F286318

General Info

Members Datasets Scaffolds Average Seq Length
186 115 185 196

Family's Representative Sequence

Representative Sequence 3300036534|Ga0310109_000141|Ga0310109_000141_946_1614
Length 222
Sequence MAVFYKYERGCHSILSPGTQVQIEMRRELFMSKVVVFTNLTLDGVMQAPGRPDEDRRNGFEHGGWAVPYAAMAQAGKSMPSTSALLLGRRTYEDFYAFWPNQINNPYTEMLNNTQKYVASTTLSEPLSWSNSTLLSGNAAEAVAKLKQEPGKDLLIMGSGELIQSLMRHDLVDEYILLIHPLVLGSGRRLFPDGGEAAALRLVATSTTNNGVAIATYQPASR

Samples

Sample ID Description Type Environment
1 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.16
Metatranscriptomes 4.3
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 2.15
Rhizosphere 93.01
Stem 0
Stem Tuber 0
Unclassified 4.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10051981 3300003203 Bacteria 1368
2 JGI25407J50210_10005392 3300003373 Bacteria 3143
3 JGI25407J50210_10016677 3300003373 Unclassified 1903
4 JGI25407J50210_10017121 3300003373 Bacteria 1880
5 JGI25407J50210_10049686 3300003373 Bacteria 1064
6 Ga0070658_10435987 3300005327 Bacteria 1128
7 Ga0070666_10443764 3300005335 Bacteria 936
8 Ga0070691_10025190 3300005341 Bacteria 2770
9 Ga0070687_100017159 3300005343 Bacteria 3321
10 Ga0070661_100058397 3300005344 Bacteria 2827
11 Ga0070659_100287798 3300005366 Bacteria 1368
12 Ga0070703_10012946 3300005406 Bacteria 2364
13 Ga0070709_10065226 3300005434 Bacteria 2331
14 Ga0070714_100011868 3300005435 Bacteria 6925
15 Ga0070714_100028507 3300005435 Bacteria 4634
16 Ga0070714_100242121 3300005435 Unclassified 1665
17 Ga0070714_100450348 3300005435 Bacteria 1223
18 Ga0070714_100929604 3300005435 Bacteria 845
19 Ga0070714_101126081 3300005435 Bacteria 765
20 Ga0070713_100003290 3300005436 Bacteria 10646
21 Ga0070713_100285795 3300005436 Bacteria 1515
22 Ga0070713_100361432 3300005436 Bacteria 1349
23 Ga0070713_100580120 3300005436 Bacteria 1064
24 Ga0070713_100592556 3300005436 Bacteria 1052
25 Ga0070713_100750324 3300005436 Bacteria 934
26 Ga0070701_10578462 3300005438 Bacteria 741
27 Ga0070708_100001053 3300005445 Bacteria 21005
28 Ga0070706_100009993 3300005467 Bacteria 8813
29 Ga0070706_100080722 3300005467 Bacteria 3012
30 Ga0070706_100206485 3300005467 Bacteria 1834
31 Ga0070707_100007511 3300005468 Bacteria 10123
32 Ga0070707_100010853 3300005468 Bacteria 8484
33 Ga0070699_100038296 3300005518 Bacteria 4151
34 Ga0070699_100053142 3300005518 Bacteria 3506
35 Ga0070684_100000189 3300005535 Bacteria 42780
36 Ga0070697_100175864 3300005536 Bacteria 1813
37 Ga0070697_100333106 3300005536 Bacteria 1309
38 Ga0070697_100847199 3300005536 Bacteria 810
39 Ga0068857_100000218 3300005577 Bacteria 37864
40 Ga0068857_100273679 3300005577 Unclassified 1552
41 Ga0068860_100796257 3300005843 Bacteria 958
42 Ga0068860_100919618 3300005843 Unclassified 891
43 Ga0081455_10100090 3300005937 Bacteria 2330
44 Ga0081538_10000128 3300005981 Bacteria 77546
45 Ga0081538_10002609 3300005981 Bacteria 17449
46 Ga0081538_10007748 3300005981 Bacteria 9235
47 Ga0081538_10008413 3300005981 Bacteria 8761
48 Ga0081538_10011191 3300005981 Bacteria 7289
49 Ga0081538_10011319 3300005981 Bacteria 7235
50 Ga0081538_10154387 3300005981 Bacteria 1033
