F285951

General Info

Members Datasets Scaffolds Average Seq Length
186 130 181 306

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10005981|Ga0105238_100059816
Length 351
Sequence MLPASESERPGRRMHGPVRLTPWPVPVSMRAILRRRGRPEEKIRMSTGFVFPGQGSQAVGMGRSLAEAFGSARLVFEEIDDALGQRLSRLMFEGPESDLTLTENAQPALMAVSLAVLAVLESEGGFKLSDKAAFVAGHSLGEYTALAAAGALSLPDAARLLKRRGLAMQRAVPVGAGAMAALLGLDLPVAEEVACXXANDNAPGQVVVSGDRAAVERAVAIAAEKGAKRSILLPVSAPFHCALMAPAAREMEEALAAADLLPPTVPLIANITAAPVSDPETIRRQLVQQVTGMVRWRESVLRLKEEGVQRLVEIGAGKVLSGLCKRIDREIEALAVGQPGDVEGALRALTA

Samples

Sample ID Description Type Environment
1 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
2 2909042592 Labrys sp. LIt4 Isolate Nodule
3 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
4 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
36 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
40 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
48 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
50 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
51 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
55 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
56 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
57 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
58 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
72 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
77 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
78 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
79 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
80 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
81 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
82 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
95 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
96 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
97 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
103 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
113 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
114 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
115 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
116 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
117 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
118 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
119 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
120 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
121 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
122 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
123 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
124 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
129 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
130 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.68
Nodule 0.54
Rhizoplane 0.54
Rhizosphere 82.26
Stem 0
Stem Tuber 0
Unclassified 6.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000772 3300000549 Bacteria 5068
2 JGI24741J21665_1004143 3300001915 Bacteria 3277
3 JGI24740J21852_10029090 3300001979 Bacteria 1818
4 JGI25153J46596_10000054 3300003215 Bacteria 136806
5 Ga0055531_10014275 3300003794 Bacteria 3589
