_1000194882 134
79 3300005616 Ga0068852_100036248 Ga0068852_1000362482 134
80 3300005834 Ga0068851_10724590 Ga0068851_107245902 134
81 3300021384 Ga0213876_10064326 Ga0213876_100643262 134
82 3300025321 Ga0207656_10001921 Ga0207656_100019212 134
83 3300025909 Ga0207705_10125367 Ga0207705_101253672 134
84 3300025919 Ga0207657_10260301 Ga0207657_102603012 134
85 3300025920 Ga0207649_10028121 Ga0207649_100281212 134
86 3300025945 Ga0207679_10023034 Ga0207679_100230345 134
87 3300025981 Ga0207640_11639070 Ga0207640_116390702 134
88 3300026041 Ga0207639_10187012 Ga0207639_101870122 134
89 3300026067 Ga0207678_10009726 Ga0207678_100097267 134
90 3300026142 Ga0207698_10374139 Ga0207698_103741392 134
91 3300031824 Ga0307413_11450063 Ga0307413_114500632 134
92 3300031995 Ga0307409_101569085 Ga0307409_1015690852 134
93 3300032002 Ga0307416_101087323 Ga0307416_1010873232 134
94 3300032005 Ga0307411_10610800 Ga0307411_106108002 134
95 3300039437 Ga0436365_1608922 Ga0436365_1608922_422_838 134
96 3300049526 Ga0501303_015639 Ga0501303_015639_217_621 134
97 3300013105 Ga0157369_10270507 Ga0157369_102705071 135
98 3300031731 Ga0307405_11491871 Ga0307405_114918711 135
99 3300049571 Ga0501034_0401372 Ga0501034_0401372_336_752 135
100 3300049571 Ga0501034_0454935 Ga0501034_0454935_295_711 135
101 3300049571 Ga0501034_1153933 Ga0501034_1153933_152_568 135
102 3300049581 Ga0501047_0258791 Ga0501047_0258791_863_1279 135
103 3300053085 Ga0495619_0607040 Ga0495619_0607040_310_732 135
104 3300053153 Ga0500616_0178393 Ga0500616_0178393_370_837 135
105 3300003323 rootH1_10077715 rootH1_100777153 136
106 3300049591 Ga0501075_0488325 Ga0501075_0488325_373_783 136
107 3300031824 Ga0307413_11588887 Ga0307413_115888871 137
108 3300031852 Ga0307410_10000365 Ga0307410_1000036514 137
109 3300031852 Ga0307410_11001649 Ga0307410_110016492 137
110 3300031903 Ga0307407_10543931 Ga0307407_105439312 137
111 3300031911 Ga0307412_10448609 Ga0307412_104486091 137
112 3300031995 Ga0307409_100023340 Ga0307409_1000233407 137
113 3300031995 Ga0307409_100048080 Ga0307409_1000480805 137
114 3300031995 Ga0307409_100179216 Ga0307409_1001792162 137
115 3300031995 Ga0307409_101866317 Ga0307409_1018663171 137
116 3300032002 Ga0307416_100097368 Ga0307416_1000973682 137
117 3300032004 Ga0307414_10074306 Ga0307414_100743062 137
118 3300032004 Ga0307414_10840202 Ga0307414_108402022 137
119 3300032005 Ga0307411_10023791 Ga0307411_100237913 137
120 3300032005 Ga0307411_10907994 Ga0307411_109079942 137
121 3300032126 Ga0307415_100392623 Ga0307415_1003926232 137
122 3300037853 Ga0436364_1114142 Ga0436364_1114142_1358_1789 137
123 3300039437 Ga0436365_0025430 Ga0436365_0025430_225_656 137
124 3300045976 Ga0466967_0068172 Ga0466967_0068172_2719_3150 137
125 3300048913 Ga0496110_0529326 Ga0496110_0529326_373_804 137
126 3300048915 Ga0496112_0107653 Ga0496112_0107653_97_522 137
127 3300048924 Ga0496121_0222848 Ga0496121_0222848_487_930 137
128 3300053119 Ga0500595_004588 Ga0500595_004588_1294_1737 137
129 3300005345 Ga0070692_10950693 Ga0070692_109506931 138
130 3300005444 Ga0070694_100737358 Ga0070694_1007373581 138
131 3300005545 Ga0070695_100607513 Ga0070695_1006075131 138
132 3300005614 Ga0068856_102183642 Ga0068856_1021836422 138
133 3300006852 Ga0075433_10909414 Ga0075433_109094141 138
134 3300006871 Ga0075434_100324721 Ga0075434_1003247212 138
135 3300006914 Ga0075436_100345526 Ga0075436_1003455262 138
136 3300007076 Ga0075435_101232264 Ga0075435_1012322641 138
137 3300037418 Ga0395900_0451493 Ga0395900_0451493_548_976 138
138 3300037466 Ga0395898_0302161 Ga0395898_0302161_95_523 138
139 3300048915 Ga0496112_0477534 Ga0496112_0477534_190_606 138
140 3300049586 Ga0501070_0443715 Ga0501070_0443715_45_461 138
141 3300049742 Ga0501080_1808044 Ga0501080_1808044_31_447 138
142 3300049823 Ga0501044_0699632 Ga0501044_0699632_197_613 138
143 3300050512 nmdc:mga0n895_350298_c1 nmdc:mga0n895_350298_c1_678_1094 138
144 3300050514 nmdc:mga08x19_468036_c1 nmdc:mga08x19_468036_c1_223_639 138