51 Ga0081539_10002116 3300005985 Bacteria 29407
52 Ga0081539_10047945 3300005985 Bacteria 2435
53 Ga0070717_10009947 3300006028 Bacteria 7156
54 Ga0070717_10038436 3300006028 Bacteria 3890
55 Ga0070716_100023010 3300006173 Unclassified 3299
56 Ga0070712_100775930 3300006175 Bacteria 821
57 Ga0075431_100079734 3300006847 Bacteria 3380
58 Ga0075433_10037475 3300006852 Bacteria 4184
59 Ga0099794_10029381 3300007265 Bacteria 2561
60 Ga0111539_10056785 3300009094 Bacteria 4652
61 Ga0105247_10038475 3300009101 Bacteria 2921
62 Ga0114129_10000179 3300009147 Bacteria 70108
63 Ga0114129_10154382 3300009147 Bacteria 3141
64 Ga0105237_10159406 3300009545 Unclassified 2254
65 Ga0105238_10301933 3300009551 Bacteria 1585
66 Ga0157369_10004434 3300013105 Bacteria 16566
67 Ga0157378_10211019 3300013297 Bacteria 1841
68 Ga0163162_10961700 3300013306 Unclassified 965
69 Ga0157380_10458205 3300014326 Bacteria 1227
70 Ga0182008_10053468 3300014497 Bacteria 1999
71 Ga0197907_10034815 3300020069 Bacteria 1052
72 Ga0197907_11228751 3300020069 Bacteria 1242
73 Ga0206356_10654433 3300020070 Bacteria 2139
74 Ga0206349_1655164 3300020075 Bacteria 1484
75 Ga0206350_11261268 3300020080 Bacteria 1933
76 Ga0213874_10000392 3300021377 Bacteria 8655
77 Ga0224712_10021239 3300022467 Bacteria 2218
78 Ga0224712_10042103 3300022467 Unclassified 1729
79 Ga0207699_10023889 3300025906 Unclassified 3334
80 Ga0207684_10001558 3300025910 Bacteria 24501
81 Ga0207684_10001763 3300025910 Bacteria 22852
82 Ga0207684_10001966 3300025910 Bacteria 21231
83 Ga0207684_10008305 3300025910 Bacteria 9236
84 Ga0207684_11035939 3300025910 Bacteria 685
85 Ga0207662_10006742 3300025918 Bacteria 6210
86 Ga0207649_10066744 3300025920 Bacteria 2282
87 Ga0207646_10007523 3300025922 Bacteria 11052
88 Ga0207646_10067019 3300025922 Bacteria 3205
89 Ga0207646_10127969 3300025922 Bacteria 2284
90 Ga0207700_10007342 3300025928 Bacteria 6730
91 Ga0207700_10526593 3300025928 Bacteria 1047
92 Ga0207664_10029784 3300025929 Bacteria 4162
93 Ga0207664_10282634 3300025929 Bacteria 1456
94 Ga0207665_10012685 3300025939 Bacteria 5541
95 Ga0207665_10349860 3300025939 Bacteria 1115
96 Ga0207679_10007027 3300025945 Bacteria 7134
97 Ga0207667_10370866 3300025949 Bacteria 1459
98 Ga0207702_10002092 3300026078 Bacteria 19254
99 Ga0207674_10000366 3300026116 Bacteria 58754
100 Ga0207675_100934084 3300026118 Unclassified 884
101 Ga0209588_1033457 3300027671 Bacteria 1648
102 Ga0268264_11159251 3300028381 Bacteria 782
103 Ga0268264_11197209 3300028381 Unclassified 769
104 Ga0307408_100021057 3300031548 Bacteria 4408
105 Ga0307405_10014892 3300031731 Bacteria 4197
106 Ga0307405_10016182 3300031731 Bacteria 4060
107 Ga0307405_10057910 3300031731 Bacteria 2436
108 Ga0307405_10602724 3300031731 Bacteria 896
109 Ga0307413_10010648 3300031824 Bacteria 4476
110 Ga0307413_11003104 3300031824 Unclassified 716
111 Ga0307410_10195930 3300031852 Bacteria 1539
112 Ga0307410_10633095 3300031852 Bacteria 895
113 Ga0307406_10012562 3300031901 Bacteria 4827
114 Ga0307406_10308021 3300031901 Bacteria 1220
115 Ga0307407_10007602 3300031903 Bacteria 4917
116 Ga0307412_10171413 3300031911 Bacteria 1623