6 Ga0070658_10118088 3300005327 Bacteria 2202
7 Ga0070661_100008588 3300005344 Bacteria 7063
8 Ga0070661_100062299 3300005344 Bacteria 2738
9 Ga0070674_100012953 3300005356 Bacteria 5136
10 Ga0070667_100025603 3300005367 Bacteria 4905
11 Ga0070694_100076291 3300005444 Bacteria 2320
12 Ga0070681_10265500 3300005458 Bacteria 1628
13 Ga0070697_100451891 3300005536 Bacteria 1119
14 Ga0068853_100119036 3300005539 Bacteria 2354
15 Ga0068855_100276660 3300005563 Bacteria 1865
16 Ga0068854_100079247 3300005578 Bacteria 2421
17 Ga0068866_10060492 3300005718 Bacteria 1964
18 Ga0068861_100322007 3300005719 Bacteria 1347
19 Ga0068863_100000030 3300005841 Bacteria 176023
20 Ga0068862_100025088 3300005844 Bacteria 5004
21 Ga0068862_100069344 3300005844 Bacteria 3043
22 Ga0081538_10037548 3300005981 Bacteria 3141
23 Ga0097621_100045054 3300006237 Bacteria 3562
24 Ga0068871_100090272 3300006358 Bacteria 2551
25 Ga0075433_10054074 3300006852 Bacteria 3502
26 Ga0075433_10203087 3300006852 Bacteria 1762
27 Ga0105240_10111612 3300009093 Bacteria 3307
28 Ga0111539_10013156 3300009094 Bacteria 10348
29 Ga0111539_10378259 3300009094 Bacteria 1648
30 Ga0105245_10154487 3300009098 Bacteria 2172
31 Ga0114129_10003089 3300009147 Bacteria 23361
32 Ga0105248_10028382 3300009177 Bacteria 6234
33 Ga0105238_10005981 3300009551 Bacteria 12065
34 Ga0105249_10111986 3300009553 Bacteria 2581
35 Ga0105239_10007588 3300010375 Bacteria 12431
36 Ga0182005_1002347 3300015265 Bacteria 6825
37 Ga0213872_10021816 3300021361 Bacteria 2949
38 Ga0213872_10030747 3300021361 Bacteria 2460
39 Ga0213872_10039007 3300021361 Bacteria 2168
40 Ga0213876_10004806 3300021384 Bacteria 7495
41 Ga0213875_10005815 3300021388 Bacteria 6562
42 Ga0213875_10129779 3300021388 Bacteria 1179
43 Ga0209758_1000119 3300025297 Bacteria 195545
44 Ga0209050_1003817 3300025298 Bacteria 10753
45 Ga0209257_1000562 3300025304 Bacteria 63202
46 Ga0209257_1037011 3300025304 Bacteria 1492
47 Ga0207705_10146155 3300025909 Bacteria 1769
48 Ga0207640_10007291 3300025981 Bacteria 6101
49 Ga0207639_10059460 3300026041 Bacteria 2944
50 Ga0207675_100161118 3300026118 Bacteria 2140
51 Ga0209974_10075778 3300027876 Bacteria 1152
52 Ga0207428_10000096 3300027907 Bacteria 123081
53 Ga0207428_10315425 3300027907 Bacteria 1155
54 Ga0268265_10031043 3300028380 Bacteria 3855
55 Ga0265313_10008177 3300031595 Bacteria 6992
56 Ga0307508_10060187 3300031616 Bacteria 3359
57 Ga0307516_10256688 3300031730 Bacteria 1440
58 Ga0307412_10162353 3300031911 Bacteria 1662
59 Ga0307416_100197628 3300032002 Bacteria 1904
60 Ga0373934_0007675 3300035086 Bacteria 4008
61 Ga0373940_0006342 3300035088 Bacteria 2620
62 Ga0373939_0009378 3300035114 Bacteria 2425
63 Ga0373957_0037058 3300035120 Bacteria 1820
64 Ga0373955_0012875 3300035172 Bacteria 4032
65 Ga0373933_0005564 3300035724 Bacteria 6863
66 Ga0373937_0131921 3300036401 Bacteria 2333
67 Ga0316582_0053337 3300036647 Bacteria 2572
68 Ga0395900_0183692 3300037418 Bacteria 2123
69 Ga0395900_0185521 3300037418 Bacteria 2112
70 Ga0395898_0205274 3300037466 Bacteria 1880
71 Ga0395898_0380618 3300037466 Bacteria 1346
