F288042

General Info

Members Datasets Scaffolds Average Seq Length
187 139 374 67

Family's Representative Sequence

Representative Sequence 3300039093|Ga0400489_83260|Ga0400489_83260_369_602
Length 77
Sequence VKQKTKKGGASMANGTVKWFSNDKGFGFIEQDNGEDVFVHFSAIQAEGFKTLNEGDSVTFDVEQGTKGPAAMNVVRQ

Samples

Sample ID Description Type Environment
1 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
82 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
90 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
91 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
95 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
109 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
113 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
114 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
115 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
136 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
137 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 2.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 4.28
Rhizosphere 89.3
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400489_83260 3300039093 Bacteria 1711
2 JGI24740J21852_10109189 3300001979 Bacteria 699
3 JGI25406J46586_10030852 3300003203 Bacteria 2013
4 JGI25406J46586_10060964 3300003203 Bacteria 1218
5 Ga0007429J51699_1050783 3300003579 Bacteria 524
6 Ga0032354_1042901 3300003693 Bacteria 515
7 Ga0070658_11522982 3300005327 Bacteria 580
8 Ga0070683_100604155 3300005329 Bacteria 1050
9 Ga0070682_100238591 3300005337 Bacteria 1304
10 Ga0070682_100714483 3300005337 Bacteria 805
11 Ga0070682_101989722 3300005337 Bacteria 511
12 Ga0070660_100011510 3300005339 Bacteria 6293
13 Ga0070692_10012348 3300005345 Bacteria 3951
14 Ga0070692_10701633 3300005345 Bacteria 681
15 Ga0070675_100203271 3300005354 Bacteria 1720
16 Ga0070674_100785277 3300005356 Bacteria 821
17 Ga0070674_101347013 3300005356 Bacteria 638
18 Ga0070674_102225715 3300005356 Bacteria 501
19 Ga0070659_100000077 3300005366 Bacteria 76934
20 Ga0070714_100011625 3300005435 Bacteria 6988
21 Ga0070713_100136144 3300005436 Bacteria 2171
22 Ga0070701_10893624 3300005438 Bacteria 613
23 Ga0070663_100042815 3300005455 Bacteria 3184
24 Ga0070678_102410116 3300005456 Bacteria 500
25 Ga0068867_102023386 3300005459 Bacteria 545
26 Ga0070685_11580563 3300005466 Bacteria 507
27 Ga0070684_101239214 3300005535 Bacteria 702
28 Ga0070684_101847940 3300005535 Bacteria 570
29 Ga0070697_100356598 3300005536 Bacteria 1264
30 Ga0070665_100567335 3300005548 Bacteria 1148
31 Ga0070665_101362899 3300005548 Bacteria 719
32 Ga0070704_100673921 3300005549 Bacteria 915
33 Ga0068856_100088689 3300005614 Bacteria 3076
34 Ga0068852_100383544 3300005616 Bacteria 1379
35 Ga0068852_102601812 3300005616 Bacteria 526
36 Ga0068859_102151603 3300005617 Bacteria 616
37 Ga0068866_10489461 3300005718 Bacteria 812
38 Ga0068862_100896093 3300005844 Bacteria 872
39 Ga0081455_10185438 3300005937 Bacteria 1572
40 Ga0081539_10000415 3300005985 Bacteria 90819
41 Ga0081539_10012354 3300005985 Bacteria 6594
42 Ga0081539_10086572 3300005985 Bacteria 1630
43 Ga0070717_10003734 3300006028 Bacteria 10937
44 Ga0075365_10522613 3300006038 Bacteria 839
45 Ga0075432_10321627 3300006058 Bacteria 648
46 Ga0070715_10441165 3300006163 Bacteria 733
47 Ga0070712_100000009 3300006175 Bacteria 143615
48 Ga0097620_102151859 3300006931 Bacteria 616
49 Ga0105245_11472868 3300009098 Bacteria 731
50 Ga0105245_11663469 3300009098 Bacteria 690
51 Ga0105245_12137496 3300009098 Bacteria 613
52 Ga0114129_12238372 3300009147 Bacteria 657