145 3300050515 nmdc:mga0a205_571489_c1 nmdc:mga0a205_571489_c1_115_531 138
146 3300005334 Ga0068869_100956742 Ga0068869_1009567421 139
147 3300005347 Ga0070668_100219109 Ga0070668_1002191092 139
148 3300005455 Ga0070663_100204555 Ga0070663_1002045553 139
149 3300005543 Ga0070672_100315105 Ga0070672_1003151053 139
150 3300005564 Ga0070664_100563197 Ga0070664_1005631972 139
151 3300005618 Ga0068864_100672446 Ga0068864_1006724462 139
152 3300005842 Ga0068858_100129871 Ga0068858_1001298712 139
153 3300005843 Ga0068860_100287206 Ga0068860_1002872062 139
154 3300005844 Ga0068862_100364669 Ga0068862_1003646692 139
155 3300006048 Ga0075363_100137308 Ga0075363_1001373081 139
156 3300006186 Ga0075369_10046306 Ga0075369_100463064 139
157 3300006237 Ga0097621_101259754 Ga0097621_1012597542 139
158 3300009101 Ga0105247_10125009 Ga0105247_101250092 139
159 3300009553 Ga0105249_11988948 Ga0105249_119889482 139
160 3300013306 Ga0163162_11566598 Ga0163162_115665982 139
161 3300026023 Ga0207677_10450745 Ga0207677_104507451 139
162 3300026035 Ga0207703_11824799 Ga0207703_118247991 139
163 3300026067 Ga0207678_10097879 Ga0207678_100978792 139
164 3300027866 Ga0209813_10198119 Ga0209813_101981192 139
165 3300031824 Ga0307413_10832513 Ga0307413_108325132 139
166 3300031901 Ga0307406_11038512 Ga0307406_110385122 139
167 3300031903 Ga0307407_10159525 Ga0307407_101595252 139
168 3300037471 Ga0395905_0137915 Ga0395905_0137915_431_871 139
169 3300039437 Ga0436365_0401005 Ga0436365_0401005_47198_47701 139
170 3300046459 Ga0495629_0255583 Ga0495629_0255583_619_1062 139
171 3300048905 Ga0496102_0628919 Ga0496102_0628919_175_621 139
172 3300048913 Ga0496110_0381068 Ga0496110_0381068_689_1138 139
173 3300060353 Ga0501082_0265621 Ga0501082_0265621_1015_1482 139
174 3300031548 Ga0307408_100232513 Ga0307408_1002325131 141
175 3300037418 Ga0395900_0465493 Ga0395900_0465493_693_1148 141
176 3300049822 Ga0501035_0211745 Ga0501035_0211745_721_1152 141
177 3300005937 Ga0081455_10169817 Ga0081455_101698172 143
178 3300003320 rootH2_10013005 rootH2_1001300523 145
179 3300013307 Ga0157372_11779600 Ga0157372_117796001 145
180 3300028666 Ga0265336_10132418 Ga0265336_101324181 145
181 3300044683 Ga0466965_0123193 Ga0466965_0123193_656_1102 145
182 3300044706 Ga0466964_0094548 Ga0466964_0094548_419_865 145
183 3300044735 Ga0466968_0023870 Ga0466968_0023870_95_541 145
184 3300044765 Ga0466970_0036421 Ga0466970_0036421_108_554 145
185 3300044842 Ga0466957_0161155 Ga0466957_0161155_44_490 145
186 3300045836 Ga0466958_0017346 Ga0466958_0017346_2423_2869 145
187 3300045976 Ga0466967_0135797 Ga0466967_0135797_1759_2205 145
188 3300049587 Ga0501071_1006855 Ga0501071_1006855_73_561 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

51

153

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.7018 23 145
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6721 23 145
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6716 35 145
6g4r-assembly1.cif.gz_E corynebacterium glutamicum oxyr c206s mutant, h2o2-bound 0.5591 111 144
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.5566 35 145
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7161 27 140 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6838 27 140 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6722 35 142 3.90.1150.200
af_B8A580_83_200_2.60.40.3210 Mainly Beta;Sandwich;Immunoglobulin-like;Zona pellucida, ZP-N domain 0.6597 76 121 2.60.40.3210
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6371 39 141 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A3E1RH66-F1-model_v4 YdhG-like domain-containing protein 0.9983 73 145
AF-A0A353Y669-F1-model_v4 YdhG-like domain-containing protein 0.9936 16 145
AF-A0A1A6B7E1-F1-model_v4 YdhG-like domain-containing protein 0.9929 32 142
AF-A0A370D3G0-F1-model_v4 deleted 0.9916 20 140
AF-A0A4V5MSA1-F1-model_v4 deleted 0.9903 20 140

Feature Viewer

pLDDT pTM Quality
89.64 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map