72 Ga0395905_0626872 3300037471 Bacteria 977
73 Ga0436364_0046669 3300037853 Bacteria 24459
74 Ga0436364_0092464 3300037853 Bacteria 4175
75 Ga0436364_0523972 3300037853 Bacteria 4411
76 Ga0436364_1289732 3300037853 Bacteria 16913
77 Ga0395901_0169003 3300038443 Bacteria 2294
78 Ga0436365_0137032 3300039437 Bacteria 18768
79 Ga0436360_0011981 3300039438 Bacteria 3913
80 Ga0436360_1354164 3300039438 Bacteria 1197
81 Ga0436361_0127122 3300039447 Bacteria 1482
82 Ga0436361_0211622 3300039447 Bacteria 7071
83 Ga0436361_0241046 3300039447 Bacteria 3923
84 Ga0436361_0483972 3300039447 Bacteria 3509
85 Ga0436361_1003157 3300039447 Bacteria 2729
86 Ga0436362_0907380 3300039453 Bacteria 1582
87 Ga0439465_0047745 3300041413 Bacteria 1396
88 Ga0439464_0007563 3300042439 Bacteria 2841
89 Ga0453684_0073277 3300044712 Bacteria 4318
90 Ga0451576_0121854 3300045051 Bacteria 2715
91 Ga0495638_0142714 3300046460 Bacteria 1396
92 Ga0495596_0045248 3300046500 Bacteria 1731
93 Ga0495633_0072473 3300046558 Bacteria 1606
94 Ga0495659_0076288 3300046664 Bacteria 1264
95 Ga0495670_0071746 3300046691 Bacteria 1753
96 Ga0495686_0124753 3300047472 Bacteria 1531
97 Ga0496108_0002068 3300048911 Bacteria 16053
98 Ga0496126_0286955 3300048929 Bacteria 1362
99 Ga0501031_0079504 3300049568 Bacteria 2137
100 Ga0501032_0005446 3300049569 Bacteria 9448
101 Ga0501032_0296852 3300049569 Bacteria 1045
102 Ga0501033_0002868 3300049570 Bacteria 14446
103 Ga0501034_0038566 3300049571 Bacteria 4837
104 Ga0501036_0004388 3300049572 Bacteria 11382
105 Ga0501036_0136209 3300049572 Bacteria 2073
106 Ga0501036_0280406 3300049572 Bacteria 1395
107 Ga0501036_0323148 3300049572 Bacteria 1289
108 Ga0501038_0006280 3300049574 Bacteria 10985
109 Ga0501038_0075627 3300049574 Bacteria 2846
110 Ga0501038_0086209 3300049574 Bacteria 2639
111 Ga0501039_0000586 3300049575 Bacteria 26318
112 Ga0501039_0071241 3300049575 Bacteria 2701
113 Ga0501043_0047327 3300049579 Bacteria 3381
114 Ga0501043_0261212 3300049579 Bacteria 1332
115 Ga0501046_0126668 3300049580 Bacteria 1939
116 Ga0501046_0158025 3300049580 Bacteria 1707
117 Ga0501047_0016446 3300049581 Bacteria 7062
118 Ga0501047_0019030 3300049581 Bacteria 6587
119 Ga0501048_0084894 3300049582 Bacteria 2233
120 Ga0501067_0000637 3300049583 Bacteria 18857
121 Ga0501067_0050207 3300049583 Bacteria 2312
122 Ga0501069_0001620 3300049585 Bacteria 11147
123 Ga0501069_0020333 3300049585 Bacteria 3596
124 Ga0501070_0011494 3300049586 Bacteria 7477
125 Ga0501070_0020745 3300049586 Bacteria 5512
126 Ga0501070_0074398 3300049586 Bacteria 2812
127 Ga0501071_0143706 3300049587 Bacteria 1778
128 Ga0501073_0003399 3300049589 Bacteria 11970
129 Ga0501073_0003816 3300049589 Bacteria 11308
130 Ga0501073_0014856 3300049589 Bacteria 5651
131 Ga0501073_0047757 3300049589 Bacteria 3007
132 Ga0501076_0105681 3300049592 Bacteria 2272
133 Ga0501079_0033800 3300049741 Bacteria 3935
134 Ga0501079_0292397 3300049741 Bacteria 1274
135 Ga0501080_0036842 3300049742 Bacteria 4566
136 Ga0501080_0124138 3300049742 Bacteria 2391
137 Ga0501081_0253999 3300049743 Bacteria 1284
138 Ga0501083_0009245 3300049744 Bacteria 6958
