F288062

General Info

Members Datasets Scaffolds Average Seq Length
187 148 372 248

Family's Representative Sequence

Representative Sequence 3300041410|Ga0439461_0006861|Ga0439461_0006861_1057_1854
Length 265
Sequence LVSPSYTLAVNSPCSTVSLLRFAALLLPLLVVFAANAGQVQVAAAANLARPIEKIAAAFQRETGHQAIVALGSTGKFYAQIRNGAPFEVLLAADSETPRKLEAEGLARRGTRFTYAIGRLVLWSAQEGVVDTRGEILRRPPSGKLAIADPRVAPYGAAAVQTLEKMGLLATWRPFFVQGESIAQAHQFAASGNARLAFVALSQVAEQGRIARGSGWIVPSALHAPIAQDAVLLNPGAANPAATAFLTYLRGKAARAILRDAGYRF

Samples

Sample ID Description Type Environment
1 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
39 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
52 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
53 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
54 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
55 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
56 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
57 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
58 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
61 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
62 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
63 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
87 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
88 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
89 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
97 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
98 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
99 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
133 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
138 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
139 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
140 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
141 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
142 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
143 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
147 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
148 2894510363 Methylomonas sp. Kb3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.39
Nodule 0
Rhizoplane 5.35
Rhizosphere 62.03
Stem 0
Stem Tuber 0
Unclassified 1.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439461_0006861 3300041410 Bacteria 1996
2 JGI25153J46596_10001213 3300003215 Bacteria 15581
3 rootL2_10328959 3300003322 Bacteria 1349
4 rootH1_10088432 3300003323 Bacteria 1291
5 Ga0055536_1011630 3300003781 Bacteria 3352
6 Ga0065707_10083697 3300005295 Bacteria 8455
7 Ga0070669_100067634 3300005353 Bacteria 2636
8 Ga0070711_100053241 3300005439 Bacteria 2788
9 Ga0070711_100092849 3300005439 Bacteria 2179
10 Ga0068856_100146616 3300005614 Bacteria 2368
11 Ga0068859_100184670 3300005617 Bacteria 2169
12 Ga0068864_100001214 3300005618 Bacteria 21408
13 Ga0068864_100422534 3300005618 Bacteria 1270
14 Ga0068863_100000635 3300005841 Bacteria 35541
15 Ga0068858_100374389 3300005842 Bacteria 1366
16 Ga0081540_1016836 3300005983 Bacteria 4553
17 Ga0075365_10118903 3300006038 Bacteria 1821
18 Ga0075368_10006338 3300006042 Bacteria 4126
19 Ga0075368_10019060 3300006042 Bacteria 2587
20 Ga0075363_100053775 3300006048 Bacteria 2152
21 Ga0075363_100321898 3300006048 Bacteria 900
22 Ga0075364_10000113 3300006051 Bacteria 33477
23 Ga0070716_100135941 3300006173 Bacteria 1561
24 Ga0075367_10004418 3300006178 Bacteria 6867
25 Ga0075367_10007565 3300006178 Bacteria 5572
26 Ga0075367_10194569 3300006178 Bacteria 1266
27 Ga0075366_10134464 3300006195 Bacteria 1493
28 Ga0075366_10175347 3300006195 Bacteria 1301
29 Ga0075370_10008257 3300006353 Bacteria 5348
30 Ga0075428_100040317 3300006844 Bacteria 5138
31 Ga0075430_100517568 3300006846 Unclassified 984
32 Ga0075431_100070131 3300006847 Bacteria 3616
33 Ga0075429_100039638 3300006880 Bacteria 4099
