F288932

General Info

Members Datasets Scaffolds Average Seq Length
188 132 186 183

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100236756|Ga0070711_1002367562
Length 199
Sequence MPFHFQALEIEGVILIEPKVYADTRGFFMESYKRSDFEAAGVAGFFVQENHSQSRNGILRGLHYQCAPKAQGKLVRVIAGKIYDVAVDVREQSPTRGKWVAAPLSAENRRMLYIPPWCAHGFLVLSEEAEVIYKTTEEYSPDHERGILWNDPQLSISWPIVNPILSERDQLWPSLPSAAMPADVEISRVKAPGTTPTVK

Samples

Sample ID Description Type Environment
1 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
2 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
79 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
80 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
90 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
91 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
92 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 2.66
Rhizosphere 93.09
Stem 0
Stem Tuber 0
Unclassified 3.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10009352 3300002075 Bacteria 2207
2 Ga0065707_10084428 3300005295 Bacteria 7211
3 Ga0070666_10568074 3300005335 Unclassified 826
4 Ga0070661_101059075 3300005344 Unclassified 674
5 Ga0070674_100028242 3300005356 Bacteria 3683
6 Ga0070667_100060405 3300005367 Bacteria 3207
7 Ga0070709_10036950 3300005434 Unclassified 2980
8 Ga0070714_100008928 3300005435 Bacteria 7843
9 Ga0070713_100034935 3300005436 Bacteria 4044
10 Ga0070710_10967901 3300005437 Bacteria 618
11 Ga0070701_10532933 3300005438 Unclassified 767
12 Ga0070711_100004787 3300005439 Bacteria 8023
13 Ga0070711_100236756 3300005439 Unclassified 1426
14 Ga0070711_100440812 3300005439 Bacteria 1064
15 Ga0070705_100001182 3300005440 Bacteria 14252
16 Ga0070700_100498354 3300005441 Bacteria 936
17 Ga0070694_100100267 3300005444 Unclassified 2048
18 Ga0070708_100440919 3300005445 Bacteria 1228
19 Ga0070678_100111757 3300005456 Bacteria 2138
20 Ga0070662_100087815 3300005457 Bacteria 2329
21 Ga0070662_100415460 3300005457 Bacteria 1112
22 Ga0070699_100103576 3300005518 Bacteria 2496
23 Ga0070697_100427770 3300005536 Bacteria 1151
24 Ga0070704_100303187 3300005549 Bacteria 1332
25 Ga0070664_100547893 3300005564 Bacteria 1069
26 Ga0068854_100812384 3300005578 Bacteria 816
27 Ga0068856_100681696 3300005614 Unclassified 1048
28 Ga0068859_100339293 3300005617 Bacteria 1597
29 Ga0068859_101708677 3300005617 Unclassified 695
30 Ga0068861_100244391 3300005719 Bacteria 1528
31 Ga0068863_100017086 3300005841 Bacteria 6959
32 Ga0068863_100349625 3300005841 Bacteria 1439
33 Ga0068860_100190612 3300005843 Bacteria 1984
34 Ga0068860_100330526 3300005843 Bacteria 1497
35 Ga0068860_100593585 3300005843 Bacteria 1112
36 Ga0068862_100000044 3300005844 Bacteria 156665
37 Ga0068862_100108188 3300005844 Bacteria 2438
38 Ga0068862_100748432 3300005844 Unclassified 951
39 Ga0068862_101391022 3300005844 Unclassified 705
40 Ga0081455_10003859 3300005937 Bacteria 17087
41 Ga0081455_10243585 3300005937 Bacteria 1319
42 Ga0070717_10299198 3300006028 Unclassified 1430
43 Ga0070712_100184535 3300006175 Unclassified 1628
44 Ga0075428_100192346 3300006844 Bacteria 2206
45 Ga0075428_100298766 3300006844 Bacteria 1731
46 Ga0075430_100045377 3300006846 Bacteria 3713
47 Ga0075430_100127170 3300006846 Bacteria 2124
48 Ga0075433_10685287 3300006852 Unclassified 898