117 Ga0307409_100002636 3300031995 Bacteria 9439
118 Ga0307409_100014379 3300031995 Bacteria 5146
119 Ga0307409_100078917 3300031995 Bacteria 2650
120 Ga0307409_100699831 3300031995 Bacteria 1012
121 Ga0307409_101188657 3300031995 Bacteria 786
122 Ga0307416_100003347 3300032002 Bacteria 9383
123 Ga0307416_100007475 3300032002 Bacteria 6952
124 Ga0307416_100015725 3300032002 Bacteria 5235
125 Ga0307416_101295191 3300032002 Bacteria 834
126 Ga0307414_10195260 3300032004 Bacteria 1641
127 Ga0307414_10432359 3300032004 Bacteria 1150
128 Ga0307414_10571377 3300032004 Bacteria 1010
129 Ga0307414_10919500 3300032004 Unclassified 803
130 Ga0307411_10169816 3300032005 Bacteria 1643
131 Ga0307415_100002452 3300032126 Bacteria 9256
132 Ga0307415_100002787 3300032126 Bacteria 8752
133 Ga0307415_100011590 3300032126 Bacteria 5053
134 Ga0310109_000141 3300036534 Bacteria 4201
135 Ga0395899_0068407 3300037312 Bacteria 2604
136 Ga0395900_0024961 3300037418 Bacteria 6117
137 Ga0395900_0610866 3300037418 Bacteria 1030
138 Ga0395898_0021096 3300037466 Bacteria 6608
139 Ga0395898_0025537 3300037466 Bacteria 5951
140 Ga0395898_0292417 3300037466 Bacteria 1554
141 Ga0395905_0281983 3300037471 Bacteria 1547
142 Ga0395905_0936015 3300037471 Bacteria 769
143 Ga0395901_0010474 3300038443 Bacteria 9391
144 Ga0395901_0620328 3300038443 Bacteria 1088
145 Ga0395901_0792233 3300038443 Bacteria 937
146 Ga0436365_0018318 3300039437 Bacteria 842
147 Ga0436365_1773152 3300039437 Bacteria 6189
148 Ga0436360_0042306 3300039438 Bacteria 1057
149 Ga0436361_0497385 3300039447 Bacteria 2527
150 Ga0436363_0811346 3300039450 Bacteria 1643
151 Ga0436363_1167470 3300039450 Bacteria 1221
152 Ga0436363_1173560 3300039450 Bacteria 60217
153 Ga0436362_1193578 3300039453 Unclassified 1777
154 Ga0451853_0102610 3300041512 Bacteria 891
155 Ga0450916_000141 3300042530 Bacteria 5045
156 Ga0453683_0008390 3300044673 Bacteria 6935
157 Ga0466963_0625108 3300044694 Bacteria 760
158 Ga0453684_0166805 3300044712 Bacteria 2599
159 Ga0453684_0637129 3300044712 Bacteria 1164
160 Ga0466959_0245007 3300045049 Bacteria 1237
161 Ga0451576_0032691 3300045051 Bacteria 5534
162 Ga0496108_0000046 3300048911 Bacteria 133726
163 Ga0496109_0224189 3300048912 Bacteria 1768
164 Ga0496112_0020461 3300048915 Bacteria 6274
165 Ga0496115_0347379 3300048918 Bacteria 1210
166 Ga0501036_0122992 3300049572 Bacteria 2191
167 Ga0501041_0035002 3300049577 Bacteria 3042
168 Ga0501042_0096731 3300049578 Bacteria 2121
169 Ga0501043_0083625 3300049579 Bacteria 2509
170 Ga0501046_0097717 3300049580 Bacteria 2255
171 Ga0501047_0047554 3300049581 Bacteria 4144
172 Ga0501047_0178868 3300049581 Bacteria 1988
173 Ga0501048_0059289 3300049582 Bacteria 2712
174 Ga0501071_0202949 3300049587 Bacteria 1489
175 Ga0501072_0083681 3300049588 Bacteria 2529
176 Ga0501074_0050795 3300049590 Bacteria 2993
177 Ga0501076_0093380 3300049592 Bacteria 2421
178 Ga0501079_0011835 3300049741 Bacteria 6660
179 nmdc:mga05p37_227338_c1 3300050507 Bacteria 2249
180 nmdc:mga09592_382013_c1 3300050508 Unclassified 1218
181 nmdc:mga06r32_65793_c1 3300050510 Bacteria 3497
182 nmdc:mga0a205_2973_c1 3300050515 Bacteria 9543