139 Ga0501083_0020723 3300049744 Bacteria 4571
140 Ga0501083_0040504 3300049744 Bacteria 3162
141 Ga0501083_0106941 3300049744 Bacteria 1841
142 Ga0501083_0114096 3300049744 Bacteria 1774
143 Ga0501083_0305728 3300049744 Bacteria 1034
144 Ga0501035_0003442 3300049822 Bacteria 15145
145 Ga0501035_0053381 3300049822 Bacteria 3615
146 Ga0501044_0031600 3300049823 Bacteria 5572
147 Ga0501044_0045787 3300049823 Bacteria 4531
148 Ga0501044_0063380 3300049823 Bacteria 3776
149 Ga0501044_0142961 3300049823 Bacteria 2380
150 Ga0501044_0145694 3300049823 Bacteria 2354
151 Ga0501045_0355799 3300049824 Bacteria 1090
152 nmdc:mga05p37_19045_c1 3300050507 Bacteria 8302
153 nmdc:mga08y16_221738_c1 3300050511 Bacteria 1957
154 nmdc:mga08y16_241489_c1 3300050511 Bacteria 1867
155 nmdc:mga08y16_419_c1 3300050511 Bacteria 39080
156 nmdc:mga0n895_50291_c1 3300050512 Bacteria 4085
157 nmdc:mga08x19_131091_c1 3300050514 Bacteria 1686
158 nmdc:mga0a205_255478_c1 3300050515 Bacteria 1631
159 Ga0495601_0006481 3300053077 Bacteria 6846
160 Ga0495619_0201576 3300053085 Bacteria 1377
161 Ga0500644_0045115 3300053088 Bacteria 1483
162 Ga0500651_0041785 3300053093 Bacteria 2890
163 Ga0500566_0008660 3300053094 Bacteria 6017
164 Ga0500555_027648 3300053103 Bacteria 1617
165 Ga0500595_002391 3300053119 Bacteria 9372
166 Ga0500642_0043024 3300053130 Bacteria 1960
167 Ga0500658_0008025 3300053134 Bacteria 3902
168 Ga0500559_0020821 3300053136 Bacteria 2776
169 Ga0500616_0000806 3300053153 Bacteria 35829
170 Ga0500616_0106870 3300053153 Bacteria 1358
171 Ga0500622_0000047 3300053156 Bacteria 149427
172 Ga0500609_000390 3300053731 Bacteria 6488
173 Ga0501084_0014758 3300054114 Bacteria 6480
174 Ga0501084_0029932 3300054114 Bacteria 4554
175 Ga0501084_0071268 3300054114 Bacteria 2910
176 Ga0501084_0426598 3300054114 Bacteria 1121
177 Ga0590071_017283 3300059421 Bacteria 1694
178 Ga0501082_0014522 3300060353 Bacteria 6781
179 Ga0501082_0024232 3300060353 Bacteria 5232
180 Ga0501082_0316213 3300060353 Bacteria 1360
181 Ga0530510_0192576 3300061734 Bacteria 1514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0316213 Ga0501082_0316213_538_1341 251
2 3300049572 Ga0501036_0280406 Ga0501036_0280406_20_835 255
3 3300045051 Ga0451576_0121854 Ga0451576_0121854_1123_2070 264
4 3300005344 Ga0070661_100008588 Ga0070661_1000085888 265
5 3300005367 Ga0070667_100025603 Ga0070667_1000256032 265
6 3300009147 Ga0114129_10003089 Ga0114129_1000308922 265
7 3300050507 nmdc:mga05p37_19045_c1 nmdc:mga05p37_19045_c1_3166_4128 265
8 3300001915 JGI24741J21665_1004143 JGI24741J21665_10041431 266
9 3300005327 Ga0070658_10118088 Ga0070658_101180883 266
10 3300005344 Ga0070661_100062299 Ga0070661_1000622992 266
11 3300005539 Ga0068853_100119036 Ga0068853_1001190362 266
12 3300005578 Ga0068854_100079247 Ga0068854_1000792473 266
13 3300006237 Ga0097621_100045054 Ga0097621_1000450544 266
14 3300006358 Ga0068871_100090272 Ga0068871_1000902724 266
15 3300021361 Ga0213872_10039007 Ga0213872_100390072 266
16 3300025909 Ga0207705_10146155 Ga0207705_101461552 266
17 3300025981 Ga0207640_10007291 Ga0207640_100072914 266