34 Ga0075429_100112538 3300006880 Bacteria 2379
35 Ga0097620_100184678 3300006931 Bacteria 2169
36 Ga0105240_10168950 3300009093 Bacteria 2592
37 Ga0105240_10284915 3300009093 Bacteria 1897
38 Ga0111539_10361035 3300009094 Bacteria 1691
39 Ga0114129_10053347 3300009147 Bacteria 5671
40 Ga0105241_10051108 3300009174 Bacteria 3151
41 Ga0105238_10141857 3300009551 Bacteria 2379
42 Ga0105239_10057134 3300010375 Bacteria 4280
43 Ga0105239_10422965 3300010375 Bacteria 1509
44 Ga0105246_10093033 3300011119 Bacteria 2177
45 Ga0157369_10482046 3300013105 Bacteria 1284
46 Ga0163162_10113133 3300013306 Bacteria 2813
47 Ga0209677_105450 3300025253 Bacteria 3316
48 Ga0209233_1006079 3300025261 Bacteria 3927
49 Ga0209455_1005459 3300025272 Bacteria 3922
50 Ga0209676_1000547 3300025292 Bacteria 57868
51 Ga0209758_1000641 3300025297 Bacteria 53250
52 Ga0207710_10043163 3300025900 Bacteria 2005
53 Ga0207694_10203255 3300025924 Bacteria 1612
54 Ga0207670_10349518 3300025936 Bacteria 1170
55 Ga0207703_10085879 3300026035 Bacteria 2634
56 Ga0207703_10650913 3300026035 Bacteria 1000
57 Ga0207702_10475854 3300026078 Bacteria 1215
58 Ga0207641_10000242 3300026088 Bacteria 70950
59 Ga0207676_10001031 3300026095 Bacteria 21326
60 Ga0207676_10352058 3300026095 Bacteria 1362
61 Ga0209971_1006560 3300027682 Bacteria 2752
62 Ga0209966_1002453 3300027695 Bacteria 3096
63 Ga0209813_10007257 3300027866 Bacteria 2756
64 Ga0209813_10009827 3300027866 Bacteria 2459
65 Ga0265319_1016150 3300028563 Bacteria 2868
66 Ga0265334_10000381 3300028573 Bacteria 23728
67 Ga0265318_10000543 3300028577 Bacteria 26880
68 Ga0265318_10000951 3300028577 Bacteria 18624
69 Ga0265323_10015976 3300028653 Bacteria 2939
70 Ga0265322_10023848 3300028654 Bacteria 1749
71 Ga0265336_10000116 3300028666 Bacteria 59582
72 Ga0307517_10023634 3300028786 Bacteria 7629
73 Ga0265338_10000094 3300028800 Bacteria 168366
74 Ga0265338_10032164 3300028800 Bacteria 5125
75 Ga0265324_10006018 3300029957 Bacteria 5133
76 Ga0265330_10038158 3300031235 Bacteria 2136
77 Ga0265332_10000029 3300031238 Bacteria 180902
78 Ga0265332_10006565 3300031238 Bacteria 5274
79 Ga0265320_10017287 3300031240 Bacteria 4011
80 Ga0265325_10000997 3300031241 Bacteria 20347
81 Ga0265325_10089733 3300031241 Bacteria 1517
82 Ga0265340_10004683 3300031247 Bacteria 7613
83 Ga0265340_10157881 3300031247 Bacteria 1032
84 Ga0265316_10002962 3300031344 Bacteria 17373
85 Ga0307513_10089381 3300031456 Bacteria 3145
86 Ga0265313_10001005 3300031595 Bacteria 27640
87 Ga0307508_10384408 3300031616 Bacteria 995
88 Ga0316575_10000077 3300031665 Bacteria 24214
89 Ga0265314_10133833 3300031711 Unclassified 1542
90 Ga0265342_10042374 3300031712 Bacteria 2750
91 Ga0316578_10049526 3300031728 Bacteria 2455
92 Ga0316578_10069598 3300031728 Bacteria 2082
93 Ga0307516_10142680 3300031730 Bacteria 2163
94 Ga0316577_10028464 3300031733 Bacteria 3117
95 Ga0316577_10096847 3300031733 Bacteria 1653
96 Ga0316574_0013934 3300035398 Bacteria 4634
97 Ga0316584_0032097 3300036712 Bacteria 3885
98 Ga0373925_0756821 3300037068 Bacteria 801
99 Ga0395900_0134819 3300037418 Bacteria 2529
100 Ga0395905_0024597 3300037471 Bacteria 5683
101 Ga0395901_0373947 3300038443 Bacteria 1467
102 Ga0400487_46290 3300039110 Bacteria 42548
103 Ga0436365_0325481 3300039437 Bacteria 1073
104 Ga0436365_1454194 3300039437 Bacteria 1042
105 Ga0436361_1080461 3300039447 Bacteria 1139
106 Ga0436363_1228487 3300039450 Bacteria 1105
107 Ga0439431_0038256 3300041997 Bacteria 1214
108 Ga0450903_010412 3300042138 Bacteria 1505
109 Ga0439446_0017292 3300042156 Bacteria 2014
110 Ga0439435_0000610 3300042436 Bacteria 5832
111 Ga0453684_0001497 3300044712 Bacteria 65811
112 Ga0466957_0060585 3300044842 Bacteria 2321
113 Ga0466957_0091383 3300044842 Bacteria 1908
114 Ga0466957_0304631 3300044842 Bacteria 1071
115 Ga0451576_0484846 3300045051 Bacteria 1299