53 Ga0105243_10219983 3300009148 Bacteria 1678
54 Ga0105243_11346152 3300009148 Bacteria 733
55 Ga0105242_12120147 3300009176 Bacteria 606
56 Ga0105246_11461810 3300011119 Bacteria 640
57 Ga0157369_10808456 3300013105 Bacteria 963
58 Ga0157372_12154569 3300013307 Bacteria 640
59 Ga0157375_12486843 3300013308 Bacteria 618
60 Ga0157380_11195376 3300014326 Bacteria 804
61 Ga0157380_13525165 3300014326 Bacteria 501
62 Ga0157377_11658266 3300014745 Bacteria 514
63 Ga0213873_10227435 3300021358 Bacteria 585
64 Ga0213876_10030105 3300021384 Bacteria 2862
65 Ga0213875_10303149 3300021388 Bacteria 756
66 Ga0207699_10817596 3300025906 Bacteria 685
67 Ga0207693_10000101 3300025915 Bacteria 76993
68 Ga0207649_11442737 3300025920 Bacteria 545
69 Ga0207652_11827144 3300025921 Bacteria 513
70 Ga0207700_10155341 3300025928 Bacteria 1895
71 Ga0207664_10271716 3300025929 Bacteria 1485
72 Ga0207690_10000017 3300025932 Bacteria 243513
73 Ga0207709_10099672 3300025935 Bacteria 1918
74 Ga0207709_10959052 3300025935 Bacteria 697
75 Ga0207669_10393146 3300025937 Bacteria 1084
76 Ga0207669_11197409 3300025937 Bacteria 643
77 Ga0207669_11674359 3300025937 Bacteria 543
78 Ga0207691_10071653 3300025940 Bacteria 3127
79 Ga0207661_10712971 3300025944 Bacteria 923
80 Ga0207679_11508062 3300025945 Bacteria 616
81 Ga0207668_12023126 3300025972 Bacteria 519
82 Ga0207677_10429751 3300026023 Bacteria 1127
83 Ga0207677_10490566 3300026023 Bacteria 1060
84 Ga0207702_10126474 3300026078 Bacteria 2295
85 Ga0207648_10955298 3300026089 Bacteria 802
86 Ga0207675_101242999 3300026118 Bacteria 765
87 Ga0207698_10537561 3300026142 Bacteria 1143
88 Ga0268266_10782437 3300028379 Bacteria 921
89 Ga0316576_10041499 3300031727 Bacteria 3313
90 Ga0307405_10566286 3300031731 Bacteria 922
91 Ga0307413_10224386 3300031824 Bacteria 1375
92 Ga0307413_10939164 3300031824 Bacteria 737
93 Ga0307413_11261935 3300031824 Bacteria 645
94 Ga0307410_10118922 3300031852 Bacteria 1924
95 Ga0307406_10343752 3300031901 Bacteria 1163
96 Ga0307407_11447594 3300031903 Bacteria 542
97 Ga0307407_11493693 3300031903 Bacteria 534
98 Ga0307409_100099015 3300031995 Bacteria 2413
99 Ga0307409_100306331 3300031995 Bacteria 1480
100 Ga0307409_100818566 3300031995 Bacteria 940
101 Ga0307409_102930211 3300031995 Bacteria 504
102 Ga0307416_101503372 3300032002 Bacteria 779
103 Ga0307414_10301360 3300032004 Bacteria 1356
104 Ga0307411_11328511 3300032005 Bacteria 656
105 Ga0307411_11990286 3300032005 Bacteria 542
106 Ga0307415_101825436 3300032126 Bacteria 589
107 Ga0316580_10036465 3300032139 Bacteria 1522
108 Ga0316593_10410592 3300032168 Bacteria 524
109 Ga0316582_1243124 3300036647 Bacteria 507
110 Ga0395899_0552125 3300037312 Bacteria 740
111 Ga0395900_1345166 3300037418 Bacteria 628
112 Ga0395900_1593649 3300037418 Bacteria 564
113 Ga0395898_0039884 3300037466 Bacteria 4646
114 Ga0395898_0509400 3300037466 Bacteria 1144
115 Ga0395898_0548261 3300037466 Bacteria 1098
116 Ga0395898_0596657 3300037466 Bacteria 1047
117 Ga0395898_1665987 3300037466 Bacteria 561
118 Ga0436364_0725091 3300037853 Bacteria 1898
119 Ga0395901_0010769 3300038443 Bacteria 9272
120 Ga0395901_0625982 3300038443 Bacteria 1082
121 Ga0400490_32254 3300038726 Bacteria 1155
122 Ga0242420_112108 3300038996 Bacteria 588
123 Ga0400483_107026 3300039062 Bacteria 2514
124 Ga0400483_243910 3300039062 Bacteria 10078
125 Ga0436365_0369417 3300039437 Bacteria 7222
126 Ga0436362_0672379 3300039453 Bacteria 963
127 Ga0451800_0185598 3300041459 Bacteria 563
128 Ga0451835_0463708 3300041492 Bacteria 778
