F283471

General Info

Members Datasets Scaffolds Average Seq Length
184 148 368 302

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2884994152|2884996502
Length 346
Sequence PDAAVPGPAASPLIPAPSLADTPSAATTPTGAATTSDTSAESAPTPPSARGGLAAGIAAYALWGVLPLYFPLLEPAGAVEIIAHRVVWSLLFCLLLLLVTRTWAGFVAALRDRRTLGLLGVAAVLLAVNWLVFVFGVLTDRVVDAALGYFINPLVTVALAVLVLRERLRPVQWVALGFGALAVVVITVGYGQLPWIALTLALSFGFYGLIKNRVGRSVAAIPGLTAETLLLAPLALGYLAILGADGTGTFAAYGPWHAVALVSSGVVTAVPLLLFNSAARRLPLSVVGLLQYLAPVLQLLIGVLVLHEQMPVARWWGFALVWLALVLLTVDGLRSRLHTRTRTATA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
24 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
26 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
35 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
36 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
37 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
38 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
39 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
40 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
41 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
42 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
46 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
47 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
48 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
49 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
50 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
51 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
55 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
56 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
57 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
58 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
59 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
60 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
64 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
65 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
75 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
76 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
77 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
78 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
79 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
80 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
81 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
82 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
83 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
84 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
87 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
88 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
89 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
90 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
91 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
92 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
93 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
94 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
117 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
124 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
125 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
126 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
127 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
128 2643221613 Oerskovia sp. Root22 Isolate Unclassified
129 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
130 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
131 2643221721 Oerskovia sp. Root918 Isolate Unclassified
132 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
133 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
134 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
135 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
136 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
137 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
138 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
139 2808606394 Promicromonospora sp. C35 Isolate Unclassified
140 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
141 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
142 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
143 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
144 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
145 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
146 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
147 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
148 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.87
Metatranscriptomes 0.54
Isolates 13.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0
Rhizoplane 5.98
Rhizosphere 70.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10020857 3300003323 Bacteria 3287
2 Ga0070660_100166787 3300005339 Bacteria 1777
3 Ga0070689_100154582 3300005340 Bacteria 1852
4 Ga0070669_100361983 3300005353 Bacteria 1180
5 Ga0070709_10216680 3300005434 Bacteria 1363
6 Ga0070714_100014967 3300005435 Bacteria 6235
7 Ga0070681_10280298 3300005458 Bacteria 1577
8 Ga0070679_100032408 3300005530 Bacteria 5169
9 Ga0070684_100293874 3300005535 Bacteria 1490
10 Ga0068857_100020204 3300005577 Bacteria 5856
11 Ga0068857_100609917 3300005577 Bacteria 1032
12 Ga0068854_100145113 3300005578 Bacteria 1825