183 Ga0500637_0150806 3300053178 Bacteria 1343
184 Ga0501084_0081970 3300054114 Bacteria 2706
185 Ga0530510_0095985 3300061734 Bacteria 2166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10435987 Ga0070658_104359872 178
2 3300005577 Ga0068857_100000218 Ga0068857_10000021825 178
3 3300005843 Ga0068860_100919618 Ga0068860_1009196182 178
4 3300020069 Ga0197907_10034815 Ga0197907_100348152 178
5 3300020075 Ga0206349_1655164 Ga0206349_16551642 178
6 3300025928 Ga0207700_10007342 Ga0207700_100073425 178
7 3300025945 Ga0207679_10007027 Ga0207679_100070277 178
8 3300026078 Ga0207702_10002092 Ga0207702_100020926 178
9 3300026116 Ga0207674_10000366 Ga0207674_100003669 178
10 3300028381 Ga0268264_11197209 Ga0268264_111972091 178
11 3300031824 Ga0307413_11003104 Ga0307413_110031042 179
12 3300031995 Ga0307409_101188657 Ga0307409_1011886571 179
13 3300032004 Ga0307414_10919500 Ga0307414_109195001 179
14 3300025939 Ga0207665_10349860 Ga0207665_103498602 180
15 3300026118 Ga0207675_100934084 Ga0207675_1009340841 180
16 3300049581 Ga0501047_0047554 Ga0501047_0047554_2182_2757 180
17 3300005335 Ga0070666_10443764 Ga0070666_104437641 181
18 3300005343 Ga0070687_100017159 Ga0070687_1000171592 181
19 3300025918 Ga0207662_10006742 Ga0207662_100067426 181
20 3300005467 Ga0070706_100009993 Ga0070706_10000999313 188
21 3300005468 Ga0070707_100007511 Ga0070707_1000075114 188
22 3300005536 Ga0070697_100175864 Ga0070697_1001758643 188
23 3300006028 Ga0070717_10009947 Ga0070717_1000994713 188
24 3300025910 Ga0207684_10001763 Ga0207684_1000176324 188
25 3300025922 Ga0207646_10067019 Ga0207646_100670195 188
26 3300050507 nmdc:mga05p37_227338_c1 nmdc:mga05p37_227338_c1_1527_2099 188
27 3300053178 Ga0500637_0150806 Ga0500637_0150806_426_998 188
28 3300005435 Ga0070714_100450348 Ga0070714_1004503482 189
29 3300005436 Ga0070713_100361432 Ga0070713_1003614321 189
30 3300005436 Ga0070713_100580120 Ga0070713_1005801202 189
31 3300005436 Ga0070713_100750324 Ga0070713_1007503241 189
32 3300005445 Ga0070708_100001053 Ga0070708_10000105310 189
33 3300005467 Ga0070706_100206485 Ga0070706_1002064852 189
34 3300005468 Ga0070707_100010853 Ga0070707_10001085311 189
35 3300005518 Ga0070699_100053142 Ga0070699_1000531424 189
36 3300005536 Ga0070697_100333106 Ga0070697_1003331062 189
37 3300006028 Ga0070717_10038436 Ga0070717_100384364 189
38 3300025910 Ga0207684_11035939 Ga0207684_110359391 189
39 3300025922 Ga0207646_10127969 Ga0207646_101279692 189
40 3300025928 Ga0207700_10526593 Ga0207700_105265932 189
41 iso_pu_bacteria 2939598168 2939601467 189
42 3300005435 Ga0070714_100242121 Ga0070714_1002421212 190
43 3300005435 Ga0070714_101126081 Ga0070714_1011260811 190
44 3300005467 Ga0070706_100080722 Ga0070706_1000807223 190
45 3300005536 Ga0070697_100847199 Ga0070697_1008471991 190
46 3300005577 Ga0068857_100273679 Ga0068857_1002736792 190
47 3300006852 Ga0075433_10037475 Ga0075433_100374753 190
48 3300009101 Ga0105247_10038475 Ga0105247_100384753 190
49 3300013297 Ga0157378_10211019 Ga0157378_102110192 190
50 3300013306 Ga0163162_10961700 Ga0163162_109617002 190
51 3300020069 Ga0197907_11228751 Ga0197907_112287512 190
52 3300022467 Ga0224712_10042103 Ga0224712_100421032 190