18 3300026041 Ga0207639_10059460 Ga0207639_100594603 266
19 3300039447 Ga0436361_0211622 Ga0436361_0211622_739_1638 266
20 3300047472 Ga0495686_0124753 Ga0495686_0124753_257_1207 266
21 3300044712 Ga0453684_0073277 Ga0453684_0073277_2749_3696 267
22 3300046500 Ga0495596_0045248 Ga0495596_0045248_824_1717 267
23 3300021384 Ga0213876_10004806 Ga0213876_100048068 268
24 3300039437 Ga0436365_0137032 Ga0436365_0137032_8401_9321 268
25 3300053088 Ga0500644_0045115 Ga0500644_0045115_222_1169 270
26 3300005563 Ga0068855_100276660 Ga0068855_1002766601 272
27 3300009093 Ga0105240_10111612 Ga0105240_101116123 272
28 3300021361 Ga0213872_10030747 Ga0213872_100307472 272
29 3300037418 Ga0395900_0183692 Ga0395900_0183692_981_1922 272
30 3300037466 Ga0395898_0205274 Ga0395898_0205274_474_1415 272
31 3300038443 Ga0395901_0169003 Ga0395901_0169003_1024_1965 272
32 3300039447 Ga0436361_0483972 Ga0436361_0483972_1589_2536 272
33 3300039447 Ga0436361_1003157 Ga0436361_1003157_966_1913 272
34 3300053093 Ga0500651_0041785 Ga0500651_0041785_144_1094 272
35 3300039438 Ga0436360_0011981 Ga0436360_0011981_158_1126 273
36 3300053156 Ga0500622_0000047 Ga0500622_0000047_42279_43223 273
37 3300035086 Ga0373934_0007675 Ga0373934_0007675_2481_3500 274
38 3300035120 Ga0373957_0037058 Ga0373957_0037058_425_1444 274
39 3300035172 Ga0373955_0012875 Ga0373955_0012875_626_1645 274
40 3300035724 Ga0373933_0005564 Ga0373933_0005564_5037_6056 274
41 3300036401 Ga0373937_0131921 Ga0373937_0131921_1129_2148 274
42 3300049579 Ga0501043_0261212 Ga0501043_0261212_52_1011 274
43 3300049823 Ga0501044_0145694 Ga0501044_0145694_296_1255 274
44 3300053077 Ga0495601_0006481 Ga0495601_0006481_2437_3456 274
45 3300053085 Ga0495619_0201576 Ga0495619_0201576_327_1346 274
46 3300049569 Ga0501032_0296852 Ga0501032_0296852_35_994 275
47 3300037418 Ga0395900_0185521 Ga0395900_0185521_1225_2094 276
48 3300037471 Ga0395905_0626872 Ga0395905_0626872_19_912 276
49 3300039438 Ga0436360_1354164 Ga0436360_1354164_34_924 280
50 3300049580 Ga0501046_0158025 Ga0501046_0158025_645_1589 280
51 3300049581 Ga0501047_0016446 Ga0501047_0016446_6025_6969 280
52 3300049823 Ga0501044_0063380 Ga0501044_0063380_1910_2854 280
53 3300005444 Ga0070694_100076291 Ga0070694_1000762912 281
54 3300010375 Ga0105239_10007588 Ga0105239_1000758811 281
55 3300036647 Ga0316582_0053337 Ga0316582_0053337_894_1838 281
56 3300039447 Ga0436361_0127122 Ga0436361_0127122_262_1212 281
57 3300049571 Ga0501034_0038566 Ga0501034_0038566_1848_2741 281
58 3300049589 Ga0501073_0014856 Ga0501073_0014856_2149_3042 281
59 3300049742 Ga0501080_0036842 Ga0501080_0036842_2311_3204 281
60 3300049824 Ga0501045_0355799 Ga0501045_0355799_29_922 281
61 3300027907 Ga0207428_10315425 Ga0207428_103154252 282
62 3300037853 Ga0436364_0523972 Ga0436364_0523972_1291_2259 282
63 3300046558 Ga0495633_0072473 Ga0495633_0072473_331_1269 282
64 3300046664 Ga0495659_0076288 Ga0495659_0076288_27_965 282
65 3300046691 Ga0495670_0071746 Ga0495670_0071746_455_1393 282
66 3300048911 Ga0496108_0002068 Ga0496108_0002068_4013_4951 282
67 3300048929 Ga0496126_0286955 Ga0496126_0286955_257_1159 282