49 Ga0075429_100015717 3300006880 Bacteria 6558
50 Ga0075429_100484046 3300006880 Unclassified 1084
51 Ga0075436_100019380 3300006914 Bacteria 4662
52 Ga0075436_100019411 3300006914 Bacteria 4658
53 Ga0075436_100081833 3300006914 Bacteria 2239
54 Ga0075436_100842936 3300006914 Bacteria 684
55 Ga0097620_100339328 3300006931 Bacteria 1597
56 Ga0097620_101708919 3300006931 Unclassified 695
57 Ga0075435_100004037 3300007076 Bacteria 10036
58 Ga0105240_10172089 3300009093 Bacteria 2563
59 Ga0105240_10409081 3300009093 Bacteria 1526
60 Ga0114129_10019843 3300009147 Bacteria 9566
61 Ga0114129_11961891 3300009147 Bacteria 709
62 Ga0114129_12199372 3300009147 Bacteria 664
63 Ga0105248_10809117 3300009177 Bacteria 1058
64 Ga0105238_10677978 3300009551 Bacteria 1042
65 Ga0157370_10834065 3300013104 Bacteria 838
66 Ga0157370_11107467 3300013104 Bacteria 715
67 Ga0157369_10284222 3300013105 Bacteria 1723
68 Ga0157374_10017331 3300013296 Bacteria 6339
69 Ga0157374_10983967 3300013296 Bacteria 862
70 Ga0157374_11260988 3300013296 Bacteria 761
71 Ga0157378_10217685 3300013297 Bacteria 1814
72 Ga0157378_10491750 3300013297 Bacteria 1224
73 Ga0157372_10621949 3300013307 Bacteria 1258
74 Ga0157380_10002196 3300014326 Bacteria 13116
75 Ga0157380_10044855 3300014326 Bacteria 3467
76 Ga0207692_10296983 3300025898 Bacteria 982
77 Ga0207680_10522003 3300025903 Unclassified 847
78 Ga0207699_10046075 3300025906 Bacteria 2548
79 Ga0207695_10264607 3300025913 Bacteria 1616
80 Ga0207663_10004236 3300025916 Bacteria 7115
81 Ga0207663_10234164 3300025916 Unclassified 1343
82 Ga0207663_10379897 3300025916 Bacteria 1076
83 Ga0207664_10020330 3300025929 Bacteria 4919
84 Ga0207664_11154639 3300025929 Bacteria 691
85 Ga0207706_10303692 3300025933 Bacteria 1390
86 Ga0207706_10559339 3300025933 Bacteria 984
87 Ga0207669_10018571 3300025937 Bacteria 3598
88 Ga0207658_10092521 3300025986 Unclassified 2349
89 Ga0207678_10365892 3300026067 Bacteria 1245
90 Ga0207641_10028394 3300026088 Bacteria 4623
91 Ga0207641_10889571 3300026088 Unclassified 884
92 Ga0207641_11856475 3300026088 Unclassified 604
93 Ga0207698_11031629 3300026142 Bacteria 834
94 Ga0209588_1129929 3300027671 Unclassified 804
95 Ga0268265_10000045 3300028380 Bacteria 180378
96 Ga0268265_10028396 3300028380 Bacteria 4004
97 Ga0268264_10071916 3300028381 Bacteria 2932
98 Ga0268264_10253527 3300028381 Bacteria 1636
99 Ga0268264_10559133 3300028381 Viruses 1123
100 Ga0265336_10007494 3300028666 Bacteria 3877
101 Ga0265338_10172639 3300028800 Bacteria 1656
102 Ga0265324_10039546 3300029957 Bacteria 1635
103 Ga0265325_10041874 3300031241 Bacteria 2398
104 Ga0265316_10218829 3300031344 Bacteria 1406
105 Ga0265316_10269226 3300031344 Bacteria 1247
106 Ga0307513_10018925 3300031456 Bacteria 8211
107 Ga0265342_10144089 3300031712 Bacteria 1327
108 Ga0307416_100221608 3300032002 Bacteria 1815
109 Ga0373947_0432079 3300035725 Bacteria 891
110 Ga0316584_0222271 3300036712 Bacteria 1387
111 Ga0395905_0204138 3300037471 Bacteria 1853
112 Ga0400488_48836 3300038741 Bacteria 12113
113 Ga0400489_15633 3300039093 Bacteria 49266
114 Ga0436360_0441572 3300039438 Unclassified 780
115 Ga0451577_0189064 3300042876 Bacteria 1857
116 Ga0453683_0034983 3300044673 Bacteria 3167