116 Ga0466967_0777880 3300045976 Bacteria 950
117 Ga0495587_0014055 3300046536 Bacteria 5027
118 Ga0495609_0134424 3300046538 Bacteria 1058
119 Ga0495671_0035211 3300046692 Bacteria 2544
120 Ga0495660_0154765 3300046810 Bacteria 1129
121 Ga0495677_0094811 3300047445 Bacteria 1126
122 Ga0495681_0006858 3300047470 Bacteria 7395
123 Ga0495602_0091239 3300048088 Bacteria 2528
124 Ga0496102_0760297 3300048905 Bacteria 892
125 Ga0496104_0005378 3300048907 Bacteria 11211
126 Ga0496104_0011589 3300048907 Bacteria 7902
127 Ga0496105_0128717 3300048908 Bacteria 2088
128 Ga0496105_0640484 3300048908 Bacteria 821
129 Ga0496106_0041044 3300048909 Bacteria 3467
130 Ga0496108_0038479 3300048911 Bacteria 3985
131 Ga0496109_0038699 3300048912 Bacteria 4313
132 Ga0496110_0026515 3300048913 Bacteria 4960
133 Ga0496113_0259140 3300048916 Bacteria 1389
134 Ga0496117_0067981 3300048920 Bacteria 2408
135 Ga0496118_0165388 3300048921 Bacteria 1360
136 Ga0496121_0032113 3300048924 Bacteria 4780
137 Ga0496122_0060558 3300048925 Bacteria 2787
138 Ga0496124_0094754 3300048927 Bacteria 2427
139 Ga0496125_0003103 3300048928 Bacteria 20706
140 Ga0496125_0061801 3300048928 Bacteria 3001
141 Ga0496125_0324125 3300048928 Bacteria 932
142 Ga0496126_0069369 3300048929 Bacteria 3144
143 Ga0501033_0106564 3300049570 Bacteria 2042
144 Ga0501033_0192037 3300049570 Bacteria 1461
145 Ga0501033_0408556 3300049570 Bacteria 946
146 Ga0501034_0041841 3300049571 Bacteria 4636
147 Ga0501034_0492814 3300049571 Bacteria 1140
148 Ga0501037_0148721 3300049573 Bacteria 1675
149 Ga0501043_0259536 3300049579 Bacteria 1337
150 Ga0501047_0234745 3300049581 Bacteria 1686
151 Ga0501070_0253767 3300049586 Bacteria 1438
152 Ga0501070_0282532 3300049586 Bacteria 1354
153 Ga0501073_0018476 3300049589 Bacteria 5040
154 Ga0501074_0075374 3300049590 Bacteria 2422
155 Ga0501074_0261729 3300049590 Bacteria 1230
156 Ga0501257_061036 3300049686 Bacteria 953
157 Ga0501080_0139879 3300049742 Bacteria 2238
158 Ga0501083_0079917 3300049744 Bacteria 2168
159 Ga0501044_0433782 3300049823 Bacteria 1222
160 nmdc:mga03n38_34866_c1 3300050490 Bacteria 2152
161 nmdc:mga00v17_229_c1 3300050491 Bacteria 33373
162 nmdc:mga0yw44_95582_c1 3300050492 Bacteria 1885
163 nmdc:mga0k408_292911_c1 3300050493 Bacteria 971
164 nmdc:mga0k408_57587_c1 3300050493 Bacteria 2256
165 nmdc:mga06z11_29472_c1 3300050494 Bacteria 2645
166 nmdc:mga06z11_3247_c1 3300050494 Bacteria 6284
167 nmdc:mga04h51_6228_c1 3300050495 Bacteria 3082
168 nmdc:mga04h51_8440_c1 3300050495 Bacteria 2756
169 nmdc:mga07m45_50089_c2 3300050496 Bacteria 1446
170 nmdc:mga07m45_536_c1 3300050496 Bacteria 16073
171 nmdc:mga0qj67_39303_c1 3300050509 Bacteria 3715
172 Ga0495601_0011387 3300053077 Bacteria 5318
173 Ga0500572_066388 3300053111 Bacteria 1106
174 Ga0500559_0000639 3300053136 Bacteria 23660
175 Ga0500559_0120130 3300053136 Unclassified 1222
176 Ga0500603_082657 3300053150 Bacteria 932
177 Ga0500639_012325 3300053163 Bacteria 4489
178 Ga0500636_0211201 3300053177 Bacteria 1018
179 Ga0500576_048019 3300053725 Bacteria 1901
180 Ga0500596_022529 3300053735 Bacteria 952
181 Ga0501084_0175329 3300054114 Bacteria 1810
182 Ga0501084_0269719 3300054114 Bacteria 1437
183 Ga0501082_0020526 3300060353 Bacteria 5694
184 2729147590 2728369097 Bacteria 4333476
185 2881105333 2881101125 Bacteria 4590519
186 2894510971 2894510363 Bacteria 5121143
187 Ga0439461_0006861
188 JGI25153J46596_10001213
189 rootL2_10328959
190 rootH1_10088432
191 Ga0055536_1011630
192 Ga0065707_10083697
193 Ga0070669_100067634
194 Ga0070711_100053241
195 Ga0070711_100092849
196 Ga0068856_100146616
197 Ga0068859_100184670
198 Ga0068864_100001214
199 Ga0068864_100422534
200 Ga0068863_100000635
201 Ga0068858_100374389
202 Ga0081540_1016836
203 Ga0075365_10118903
204 Ga0075368_10006338
205 Ga0075368_10019060