68 3300005981 Ga0081538_10037548 Ga0081538_100375482 283
69 3300042439 Ga0439464_0007563 Ga0439464_0007563_1293_2231 283
70 3300032002 Ga0307416_100197628 Ga0307416_1001976283 285
71 3300049744 Ga0501083_0040504 Ga0501083_0040504_522_1463 286
72 3300009177 Ga0105248_10028382 Ga0105248_100283822 287
73 3300021388 Ga0213875_10129779 Ga0213875_101297791 287
74 3300037853 Ga0436364_1289732 Ga0436364_1289732_1145_2116 287
75 3300039453 Ga0436362_0907380 Ga0436362_0907380_16_942 287
76 3300049583 Ga0501067_0050207 Ga0501067_0050207_355_1296 287
77 3300050514 nmdc:mga08x19_131091_c1 nmdc:mga08x19_131091_c1_726_1667 287
78 3300061734 Ga0530510_0192576 Ga0530510_0192576_525_1454 287
79 3300049574 Ga0501038_0075627 Ga0501038_0075627_50_1009 289
80 iso_pu_bacteria 8056667051 8056672801 290
81 3300005458 Ga0070681_10265500 Ga0070681_102655002 291
82 3300009551 Ga0105238_10005981 Ga0105238_100059816 291
83 3300005536 Ga0070697_100451891 Ga0070697_1004518911 292
84 iso_pu_bacteria 8045864390 8045865900 292
85 3300031730 Ga0307516_10256688 Ga0307516_102566882 293
86 iso_pu_bacteria 2837678835 2837682157 294
87 iso_pu_bacteria 2909042592 2909043410 294
88 3300005841 Ga0068863_100000030 Ga0068863_100000030138 295
89 3300035088 Ga0373940_0006342 Ga0373940_0006342_130_1071 295
90 3300035114 Ga0373939_0009378 Ga0373939_0009378_401_1342 295
91 3300060353 Ga0501082_0014522 Ga0501082_0014522_3160_4128 295
92 3300015265 Ga0182005_1002347 Ga0182005_10023475 296
93 3300031595 Ga0265313_10008177 Ga0265313_100081774 296
94 iso_pu_bacteria 2919450847 2919452084 296
95 3300009098 Ga0105245_10154487 Ga0105245_101544872 297
96 3300021361 Ga0213872_10021816 Ga0213872_100218162 297
97 3300021388 Ga0213875_10005815 Ga0213875_100058155 297
98 3300027876 Ga0209974_10075778 Ga0209974_100757782 297
99 3300037853 Ga0436364_0046669 Ga0436364_0046669_19423_20379 297
100 3300037853 Ga0436364_0092464 Ga0436364_0092464_1852_2808 297
101 3300039447 Ga0436361_0241046 Ga0436361_0241046_647_1609 297
102 3300049568 Ga0501031_0079504 Ga0501031_0079504_232_1191 297
103 3300049575 Ga0501039_0071241 Ga0501039_0071241_1610_2551 297
104 3300049585 Ga0501069_0020333 Ga0501069_0020333_593_1534 297
105 3300049586 Ga0501070_0020745 Ga0501070_0020745_3536_4477 297
106 3300049587 Ga0501071_0143706 Ga0501071_0143706_284_1225 297
107 3300049592 Ga0501076_0105681 Ga0501076_0105681_1172_2113 297
108 3300049741 Ga0501079_0292397 Ga0501079_0292397_167_1108 297
109 3300049742 Ga0501080_0124138 Ga0501080_0124138_872_1813 297
110 3300049744 Ga0501083_0020723 Ga0501083_0020723_445_1413 297
111 3300049744 Ga0501083_0106941 Ga0501083_0106941_317_1258 297
112 3300049823 Ga0501044_0031600 Ga0501044_0031600_1616_2557 297
113 3300050511 nmdc:mga08y16_221738_c1 nmdc:mga08y16_221738_c1_767_1708 297
114 3300053136 Ga0500559_0020821 Ga0500559_0020821_1366_2307 297
115 3300053153 Ga0500616_0106870 Ga0500616_0106870_271_1224 297
116 3300054114 Ga0501084_0014758 Ga0501084_0014758_2160_3101 297
117 3300060353 Ga0501082_0024232 Ga0501082_0024232_3416_4357 297
118 3300001979 JGI24740J21852_10029090 JGI24740J21852_100290902 298