117 Ga0466961_0674521 3300044693 Bacteria 620
118 Ga0453684_0008826 3300044712 Bacteria 17873
119 Ga0453684_0035420 3300044712 Bacteria 6899
120 Ga0453684_0051916 3300044712 Bacteria 5368
121 Ga0451576_0002484 3300045051 Bacteria 27384
122 Ga0451576_0035954 3300045051 Bacteria 5253
123 Ga0466958_0431504 3300045836 Bacteria 852
124 Ga0495606_0003991 3300046507 Bacteria 15084
125 Ga0495608_0228236 3300046511 Bacteria 1166
126 Ga0495663_0067588 3300046525 Bacteria 1133
127 Ga0495642_0054242 3300046528 Bacteria 1653
128 Ga0495624_0171046 3300046690 Bacteria 1325
129 Ga0495581_0279795 3300047315 Bacteria 975
130 Ga0495674_0042783 3300047319 Bacteria 4038
131 Ga0495675_0206802 3300047444 Bacteria 1193
132 Ga0496102_0798826 3300048905 Bacteria 866
133 Ga0496102_1466045 3300048905 Bacteria 601
134 Ga0496104_0837559 3300048907 Bacteria 825
135 Ga0496105_0314159 3300048908 Unclassified 1257
136 Ga0496114_0302303 3300048917 Bacteria 1413
137 Ga0496125_0001391 3300048928 Bacteria 35426
138 Ga0496126_0077992 3300048929 Bacteria 2936
139 Ga0501031_0050334 3300049568 Bacteria 2714
140 Ga0501031_0062937 3300049568 Bacteria 2418
141 Ga0501031_0138558 3300049568 Bacteria 1590
142 Ga0501033_0053358 3300049570 Bacteria 2994
143 Ga0501033_0099554 3300049570 Bacteria 2123
144 Ga0501034_0040442 3300049571 Bacteria 4719
145 Ga0501034_0284136 3300049571 Unclassified 1594
146 Ga0501034_0324559 3300049571 Bacteria 1472
147 Ga0501036_0216285 3300049572 Bacteria 1610
148 Ga0501037_0134295 3300049573 Bacteria 1773
149 Ga0501040_0415141 3300049576 Bacteria 967
150 Ga0501041_0284714 3300049577 Unclassified 1040
151 Ga0501046_0128882 3300049580 Bacteria 1919
152 Ga0501046_0136690 3300049580 Bacteria 1856
153 Ga0501047_0409206 3300049581 Bacteria 1189
154 Ga0501048_0232951 3300049582 Bacteria 1307
155 Ga0501070_0011120 3300049586 Bacteria 7597
156 Ga0501070_0589511 3300049586 Bacteria 887
157 Ga0501072_0025538 3300049588 Bacteria 4602
158 Ga0501072_0232013 3300049588 Bacteria 1470
159 Ga0501073_0013802 3300049589 Bacteria 5874
160 Ga0501074_0804971 3300049590 Bacteria 662
161 Ga0501075_0032390 3300049591 Bacteria 3883
162 Ga0501076_0265742 3300049592 Bacteria 1405
163 Ga0501080_0011961 3300049742 Bacteria 7949
164 Ga0501080_0170766 3300049742 Bacteria 2006
165 Ga0501081_0255678 3300049743 Bacteria 1279
166 Ga0501083_0151963 3300049744 Bacteria 1516
167 Ga0501035_0023301 3300049822 Bacteria 5679
168 Ga0501044_0026872 3300049823 Bacteria 6091
169 nmdc:mga05p37_1508296_c1 3300050507 Bacteria 669
170 nmdc:mga05p37_7563_c1 3300050507 Bacteria 2825
171 nmdc:mga09592_79989_c1 3300050508 Bacteria 2783
172 nmdc:mga09592_881627_c1 3300050508 Bacteria 753
173 nmdc:mga0qj67_180434_c1 3300050509 Bacteria 1715
174 nmdc:mga0qj67_51164_c1 3300050509 Bacteria 3266
175 nmdc:mga06r32_497960_c1 3300050510 Bacteria 1196
176 nmdc:mga06r32_559911_c1 3300050510 Bacteria 1116
177 nmdc:mga0rr50_16358_c1 3300050513 Bacteria 4924
178 nmdc:mga08x19_1730_c1 3300050514 Bacteria 13435
179 nmdc:mga08x19_45587_c1 3300050514 Unclassified 2802
180 nmdc:mga08x19_75893_c1 3300050514 Bacteria 2199
181 Ga0495601_0025333 3300053077 Bacteria 3658
182 Ga0495619_0015283 3300053085 Bacteria 4855
183 Ga0495619_0301549 3300053085 Bacteria 1110
184 Ga0500650_0000226 3300053098 Bacteria 13818