129 Ga0451835_1010065 3300041492 Bacteria 523
130 Ga0451853_2882191 3300041512 Bacteria 1073
131 Ga0466965_0692036 3300044683 Bacteria 584
132 Ga0466961_0161769 3300044693 Bacteria 1395
133 Ga0466963_0406412 3300044694 Bacteria 960
134 Ga0466963_1087224 3300044694 Bacteria 563
135 Ga0466963_1161729 3300044694 Bacteria 543
136 Ga0466964_0173604 3300044706 Bacteria 1017
137 Ga0453684_1392489 3300044712 Bacteria 728
138 Ga0453684_2242987 3300044712 Bacteria 544
139 Ga0466971_0362400 3300044719 Bacteria 703
140 Ga0466968_0152047 3300044735 Unclassified 1064
141 Ga0466960_0280160 3300044901 Bacteria 934
142 Ga0466959_0070596 3300045049 Bacteria 2530
143 Ga0466958_0305058 3300045836 Bacteria 1022
144 Ga0466967_0042116 3300045976 Bacteria 3944
145 Ga0466967_0054750 3300045976 Bacteria 3513
146 Ga0466967_0082456 3300045976 Bacteria 2906
147 Ga0466967_0155328 3300045976 Bacteria 2142
148 Ga0466967_0950424 3300045976 Bacteria 855
149 Ga0466967_1293843 3300045976 Bacteria 726
150 Ga0466967_1625598 3300045976 Bacteria 643
151 Ga0466967_2431487 3300045976 Bacteria 519
152 Ga0495596_0260294 3300046500 Bacteria 673
153 Ga0495583_0348308 3300046506 Bacteria 585
154 Ga0495620_0359052 3300046515 Bacteria 552
155 Ga0495631_0066407 3300046518 Bacteria 1561
156 Ga0495637_0237061 3300046520 Bacteria 660
157 Ga0495644_0131226 3300046523 Bacteria 955
158 Ga0495654_0175016 3300046530 Bacteria 933
159 Ga0495598_0119001 3300046537 Bacteria 894
160 Ga0495609_0235194 3300046538 Bacteria 758
161 Ga0495656_0253851 3300046615 Bacteria 889
162 Ga0495668_0650155 3300046616 Bacteria 583
163 Ga0495672_0008232 3300047320 Bacteria 7729
164 Ga0495673_0319977 3300047469 Bacteria 553
165 Ga0496100_0020849 3300048903 Bacteria 3938
166 Ga0496101_0004517 3300048904 Bacteria 8780
167 Ga0496101_0692432 3300048904 Bacteria 805
168 Ga0496102_1032928 3300048905 Bacteria 742
169 Ga0496107_0720435 3300048910 Bacteria 733
170 Ga0496111_1194920 3300048914 Bacteria 539
171 Ga0496112_1078247 3300048915 Bacteria 722
172 Ga0501067_0013429 3300049583 Bacteria 4536
173 Ga0501067_0251710 3300049583 Bacteria 983
174 Ga0501068_0050802 3300049584 Bacteria 2507
175 Ga0501069_0178071 3300049585 Bacteria 1229
176 Ga0501069_1019697 3300049585 Bacteria 506
177 Ga0501071_0651760 3300049587 Bacteria 810
178 Ga0501072_1503166 3300049588 Bacteria 520
179 Ga0501076_0327483 3300049592 Bacteria 1257
180 Ga0501079_1480844 3300049741 Bacteria 534
181 Ga0501045_0691465 3300049824 Bacteria 753
182 Ga0495655_0160425 3300053083 Bacteria 713
183 Ga0590075_043671 3300059424 Bacteria 1147
184 Ga0590075_213676 3300059424 Bacteria 511
185 Ga0587083_0038372 3300059505 Bacteria 990
186 Ga0501082_0634486 3300060353 Bacteria 935
187 Ga0530510_0140361 3300061734 Bacteria 1780
188 Ga0400489_83260
189 JGI24740J21852_10109189
190 JGI25406J46586_10030852
191 JGI25406J46586_10060964
192 Ga0007429J51699_1050783
193 Ga0032354_1042901
194 Ga0070658_11522982
195 Ga0070683_100604155
196 Ga0070682_100238591
197 Ga0070682_100714483
198 Ga0070682_101989722
199 Ga0070660_100011510
200 Ga0070692_10012348
201 Ga0070692_10701633
202 Ga0070675_100203271
203 Ga0070674_100785277
204 Ga0070674_101347013
205 Ga0070674_102225715
206 Ga0070659_100000077
207 Ga0070714_100011625
208 Ga0070713_100136144
209 Ga0070701_10893624
210 Ga0070663_100042815
211 Ga0070678_102410116
212 Ga0068867_102023386
213 Ga0070685_11580563
214 Ga0070684_101239214
215 Ga0070684_101847940
216 Ga0070697_100356598
217 Ga0070665_100567335
218 Ga0070665_101362899
219 Ga0070704_100673921