119 3300003215 JGI25153J46596_10000054 JGI25153J46596_10000054132 298
120 3300003794 Ga0055531_10014275 Ga0055531_100142752 298
121 3300005356 Ga0070674_100012953 Ga0070674_1000129532 298
122 3300005718 Ga0068866_10060492 Ga0068866_100604922 298
123 3300005719 Ga0068861_100322007 Ga0068861_1003220071 298
124 3300005844 Ga0068862_100025088 Ga0068862_1000250882 298
125 3300005844 Ga0068862_100069344 Ga0068862_1000693443 298
126 3300006852 Ga0075433_10203087 Ga0075433_102030871 298
127 3300009094 Ga0111539_10013156 Ga0111539_1001315611 298
128 3300009094 Ga0111539_10378259 Ga0111539_103782592 298
129 3300009553 Ga0105249_10111986 Ga0105249_101119863 298
130 3300025297 Ga0209758_1000119 Ga0209758_1000119181 298
131 3300025298 Ga0209050_1003817 Ga0209050_10038176 298
132 3300025304 Ga0209257_1000562 Ga0209257_100056245 298
133 3300025304 Ga0209257_1037011 Ga0209257_10370112 298
134 3300026118 Ga0207675_100161118 Ga0207675_1001611182 298
135 3300027907 Ga0207428_10000096 Ga0207428_1000009668 298
136 3300028380 Ga0268265_10031043 Ga0268265_100310434 298
137 3300031616 Ga0307508_10060187 Ga0307508_100601871 298
138 3300031911 Ga0307412_10162353 Ga0307412_101623532 298
139 3300037466 Ga0395898_0380618 Ga0395898_0380618_105_1055 298
140 3300041413 Ga0439465_0047745 Ga0439465_0047745_221_1171 298
141 3300046460 Ga0495638_0142714 Ga0495638_0142714_165_1115 298
142 3300049569 Ga0501032_0005446 Ga0501032_0005446_904_1854 298
143 3300049570 Ga0501033_0002868 Ga0501033_0002868_8312_9262 298
144 3300049572 Ga0501036_0004388 Ga0501036_0004388_10388_11338 298
145 3300049572 Ga0501036_0136209 Ga0501036_0136209_23_973 298
146 3300049572 Ga0501036_0323148 Ga0501036_0323148_82_1032 298
147 3300049574 Ga0501038_0006280 Ga0501038_0006280_9019_9969 298
148 3300049574 Ga0501038_0086209 Ga0501038_0086209_1624_2574 298
149 3300049575 Ga0501039_0000586 Ga0501039_0000586_3874_4824 298
150 3300049579 Ga0501043_0047327 Ga0501043_0047327_790_1740 298
151 3300049580 Ga0501046_0126668 Ga0501046_0126668_191_1141 298
152 3300049581 Ga0501047_0019030 Ga0501047_0019030_3894_4844 298
153 3300049582 Ga0501048_0084894 Ga0501048_0084894_408_1358 298
154 3300049583 Ga0501067_0000637 Ga0501067_0000637_810_1760 298
155 3300049585 Ga0501069_0001620 Ga0501069_0001620_175_1125 298
156 3300049586 Ga0501070_0011494 Ga0501070_0011494_5261_6211 298
157 3300049586 Ga0501070_0074398 Ga0501070_0074398_735_1685 298
158 3300049589 Ga0501073_0003399 Ga0501073_0003399_5261_6211 298
159 3300049589 Ga0501073_0003816 Ga0501073_0003816_2384_3334 298
160 3300049589 Ga0501073_0047757 Ga0501073_0047757_986_1936 298
161 3300049741 Ga0501079_0033800 Ga0501079_0033800_1097_2047 298
162 3300049744 Ga0501083_0009245 Ga0501083_0009245_553_1503 298
163 3300049744 Ga0501083_0114096 Ga0501083_0114096_29_979 298
164 3300049744 Ga0501083_0305728 Ga0501083_0305728_38_988 298
165 3300049822 Ga0501035_0003442 Ga0501035_0003442_9098_10048 298
166 3300049822 Ga0501035_0053381 Ga0501035_0053381_981_1931 298
167 3300049823 Ga0501044_0045787 Ga0501044_0045787_1843_2793 298
168 3300049823 Ga0501044_0142961 Ga0501044_0142961_1254_2204 298