185 Ga0501084_0018473 3300054114 Bacteria 5803
186 Ga0501082_0086135 3300060353 Bacteria 2710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026088 Ga0207641_10889571 Ga0207641_108895712 152
2 3300050510 nmdc:mga06r32_559911_c1 nmdc:mga06r32_559911_c1_295_825 161
3 3300006914 Ga0075436_100081833 Ga0075436_1000818332 167
4 3300005438 Ga0070701_10532933 Ga0070701_105329331 169
5 3300050513 nmdc:mga0rr50_16358_c1 nmdc:mga0rr50_16358_c1_879_1406 169
6 3300050514 nmdc:mga08x19_45587_c1 nmdc:mga08x19_45587_c1_1082_1612 169
7 3300053085 Ga0495619_0015283 Ga0495619_0015283_4173_4685 169
8 3300005367 Ga0070667_100060405 Ga0070667_1000604053 174
9 3300005617 Ga0068859_101708677 Ga0068859_1017086771 174
10 3300005843 Ga0068860_100190612 Ga0068860_1001906122 174
11 3300006931 Ga0097620_101708919 Ga0097620_1017089191 174
12 3300025986 Ga0207658_10092521 Ga0207658_100925212 174
13 3300026088 Ga0207641_11856475 Ga0207641_118564751 174
14 3300028381 Ga0268264_10071916 Ga0268264_100719163 174
15 3300005344 Ga0070661_101059075 Ga0070661_1010590751 175
16 3300005614 Ga0068856_100681696 Ga0068856_1006816962 175
17 3300049570 Ga0501033_0053358 Ga0501033_0053358_2279_2812 175
18 3300049589 Ga0501073_0013802 Ga0501073_0013802_446_979 175
19 3300005536 Ga0070697_100427770 Ga0070697_1004277702 176
20 3300006844 Ga0075428_100192346 Ga0075428_1001923462 176
21 3300006846 Ga0075430_100045377 Ga0075430_1000453774 176
22 3300006846 Ga0075430_100127170 Ga0075430_1001271702 176
23 3300006880 Ga0075429_100015717 Ga0075429_1000157175 176
24 3300009147 Ga0114129_10019843 Ga0114129_1001984310 176
25 3300009147 Ga0114129_12199372 Ga0114129_121993721 176
26 3300049568 Ga0501031_0138558 Ga0501031_0138558_423_956 176
27 3300049571 Ga0501034_0040442 Ga0501034_0040442_2295_2831 176
28 3300050507 nmdc:mga05p37_1508296_c1 nmdc:mga05p37_1508296_c1_98_631 176
29 3300050507 nmdc:mga05p37_7563_c1 nmdc:mga05p37_7563_c1_1154_1687 176
30 3300050508 nmdc:mga09592_79989_c1 nmdc:mga09592_79989_c1_1904_2437 176
31 3300050509 nmdc:mga0qj67_180434_c1 nmdc:mga0qj67_180434_c1_312_845 176
32 3300050509 nmdc:mga0qj67_51164_c1 nmdc:mga0qj67_51164_c1_579_1112 176
33 3300050510 nmdc:mga06r32_497960_c1 nmdc:mga06r32_497960_c1_456_989 176
34 3300005335 Ga0070666_10568074 Ga0070666_105680741 177
35 3300005440 Ga0070705_100001182 Ga0070705_10000118210 177
36 3300005578 Ga0068854_100812384 Ga0068854_1008123841 177
37 3300005841 Ga0068863_100349625 Ga0068863_1003496252 177
38 3300005843 Ga0068860_100330526 Ga0068860_1003305262 177
39 3300005937 Ga0081455_10243585 Ga0081455_102435852 177
40 3300009551 Ga0105238_10677978 Ga0105238_106779781 177
41 3300013104 Ga0157370_10834065 Ga0157370_108340652 177
42 3300013105 Ga0157369_10284222 Ga0157369_102842222 177
43 3300013296 Ga0157374_10983967 Ga0157374_109839672 177
44 3300013296 Ga0157374_11260988 Ga0157374_112609881 177
45 3300013307 Ga0157372_10621949 Ga0157372_106219492 177
46 3300025903 Ga0207680_10522003 Ga0207680_105220031 177
47 3300025929 Ga0207664_11154639 Ga0207664_111546391 177
48 3300026142 Ga0207698_11031629 Ga0207698_110316291 177
49 3300028381 Ga0268264_10559133 Ga0268264_105591332 177
50 3300035725 Ga0373947_0432079 Ga0373947_0432079_141_689 177
51 3300036712 Ga0316584_0222271 Ga0316584_0222271_87_653 177