206 Ga0075363_100053775
207 Ga0075363_100321898
208 Ga0075364_10000113
209 Ga0070716_100135941
210 Ga0075367_10004418
211 Ga0075367_10007565
212 Ga0075367_10194569
213 Ga0075366_10134464
214 Ga0075366_10175347
215 Ga0075370_10008257
216 Ga0075428_100040317
217 Ga0075430_100517568
218 Ga0075431_100070131
219 Ga0075429_100039638
220 Ga0075429_100112538
221 Ga0097620_100184678
222 Ga0105240_10168950
223 Ga0105240_10284915
224 Ga0111539_10361035
225 Ga0114129_10053347
226 Ga0105241_10051108
227 Ga0105238_10141857
228 Ga0105239_10057134
229 Ga0105239_10422965
230 Ga0105246_10093033
231 Ga0157369_10482046
232 Ga0163162_10113133
233 Ga0209677_105450
234 Ga0209233_1006079
235 Ga0209455_1005459
236 Ga0209676_1000547
237 Ga0209758_1000641
238 Ga0207710_10043163
239 Ga0207694_10203255
240 Ga0207670_10349518
241 Ga0207703_10085879
242 Ga0207703_10650913
243 Ga0207702_10475854
244 Ga0207641_10000242
245 Ga0207676_10001031
246 Ga0207676_10352058
247 Ga0209971_1006560
248 Ga0209966_1002453
249 Ga0209813_10007257
250 Ga0209813_10009827
251 Ga0265319_1016150
252 Ga0265334_10000381
253 Ga0265318_10000543
254 Ga0265318_10000951
255 Ga0265323_10015976
256 Ga0265322_10023848
257 Ga0265336_10000116
258 Ga0307517_10023634
259 Ga0265338_10000094
260 Ga0265338_10032164
261 Ga0265324_10006018
262 Ga0265330_10038158
263 Ga0265332_10000029
264 Ga0265332_10006565
265 Ga0265320_10017287
266 Ga0265325_10000997
267 Ga0265325_10089733
268 Ga0265340_10004683
269 Ga0265340_10157881
270 Ga0265316_10002962
271 Ga0307513_10089381
272 Ga0265313_10001005
273 Ga0307508_10384408
274 Ga0316575_10000077
275 Ga0265314_10133833
276 Ga0265342_10042374
277 Ga0316578_10049526
278 Ga0316578_10069598
279 Ga0307516_10142680
280 Ga0316577_10028464
281 Ga0316577_10096847
282 Ga0316574_0013934
283 Ga0316584_0032097
284 Ga0373925_0756821
285 Ga0395900_0134819
286 Ga0395905_0024597
287 Ga0395901_0373947
288 Ga0400487_46290
289 Ga0436365_0325481
290 Ga0436365_1454194
291 Ga0436361_1080461
292 Ga0436363_1228487
293 Ga0439431_0038256
294 Ga0450903_010412
295 Ga0439446_0017292
296 Ga0439435_0000610
297 Ga0453684_0001497
298 Ga0466957_0060585
299 Ga0466957_0091383
300 Ga0466957_0304631
301 Ga0451576_0484846
302 Ga0466967_0777880
303 Ga0495587_0014055
304 Ga0495609_0134424
305 Ga0495671_0035211
306 Ga0495660_0154765
307 Ga0495677_0094811
308 Ga0495681_0006858
309 Ga0495602_0091239
310 Ga0496102_0760297
311 Ga0496104_0005378
312 Ga0496104_0011589
313 Ga0496105_0128717
314 Ga0496105_0640484
315 Ga0496106_0041044
316 Ga0496108_0038479
317 Ga0496109_0038699
318 Ga0496110_0026515
319 Ga0496113_0259140
320 Ga0496117_0067981
321 Ga0496118_0165388
322 Ga0496121_0032113
323 Ga0496122_0060558
324 Ga0496124_0094754
325 Ga0496125_0003103
326 Ga0496125_0061801
327 Ga0496125_0324125
328 Ga0496126_0069369
329 Ga0501033_0106564
330 Ga0501033_0192037
331 Ga0501033_0408556
332 Ga0501034_0041841
333 Ga0501034_0492814
334 Ga0501037_0148721
335 Ga0501043_0259536
336 Ga0501047_0234745
337 Ga0501070_0253767
338 Ga0501070_0282532
339 Ga0501073_0018476
340 Ga0501074_0075374
341 Ga0501074_0261729
342 Ga0501257_061036
343 Ga0501080_0139879
344 Ga0501083_0079917
345 Ga0501044_0433782
346 nmdc:mga03n38_34866_c1
347 nmdc:mga00v17_229_c1
348 nmdc:mga0yw44_95582_c1
349 nmdc:mga0k408_292911_c1
350 nmdc:mga0k408_57587_c1
351 nmdc:mga06z11_29472_c1
352 nmdc:mga06z11_3247_c1
353 nmdc:mga04h51_6228_c1
354 nmdc:mga04h51_8440_c1
355 nmdc:mga07m45_50089_c2
356 nmdc:mga07m45_536_c1
357 nmdc:mga0qj67_39303_c1
358 Ga0495601_0011387
359 Ga0500572_066388
360 Ga0500559_0000639
361 Ga0500559_0120130
362 Ga0500603_082657
363 Ga0500639_012325
364 Ga0500636_0211201
365 Ga0500576_048019
366 Ga0500596_022529
367 Ga0501084_0175329
368 Ga0501084_0269719
369 Ga0501082_0020526
370 2729147590
371 2881105333
372 2894510971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