220 Ga0068856_100088689
221 Ga0068852_100383544
222 Ga0068852_102601812
223 Ga0068859_102151603
224 Ga0068866_10489461
225 Ga0068862_100896093
226 Ga0081455_10185438
227 Ga0081539_10000415
228 Ga0081539_10012354
229 Ga0081539_10086572
230 Ga0070717_10003734
231 Ga0075365_10522613
232 Ga0075432_10321627
233 Ga0070715_10441165
234 Ga0070712_100000009
235 Ga0097620_102151859
236 Ga0105245_11472868
237 Ga0105245_11663469
238 Ga0105245_12137496
239 Ga0114129_12238372
240 Ga0105243_10219983
241 Ga0105243_11346152
242 Ga0105242_12120147
243 Ga0105246_11461810
244 Ga0157369_10808456
245 Ga0157372_12154569
246 Ga0157375_12486843
247 Ga0157380_11195376
248 Ga0157380_13525165
249 Ga0157377_11658266
250 Ga0213873_10227435
251 Ga0213876_10030105
252 Ga0213875_10303149
253 Ga0207699_10817596
254 Ga0207693_10000101
255 Ga0207649_11442737
256 Ga0207652_11827144
257 Ga0207700_10155341
258 Ga0207664_10271716
259 Ga0207690_10000017
260 Ga0207709_10099672
261 Ga0207709_10959052
262 Ga0207669_10393146
263 Ga0207669_11197409
264 Ga0207669_11674359
265 Ga0207691_10071653
266 Ga0207661_10712971
267 Ga0207679_11508062
268 Ga0207668_12023126
269 Ga0207677_10429751
270 Ga0207677_10490566
271 Ga0207702_10126474
272 Ga0207648_10955298
273 Ga0207675_101242999
274 Ga0207698_10537561
275 Ga0268266_10782437
276 Ga0316576_10041499
277 Ga0307405_10566286
278 Ga0307413_10224386
279 Ga0307413_10939164
280 Ga0307413_11261935
281 Ga0307410_10118922
282 Ga0307406_10343752
283 Ga0307407_11447594
284 Ga0307407_11493693
285 Ga0307409_100099015
286 Ga0307409_100306331
287 Ga0307409_100818566
288 Ga0307409_102930211
289 Ga0307416_101503372
290 Ga0307414_10301360
291 Ga0307411_11328511
292 Ga0307411_11990286
293 Ga0307415_101825436
294 Ga0316580_10036465
295 Ga0316593_10410592
296 Ga0316582_1243124
297 Ga0395899_0552125
298 Ga0395900_1345166
299 Ga0395900_1593649
300 Ga0395898_0039884
301 Ga0395898_0509400
302 Ga0395898_0548261
303 Ga0395898_0596657
304 Ga0395898_1665987
305 Ga0436364_0725091
306 Ga0395901_0010769
307 Ga0395901_0625982
308 Ga0400490_32254
309 Ga0242420_112108
310 Ga0400483_107026
311 Ga0400483_243910
312 Ga0436365_0369417
313 Ga0436362_0672379
314 Ga0451800_0185598
315 Ga0451835_0463708
316 Ga0451835_1010065
317 Ga0451853_2882191
318 Ga0466965_0692036
319 Ga0466961_0161769
320 Ga0466963_0406412
321 Ga0466963_1087224
322 Ga0466963_1161729
323 Ga0466964_0173604
324 Ga0453684_1392489
325 Ga0453684_2242987
326 Ga0466971_0362400
327 Ga0466968_0152047
328 Ga0466960_0280160
329 Ga0466959_0070596
330 Ga0466958_0305058
331 Ga0466967_0042116
332 Ga0466967_0054750
333 Ga0466967_0082456
334 Ga0466967_0155328
335 Ga0466967_0950424
336 Ga0466967_1293843
337 Ga0466967_1625598
338 Ga0466967_2431487
339 Ga0495596_0260294
340 Ga0495583_0348308
341 Ga0495620_0359052
342 Ga0495631_0066407
343 Ga0495637_0237061
344 Ga0495644_0131226
345 Ga0495654_0175016
346 Ga0495598_0119001
347 Ga0495609_0235194
348 Ga0495656_0253851
349 Ga0495668_0650155
350 Ga0495672_0008232
351 Ga0495673_0319977
352 Ga0496100_0020849
353 Ga0496101_0004517
354 Ga0496101_0692432
355 Ga0496102_1032928
356 Ga0496107_0720435
357 Ga0496111_1194920
358 Ga0496112_1078247
359 Ga0501067_0013429
360 Ga0501067_0251710
361 Ga0501068_0050802
362 Ga0501069_0178071
363 Ga0501069_1019697
364 Ga0501071_0651760
365 Ga0501072_1503166
366 Ga0501076_0327483
367 Ga0501079_1480844
368 Ga0501045_0691465
369 Ga0495655_0160425
370 Ga0590075_043671
371 Ga0590075_213676
372 Ga0587083_0038372
373 Ga0501082_0634486
374 Ga0530510_0140361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