52 3300044693 Ga0466961_0674521 Ga0466961_0674521_41_595 177
53 3300045836 Ga0466958_0431504 Ga0466958_0431504_60_614 177
54 3300046511 Ga0495608_0228236 Ga0495608_0228236_189_749 177
55 3300046690 Ga0495624_0171046 Ga0495624_0171046_238_798 177
56 3300047315 Ga0495581_0279795 Ga0495581_0279795_161_721 177
57 3300047319 Ga0495674_0042783 Ga0495674_0042783_2304_2864 177
58 3300047444 Ga0495675_0206802 Ga0495675_0206802_371_931 177
59 3300048917 Ga0496114_0302303 Ga0496114_0302303_785_1333 177
60 3300048929 Ga0496126_0077992 Ga0496126_0077992_200_748 177
61 3300049568 Ga0501031_0050334 Ga0501031_0050334_1651_2190 177
62 3300049568 Ga0501031_0062937 Ga0501031_0062937_170_718 177
63 3300049571 Ga0501034_0324559 Ga0501034_0324559_292_840 177
64 3300049573 Ga0501037_0134295 Ga0501037_0134295_138_686 177
65 3300049580 Ga0501046_0136690 Ga0501046_0136690_417_965 177
66 3300049582 Ga0501048_0232951 Ga0501048_0232951_700_1248 177
67 3300049586 Ga0501070_0011120 Ga0501070_0011120_612_1160 177
68 3300049588 Ga0501072_0025538 Ga0501072_0025538_2005_2544 177
69 3300049591 Ga0501075_0032390 Ga0501075_0032390_717_1256 177
70 3300049822 Ga0501035_0023301 Ga0501035_0023301_4820_5368 177
71 3300049823 Ga0501044_0026872 Ga0501044_0026872_4417_4965 177
72 3300053085 Ga0495619_0301549 Ga0495619_0301549_192_743 177
73 3300005295 Ga0065707_10084428 Ga0065707_100844287 178
74 3300005445 Ga0070708_100440919 Ga0070708_1004409192 178
75 3300005617 Ga0068859_100339293 Ga0068859_1003392932 178
76 3300005841 Ga0068863_100017086 Ga0068863_1000170864 178
77 3300005843 Ga0068860_100593585 Ga0068860_1005935852 178
78 3300005844 Ga0068862_100000044 Ga0068862_100000044147 178
79 3300006931 Ga0097620_100339328 Ga0097620_1003393282 178
80 3300013297 Ga0157378_10217685 Ga0157378_102176853 178
81 3300026088 Ga0207641_10028394 Ga0207641_100283942 178
82 3300028380 Ga0268265_10000045 Ga0268265_1000004542 178
83 3300028381 Ga0268264_10253527 Ga0268264_102535272 178
84 3300031456 Ga0307513_10018925 Ga0307513_100189256 178
85 3300039438 Ga0436360_0441572 Ga0436360_0441572_137_703 178
86 3300044673 Ga0453683_0034983 Ga0453683_0034983_1491_2045 178
87 3300049571 Ga0501034_0284136 Ga0501034_0284136_904_1455 178
88 3300049580 Ga0501046_0128882 Ga0501046_0128882_889_1440 178
89 3300049586 Ga0501070_0589511 Ga0501070_0589511_19_570 178
90 3300049742 Ga0501080_0011961 Ga0501080_0011961_3489_4040 178
91 3300005356 Ga0070674_100028242 Ga0070674_1000282423 179
92 3300005434 Ga0070709_10036950 Ga0070709_100369502 179
93 3300005435 Ga0070714_100008928 Ga0070714_1000089284 179
94 3300005436 Ga0070713_100034935 Ga0070713_1000349355 179
95 3300005437 Ga0070710_10967901 Ga0070710_109679011 179
96 3300005439 Ga0070711_100004787 Ga0070711_1000047877 179
97 3300005439 Ga0070711_100440812 Ga0070711_1004408122 179
98 3300005444 Ga0070694_100100267 Ga0070694_1001002671 179
99 3300005456 Ga0070678_100111757 Ga0070678_1001117572 179
100 3300005457 Ga0070662_100415460 Ga0070662_1004154602 179
101 3300005549 Ga0070704_100303187 Ga0070704_1003031871 179
102 3300005564 Ga0070664_100547893 Ga0070664_1005478932 179
103 3300005844 Ga0068862_101391022 Ga0068862_1013910221 179
104 3300006028 Ga0070717_10299198 Ga0070717_102991982 179
105 3300006175 Ga0070712_100184535 Ga0070712_1001845352 179