40

264

0.96

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

45

256

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t50-assembly2.cif.gz_B crystal structure of the molybdate-binding periplasmic protein moda from the bacteria pseudomonsa aeruginosa in chromate-bound form 0.8852 25 245
1atg-assembly1.cif.gz_A azotobacter vinelandii periplasmic molybdate-binding protein 0.8803 25 245
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.8792 24 245
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.8725 24 244
7t50-assembly2.cif.gz_B crystal structure of the molybdate-binding periplasmic protein moda from the bacteria pseudomonsa aeruginosa in chromate-bound form 0.8602 25 245
ID Description Score Start End Superfamily
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9466 26 88 3.40.190.10
1atgA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9443 103 205 3.40.190.10
1atgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9441 25 245 3.40.190.10
4rxlA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9341 25 243 3.40.190.10
af_P9WGU3_42_110_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9265 27 92 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7C6E9X2-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9567 34 243 GO:0015689
GO:0030973
GO:0046872
AF-A0A7T4QXI0-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9549 28 246 GO:0015689
GO:0030973
GO:0046872
AF-A0A849EE83-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9535 48 244 GO:0015689
GO:0030973
AF-A0A2E5YIN4-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9529 44 246 GO:0015689
GO:0030973
AF-A0A251X5C2-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9409 14 247 GO:0015689
GO:0030973
GO:0046872

Map