53 3300025910 Ga0207684_10008305 Ga0207684_100083052 190
54 3300036534 Ga0310109_000141 Ga0310109_000141_946_1614 190
55 3300039450 Ga0436363_1167470 Ga0436363_1167470_141_752 190
56 3300039453 Ga0436362_1193578 Ga0436362_1193578_658_1269 190
57 3300041512 Ga0451853_0102610 Ga0451853_0102610_69_647 190
58 3300044673 Ga0453683_0008390 Ga0453683_0008390_1590_2174 190
59 3300044712 Ga0453684_0166805 Ga0453684_0166805_542_1126 190
60 3300045051 Ga0451576_0032691 Ga0451576_0032691_1006_1590 190
61 3300048911 Ga0496108_0000046 Ga0496108_0000046_77213_77809 190
62 3300050515 nmdc:mga0a205_2973_c1 nmdc:mga0a205_2973_c1_1376_1972 190
63 3300003373 JGI25407J50210_10016677 JGI25407J50210_100166772 191
64 3300005406 Ga0070703_10012946 Ga0070703_100129462 191
65 3300005518 Ga0070699_100038296 Ga0070699_1000382963 191
66 3300005843 Ga0068860_100796257 Ga0068860_1007962571 191
67 3300005981 Ga0081538_10000128 Ga0081538_1000012854 191
68 3300006847 Ga0075431_100079734 Ga0075431_1000797342 191
69 3300009094 Ga0111539_10056785 Ga0111539_100567855 191
70 3300009147 Ga0114129_10000179 Ga0114129_1000017913 191
71 3300009147 Ga0114129_10154382 Ga0114129_101543823 191
72 3300009545 Ga0105237_10159406 Ga0105237_101594061 191
73 3300014326 Ga0157380_10458205 Ga0157380_104582052 191
74 3300025910 Ga0207684_10001558 Ga0207684_100015583 191
75 3300025922 Ga0207646_10007523 Ga0207646_100075237 191
76 3300028381 Ga0268264_11159251 Ga0268264_111592511 191
77 3300044712 Ga0453684_0637129 Ga0453684_0637129_425_1012 191
78 3300050508 nmdc:mga09592_382013_c1 nmdc:mga09592_382013_c1_21_623 191
79 3300050510 nmdc:mga06r32_65793_c1 nmdc:mga06r32_65793_c1_2038_2628 191
80 3300005435 Ga0070714_100011868 Ga0070714_1000118686 192
81 3300005436 Ga0070713_100592556 Ga0070713_1005925561 192
82 3300006173 Ga0070716_100023010 Ga0070716_1000230102 192
83 3300006175 Ga0070712_100775930 Ga0070712_1007759301 192
84 3300025906 Ga0207699_10023889 Ga0207699_100238892 192
85 3300025939 Ga0207665_10012685 Ga0207665_100126853 192
86 3300037466 Ga0395898_0021096 Ga0395898_0021096_4502_5086 192
87 3300044694 Ga0466963_0625108 Ga0466963_0625108_144_746 192
88 3300003203 JGI25406J46586_10051981 JGI25406J46586_100519811 193
89 3300003373 JGI25407J50210_10005392 JGI25407J50210_100053923 193
90 3300003373 JGI25407J50210_10017121 JGI25407J50210_100171212 193
91 3300003373 JGI25407J50210_10049686 JGI25407J50210_100496862 193
92 3300005341 Ga0070691_10025190 Ga0070691_100251902 193
93 3300005344 Ga0070661_100058397 Ga0070661_1000583972 193
94 3300005366 Ga0070659_100287798 Ga0070659_1002877982 193
95 3300005434 Ga0070709_10065226 Ga0070709_100652262 193
96 3300005435 Ga0070714_100028507 Ga0070714_1000285074 193
97 3300005435 Ga0070714_100929604 Ga0070714_1009296042 193
98 3300005436 Ga0070713_100003290 Ga0070713_1000032909 193
99 3300005436 Ga0070713_100285795 Ga0070713_1002857953 193
100 3300005438 Ga0070701_10578462 Ga0070701_105784621 193
101 3300005535 Ga0070684_100000189 Ga0070684_10000018934 193
102 3300005937 Ga0081455_10100090 Ga0081455_101000903 193
103 3300005981 Ga0081538_10002609 Ga0081538_100026095 193