106 3300006914 Ga0075436_100019380 Ga0075436_1000193802 179
107 3300006914 Ga0075436_100019411 Ga0075436_1000194113 179
108 3300006914 Ga0075436_100842936 Ga0075436_1008429361 179
109 3300007076 Ga0075435_100004037 Ga0075435_1000040372 179
110 3300009093 Ga0105240_10172089 Ga0105240_101720893 179
111 3300009093 Ga0105240_10409081 Ga0105240_104090812 179
112 3300009147 Ga0114129_11961891 Ga0114129_119618911 179
113 3300009177 Ga0105248_10809117 Ga0105248_108091171 179
114 3300013104 Ga0157370_11107467 Ga0157370_111074671 179
115 3300013297 Ga0157378_10491750 Ga0157378_104917502 179
116 3300025898 Ga0207692_10296983 Ga0207692_102969832 179
117 3300025906 Ga0207699_10046075 Ga0207699_100460752 179
118 3300025913 Ga0207695_10264607 Ga0207695_102646072 179
119 3300025916 Ga0207663_10004236 Ga0207663_100042364 179
120 3300025916 Ga0207663_10379897 Ga0207663_103798972 179
121 3300025929 Ga0207664_10020330 Ga0207664_100203303 179
122 3300025933 Ga0207706_10303692 Ga0207706_103036924 179
123 3300025937 Ga0207669_10018571 Ga0207669_100185716 179
124 3300026067 Ga0207678_10365892 Ga0207678_103658921 179
125 3300027671 Ga0209588_1129929 Ga0209588_11299292 179
126 3300028800 Ga0265338_10172639 Ga0265338_101726392 179
127 3300031241 Ga0265325_10041874 Ga0265325_100418742 179
128 3300031344 Ga0265316_10269226 Ga0265316_102692263 179
129 3300031712 Ga0265342_10144089 Ga0265342_101440893 179
130 3300032002 Ga0307416_100221608 Ga0307416_1002216082 179
131 3300037471 Ga0395905_0204138 Ga0395905_0204138_999_1568 179
132 3300039093 Ga0400489_15633 Ga0400489_15633_26229_26771 179
133 3300048905 Ga0496102_0798826 Ga0496102_0798826_111_722 179
134 3300048905 Ga0496102_1466045 Ga0496102_1466045_41_583 179
135 3300048907 Ga0496104_0837559 Ga0496104_0837559_115_675 179
136 3300048908 Ga0496105_0314159 Ga0496105_0314159_664_1224 179
137 3300049572 Ga0501036_0216285 Ga0501036_0216285_818_1372 179
138 3300049576 Ga0501040_0415141 Ga0501040_0415141_346_900 179
139 3300049577 Ga0501041_0284714 Ga0501041_0284714_451_1005 179
140 3300049590 Ga0501074_0804971 Ga0501074_0804971_90_644 179
141 3300049742 Ga0501080_0170766 Ga0501080_0170766_1412_1966 179
142 3300049744 Ga0501083_0151963 Ga0501083_0151963_806_1360 179
143 3300050514 nmdc:mga08x19_1730_c1 nmdc:mga08x19_1730_c1_3675_4226 179
144 3300050514 nmdc:mga08x19_75893_c1 nmdc:mga08x19_75893_c1_1586_2146 179
145 3300053077 Ga0495601_0025333 Ga0495601_0025333_2876_3436 179
146 3300054114 Ga0501084_0018473 Ga0501084_0018473_1432_1986 179
147 iso_pu_bacteria 2744054900 2746092084 179
148 iso_pu_bacteria 2744054901 2746093677 179
149 3300005937 Ga0081455_10003859 Ga0081455_1000385914 180
150 3300006844 Ga0075428_100298766 Ga0075428_1002987662 180
151 3300006880 Ga0075429_100484046 Ga0075429_1004840461 180
152 3300013296 Ga0157374_10017331 Ga0157374_100173316 180
153 3300028666 Ga0265336_10007494 Ga0265336_100074943 180
154 3300029957 Ga0265324_10039546 Ga0265324_100395462 180
155 3300031344 Ga0265316_10218829 Ga0265316_102188292 180
156 3300038741 Ga0400488_48836 Ga0400488_48836_3921_4484 180
157 3300042876 Ga0451577_0189064 Ga0451577_0189064_1283_1825 180
158 3300044712 Ga0453684_0008826 Ga0453684_0008826_755_1297 180
159 3300044712 Ga0453684_0051916 Ga0453684_0051916_377_919 180