169 3300050511 nmdc:mga08y16_241489_c1 nmdc:mga08y16_241489_c1_299_1249 298
170 3300050511 nmdc:mga08y16_419_c1 nmdc:mga08y16_419_c1_10052_11056 298
171 3300053094 Ga0500566_0008660 Ga0500566_0008660_3397_4347 298
172 3300053103 Ga0500555_027648 Ga0500555_027648_377_1327 298
173 3300053119 Ga0500595_002391 Ga0500595_002391_3220_4170 298
174 3300053130 Ga0500642_0043024 Ga0500642_0043024_776_1726 298
175 3300053134 Ga0500658_0008025 Ga0500658_0008025_2478_3428 298
176 3300053153 Ga0500616_0000806 Ga0500616_0000806_25122_26072 298
177 3300053731 Ga0500609_000390 Ga0500609_000390_4503_5453 298
178 3300054114 Ga0501084_0029932 Ga0501084_0029932_2342_3292 298
179 3300054114 Ga0501084_0071268 Ga0501084_0071268_1368_2318 298
180 3300054114 Ga0501084_0426598 Ga0501084_0426598_148_1098 298
181 3300059421 Ga0590071_017283 Ga0590071_017283_712_1662 298
182 3300049743 Ga0501081_0253999 Ga0501081_0253999_250_1197 299
183 3300006852 Ga0075433_10054074 Ga0075433_100540744 301
184 3300050512 nmdc:mga0n895_50291_c1 nmdc:mga0n895_50291_c1_2575_3528 301
185 3300050515 nmdc:mga0a205_255478_c1 nmdc:mga0a205_255478_c1_243_1196 301
186 3300000549 LJQas_1000772 LJQas_10007725 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00698

Acyl_transf_1

Acyl transferase domain

48

335

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g2y-assembly1.cif.gz_A structure of e.coli fabd complexed with malonate 0.9616 2 292
3h0p-assembly1.cif.gz_A 2.0 angstrom crystal structure of an acyl carrier protein s-malonyltransferase from salmonella typhimurium. 0.9584 1 292
3qat-assembly1.cif.gz_A crystal structure of acyl-carrier-protein-s-malonyltransferase from bartonella henselae 0.9566 1 297
3tqe-assembly1.cif.gz_A structure of the malonyl coa-acyl carrier protein transacylase (fabd) from coxiella burnetii 0.952 1 294
6smd-assembly2.cif.gz_C plmcat:antf (holo): type ii pks acyl-carrier protein in complex with its malonyl-transacylase 0.9498 1 295
ID Description Score Start End Superfamily
af_P0AAI9_6_286_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9561 7 272 3.20.10.10
3tqeA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding 0.9512 112 183 3.30.70.250
3k89A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding 0.9403 112 183 3.30.70.250
3qatB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding 0.9386 112 183 3.30.70.250
3tqeA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding 0.9385 112 183 3.30.70.250
ID Description Score Start End GO Terms
AF-A0A512IKK0-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9805 1 291 GO:0004314
GO:0005829
GO:0006633
AF-A0A1B8P4I9-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9805 91 301 GO:0004314
GO:0005829
GO:0006633
AF-A0A352IWS0-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9772 92 185 GO:0004314
GO:0005829
GO:0006633
AF-A0A382CLZ6-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9744 123 283 GO:0004314
GO:0005829
GO:0006633
AF-A0A7C7BRJ7-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9736 119 295 GO:0004314
GO:0005829
GO:0006633

Feature Viewer

pLDDT pTM Quality
94.14 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map