104 3300005981 Ga0081538_10007748 Ga0081538_100077485 193
105 3300005981 Ga0081538_10008413 Ga0081538_100084139 193
106 3300005981 Ga0081538_10011191 Ga0081538_100111914 193
107 3300005981 Ga0081538_10011319 Ga0081538_100113194 193
108 3300005981 Ga0081538_10154387 Ga0081538_101543872 193
109 3300005985 Ga0081539_10002116 Ga0081539_100021162 193
110 3300005985 Ga0081539_10047945 Ga0081539_100479452 193
111 3300007265 Ga0099794_10029381 Ga0099794_100293814 193
112 3300009551 Ga0105238_10301933 Ga0105238_103019333 193
113 3300013105 Ga0157369_10004434 Ga0157369_100044348 193
114 3300014497 Ga0182008_10053468 Ga0182008_100534683 193
115 3300020070 Ga0206356_10654433 Ga0206356_106544333 193
116 3300020080 Ga0206350_11261268 Ga0206350_112612683 193
117 3300021377 Ga0213874_10000392 Ga0213874_100003926 193
118 3300022467 Ga0224712_10021239 Ga0224712_100212392 193
119 3300025910 Ga0207684_10001966 Ga0207684_100019664 193
120 3300025920 Ga0207649_10066744 Ga0207649_100667442 193
121 3300025929 Ga0207664_10029784 Ga0207664_100297844 193
122 3300025929 Ga0207664_10282634 Ga0207664_102826343 193
123 3300025949 Ga0207667_10370866 Ga0207667_103708662 193
124 3300027671 Ga0209588_1033457 Ga0209588_10334572 193
125 3300031548 Ga0307408_100021057 Ga0307408_1000210571 193
126 3300031731 Ga0307405_10014892 Ga0307405_100148925 193
127 3300031731 Ga0307405_10016182 Ga0307405_100161824 193
128 3300031731 Ga0307405_10057910 Ga0307405_100579102 193
129 3300031731 Ga0307405_10602724 Ga0307405_106027242 193
130 3300031824 Ga0307413_10010648 Ga0307413_100106481 193
131 3300031852 Ga0307410_10195930 Ga0307410_101959301 193
132 3300031852 Ga0307410_10633095 Ga0307410_106330951 193
133 3300031901 Ga0307406_10012562 Ga0307406_100125625 193
134 3300031901 Ga0307406_10308021 Ga0307406_103080212 193
135 3300031903 Ga0307407_10007602 Ga0307407_100076025 193
136 3300031911 Ga0307412_10171413 Ga0307412_101714132 193
137 3300031995 Ga0307409_100002636 Ga0307409_1000026365 193
138 3300031995 Ga0307409_100014379 Ga0307409_1000143799 193
139 3300031995 Ga0307409_100078917 Ga0307409_1000789171 193
140 3300031995 Ga0307409_100699831 Ga0307409_1006998311 193
141 3300032002 Ga0307416_100003347 Ga0307416_1000033475 193
142 3300032002 Ga0307416_100007475 Ga0307416_1000074758 193
143 3300032002 Ga0307416_100015725 Ga0307416_1000157252 193
144 3300032002 Ga0307416_101295191 Ga0307416_1012951911 193
145 3300032004 Ga0307414_10195260 Ga0307414_101952601 193
146 3300032004 Ga0307414_10432359 Ga0307414_104323592 193
147 3300032004 Ga0307414_10571377 Ga0307414_105713771 193
148 3300032005 Ga0307411_10169816 Ga0307411_101698161 193
149 3300032126 Ga0307415_100002452 Ga0307415_1000024521 193
150 3300032126 Ga0307415_100002787 Ga0307415_1000027875 193
151 3300032126 Ga0307415_100011590 Ga0307415_1000115902 193
152 3300037312 Ga0395899_0068407 Ga0395899_0068407_1944_2525 193
153 3300037418 Ga0395900_0024961 Ga0395900_0024961_142_723 193
154 3300037418 Ga0395900_0610866 Ga0395900_0610866_29_634 193
155 3300037466 Ga0395898_0025537 Ga0395898_0025537_3259_3840 193
156 3300037466 Ga0395898_0292417 Ga0395898_0292417_136_717 193
157 3300037471 Ga0395905_0281983 Ga0395905_0281983_72_653 193