160 3300045051 Ga0451576_0002484 Ga0451576_0002484_484_1026 180
161 3300045051 Ga0451576_0035954 Ga0451576_0035954_755_1297 180
162 3300049581 Ga0501047_0409206 Ga0501047_0409206_49_618 180
163 3300050508 nmdc:mga09592_881627_c1 nmdc:mga09592_881627_c1_53_604 180
164 3300005439 Ga0070711_100236756 Ga0070711_1002367562 181
165 3300005441 Ga0070700_100498354 Ga0070700_1004983542 181
166 3300005457 Ga0070662_100087815 Ga0070662_1000878153 181
167 3300005518 Ga0070699_100103576 Ga0070699_1001035762 181
168 3300005719 Ga0068861_100244391 Ga0068861_1002443912 181
169 3300005844 Ga0068862_100108188 Ga0068862_1001081882 181
170 3300005844 Ga0068862_100748432 Ga0068862_1007484322 181
171 3300006852 Ga0075433_10685287 Ga0075433_106852872 181
172 3300014326 Ga0157380_10002196 Ga0157380_100021963 181
173 3300014326 Ga0157380_10044855 Ga0157380_100448555 181
174 3300025916 Ga0207663_10234164 Ga0207663_102341642 181
175 3300025933 Ga0207706_10559339 Ga0207706_105593392 181
176 3300028380 Ga0268265_10028396 Ga0268265_100283963 181
177 3300044712 Ga0453684_0035420 Ga0453684_0035420_439_984 181
178 3300046525 Ga0495663_0067588 Ga0495663_0067588_527_1072 181
179 3300046528 Ga0495642_0054242 Ga0495642_0054242_82_627 181
180 3300048928 Ga0496125_0001391 Ga0496125_0001391_2239_2793 181
181 3300049570 Ga0501033_0099554 Ga0501033_0099554_1509_2078 181
182 3300049588 Ga0501072_0232013 Ga0501072_0232013_369_938 181
183 3300049592 Ga0501076_0265742 Ga0501076_0265742_375_944 181
184 3300049743 Ga0501081_0255678 Ga0501081_0255678_184_753 181
185 3300053098 Ga0500650_0000226 Ga0500650_0000226_12952_13497 181
186 3300060353 Ga0501082_0086135 Ga0501082_0086135_1245_1814 181
187 3300002075 JGI24738J21930_10009352 JGI24738J21930_100093522 183
188 3300046507 Ga0495606_0003991 Ga0495606_0003991_1806_2357 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

7

177

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9852 1 183
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9847 1 183
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9824 3 179
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9799 1 183
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.9795 3 183
ID Description Score Start End Superfamily
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9755 1 183 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9702 1 183 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9628 3 183 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9549 4 182 2.60.120.10
af_Q17993_17_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9531 9 179 2.60.120.10
ID Description Score Start End GO Terms
AF-T2JAF3-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9994 4 138 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A0Q0KGA8-F1-model_v4 deleted 0.999 3 183
AF-A0A3M2XRL1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9985 2 183 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A359DFH3-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9984 5 183 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-F3G6W7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9984 4 183 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
96.7 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map