13

77

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.983 1 67
1c9o-assembly1.cif.gz_B crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp 0.9787 1 67
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.9768 2 67
1hz9-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.9758 1 67
3i2z-assembly2.cif.gz_B structure of cold shock protein e from salmonella typhimurium 0.9747 1 67
ID Description Score Start End Superfamily
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9819 2 65 2.40.50.140
af_P92186_48_133_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9627 2 64 2.40.50.140
af_P91306_55_138_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9622 2 65 2.40.50.140
5ytvA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.958 2 65 2.40.50.140
2haxB02 Special;Other non-globular;Rhinovirus 14, subunit 4; 0.9568 41 67 6.20.370.130
ID Description Score Start End GO Terms
AF-A0A662EB50-F1-model_v4 ATP-dependent helicase 1.005 2 67 GO:0003676
GO:0003724
GO:0005524
GO:0005829
GO:0016787
AF-A0A450WFT5-F1-model_v4 Cold-shock DNA-binding protein family 1.002 2 67 GO:0003677
GO:0005829
AF-A0A510HJU9-F1-model_v4 Cold-shock protein 1.001 1 67 GO:0003676
GO:0005737
AF-A0A4U0YJC9-F1-model_v4 Cold-shock protein 1.001 1 65 GO:0003676
GO:0005829
AF-A0A1A1YC89-F1-model_v4 Cold-shock protein 1.001 1 67 GO:0003676
GO:0005737

Map