158 3300037471 Ga0395905_0936015 Ga0395905_0936015_64_645 193
159 3300038443 Ga0395901_0010474 Ga0395901_0010474_5704_6285 193
160 3300038443 Ga0395901_0620328 Ga0395901_0620328_34_639 193
161 3300038443 Ga0395901_0792233 Ga0395901_0792233_244_825 193
162 3300039437 Ga0436365_0018318 Ga0436365_0018318_85_666 193
163 3300039437 Ga0436365_1773152 Ga0436365_1773152_4698_5279 193
164 3300039438 Ga0436360_0042306 Ga0436360_0042306_435_1028 193
165 3300039447 Ga0436361_0497385 Ga0436361_0497385_451_1044 193
166 3300039450 Ga0436363_0811346 Ga0436363_0811346_921_1502 193
167 3300039450 Ga0436363_1173560 Ga0436363_1173560_6032_6613 193
168 3300042530 Ga0450916_000141 Ga0450916_000141_1144_1731 193
169 3300045049 Ga0466959_0245007 Ga0466959_0245007_454_1041 193
170 3300048912 Ga0496109_0224189 Ga0496109_0224189_834_1493 193
171 3300048915 Ga0496112_0020461 Ga0496112_0020461_5260_5919 193
172 3300048918 Ga0496115_0347379 Ga0496115_0347379_555_1157 193
173 3300049572 Ga0501036_0122992 Ga0501036_0122992_1495_2076 193
174 3300049577 Ga0501041_0035002 Ga0501041_0035002_984_1565 193
175 3300049578 Ga0501042_0096731 Ga0501042_0096731_1523_2104 193
176 3300049579 Ga0501043_0083625 Ga0501043_0083625_435_1016 193
177 3300049580 Ga0501046_0097717 Ga0501046_0097717_1014_1595 193
178 3300049581 Ga0501047_0178868 Ga0501047_0178868_1021_1602 193
179 3300049582 Ga0501048_0059289 Ga0501048_0059289_1495_2076 193
180 3300049587 Ga0501071_0202949 Ga0501071_0202949_498_1079 193
181 3300049588 Ga0501072_0083681 Ga0501072_0083681_1487_2068 193
182 3300049590 Ga0501074_0050795 Ga0501074_0050795_922_1503 193
183 3300049592 Ga0501076_0093380 Ga0501076_0093380_394_975 193
184 3300049741 Ga0501079_0011835 Ga0501079_0011835_379_960 193
185 3300054114 Ga0501084_0081970 Ga0501084_0081970_1523_2104 193
186 3300061734 Ga0530510_0095985 Ga0530510_0095985_145_726 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

32

214

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.824 1 191
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8199 1 191
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8148 1 189
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8065 1 189
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7929 1 191
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7971 1 191 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7932 1 191 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.786 1 192 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7791 3 190 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.778 1 192 3.40.430.10
ID Description Score Start End GO Terms
AF-K9RR86-F1-model_v4 Dihydrofolate reductase 0.9485 1 193 GO:0008703
GO:0009231
AF-A0A1Q7LUM4-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9452 84 190 GO:0008703
GO:0009231
AF-K9RR86-F1-model_v4 Dihydrofolate reductase 0.9433 1 193 GO:0008703
GO:0009231
AF-A0A7W9DPT2-F1-model_v4 Dihydrofolate reductase 0.943 53 191 GO:0008703
GO:0009231
AF-A0A7W7G924-F1-model_v4 Dihydrofolate reductase 0.9384 45 191 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
86.66 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map