13 Ga0068856_100576168 3300005614 Bacteria 1147
14 Ga0068864_100040448 3300005618 Bacteria 3989
15 Ga0068858_100287671 3300005842 Bacteria 1566
16 Ga0075431_100050568 3300006847 Bacteria 4285
17 Ga0075429_100111178 3300006880 Bacteria 2395
18 Ga0114129_10412206 3300009147 Bacteria 1779
19 Ga0105248_10011698 3300009177 Bacteria 9674
20 Ga0105237_10010275 3300009545 Bacteria 9971
21 Ga0157369_10084371 3300013105 Bacteria 3396
22 Ga0157372_10079964 3300013307 Bacteria 3698
23 Ga0163163_10233943 3300014325 Bacteria 1887
24 Ga0163163_10313104 3300014325 Bacteria 1623
25 Ga0163161_10105456 3300017792 Bacteria 2102
26 Ga0163161_10161874 3300017792 Bacteria 1706
27 Ga0206353_10978695 3300020082 Bacteria 3451
28 Ga0209646_1007208 3300025246 Bacteria 1826
29 Ga0207707_10365612 3300025912 Bacteria 1242
30 Ga0207671_10035468 3300025914 Bacteria 3701
31 Ga0207652_10039484 3300025921 Bacteria 4006
32 Ga0207711_10017763 3300025941 Bacteria 5910
33 Ga0207640_10005954 3300025981 Bacteria 6658
34 Ga0207703_10257981 3300026035 Bacteria 1575
35 Ga0207676_10232024 3300026095 Bacteria 1650
36 Ga0207674_10023258 3300026116 Bacteria 6639
37 Ga0207674_10170592 3300026116 Bacteria 2129
38 Ga0265340_10045618 3300031247 Bacteria 2140
39 Ga0307513_10001302 3300031456 Bacteria 36100
40 Ga0316575_10000339 3300031665 Bacteria 13160
41 Ga0316579_10000580 3300031691 Bacteria 12249
42 Ga0316579_10025497 3300031691 Bacteria 2669
43 Ga0316578_10003077 3300031728 Bacteria 7532
44 Ga0316578_10003502 3300031728 Bacteria 7203
45 Ga0307405_10000168 3300031731 Bacteria 24151
46 Ga0316577_10022875 3300031733 Bacteria 3471
47 Ga0307407_10170901 3300031903 Bacteria 1431
48 Ga0307412_10000435 3300031911 Bacteria 25212
49 Ga0307409_100000224 3300031995 Bacteria 22722
50 Ga0307416_100001216 3300032002 Bacteria 13887
51 Ga0307415_100000039 3300032126 Bacteria 56866
52 Ga0307415_100127740 3300032126 Bacteria 1919
53 Ga0316583_10013756 3300032133 Bacteria 2920
54 Ga0316585_10004251 3300032137 Bacteria 3977
55 Ga0316585_10016648 3300032137 Bacteria 2216
56 Ga0316580_10010272 3300032139 Bacteria 2825
57 Ga0307507_10000732 3300033179 Bacteria 72083
58 Ga0316582_0000977 3300036647 Bacteria 11882
59 Ga0316584_0000908 3300036712 Bacteria 16880
60 Ga0316584_0141358 3300036712 Bacteria 1795
61 Ga0395898_0131874 3300037466 Bacteria 2393
62 Ga0395901_0019933 3300038443 Bacteria 6861
63 Ga0451789_1142348 3300041443 Bacteria 1622
64 Ga0451791_0795592 3300041451 Bacteria 1301
65 Ga0451841_1051321 3300041498 Bacteria 2357
66 Ga0451843_1595123 3300041509 Bacteria 1772
67 Ga0451577_0034156 3300042876 Bacteria 4586
68 Ga0451577_0506143 3300042876 Bacteria 1096
69 Ga0466969_0070874 3300044656 Bacteria 1676
70 Ga0466969_0072822 3300044656 Bacteria 1649
71 Ga0466966_0023404 3300044684 Bacteria 4045
72 Ga0466966_0025411 3300044684 Bacteria 3869
73 Ga0466961_0110031 3300044693 Bacteria 1734
74 Ga0466961_0150454 3300044693 Bacteria 1453
75 Ga0466963_0029209 3300044694 Bacteria 3547
76 Ga0453684_0389517 3300044712 Bacteria 1563
77 Ga0466971_0002291 3300044719 Bacteria 8105
78 Ga0466971_0031922 3300044719 Bacteria 2359
79 Ga0466970_0006200 3300044765 Bacteria 5962
80 Ga0466957_0077144 3300044842 Bacteria 2070
81 Ga0466959_0021172 3300045049 Bacteria 4793
82 Ga0466959_0056367 3300045049 Bacteria 2867
83 Ga0466958_0072317 3300045836 Bacteria 2112
84 Ga0466958_0079364 3300045836 Bacteria 2018
85 Ga0466967_0034331 3300045976 Bacteria 4304
86 Ga0466967_0530954 3300045976 Bacteria 1157
87 Ga0495592_0046172 3300046454 Bacteria 3247
88 Ga0495638_0157544 3300046460 Bacteria 1312
89 Ga0495651_0004811 3300046462 Bacteria 10335
90 Ga0495628_0013177 3300046516 Bacteria 6958
91 Ga0495652_0061769 3300046529 Bacteria 3161
92 Ga0495645_0036172 3300046543 Bacteria 3599
93 Ga0495625_0019707 3300046660 Bacteria 5223
94 Ga0495635_0245560 3300046663 Bacteria 1207
95 Ga0495646_0005424 3300046680 Bacteria 8056
96 Ga0495600_0115843 3300046809 Bacteria 1744
97 Ga0496105_0078987 3300048908 Bacteria 2717
98 Ga0496108_0121416 3300048911 Bacteria 2241
99 Ga0496109_0007182 3300048912 Bacteria 9413
100 Ga0496110_0038323 3300048913 Bacteria 4170
101 Ga0496111_0030747 3300048914 Bacteria 3820
102 Ga0496114_0010099 3300048917 Bacteria 7509
103 Ga0496114_0036547 3300048917 Bacteria 4060
104 Ga0496114_0168851 3300048917 Bacteria 1906
105 Ga0496117_0070033 3300048920 Bacteria 2358
106 Ga0496118_0013730 3300048921 Bacteria 7640
107 Ga0496119_0039916 3300048922 Bacteria 3011
108 Ga0496120_0072568 3300048923 Bacteria 1886
109 Ga0496122_0001064 3300048925 Bacteria 47739
110 Ga0496122_0013869 3300048925 Bacteria 7847
111 Ga0496122_0042655 3300048925 Bacteria 3566
112 Ga0496123_0038913 3300048926 Bacteria 3334
113 Ga0496123_0106813 3300048926 Bacteria 1612
114 Ga0496124_0000912 3300048927 Bacteria 47709
115 Ga0496124_0030369 3300048927 Bacteria 4798
116 Ga0496124_0043607 3300048927 Bacteria 3855
117 Ga0496124_0088712 3300048927 Bacteria 2527
118 Ga0496125_0000086 3300048928 Bacteria 216489
119 Ga0496126_0029853 3300048929 Bacteria 5175
120 Ga0496126_0079009 3300048929 Bacteria 2914
121 Ga0496126_0209232 3300048929 Bacteria 1643
122 Ga0496126_0342708 3300048929 Bacteria 1224
123 Ga0501032_0015089 3300049569 Bacteria 5456
124 Ga0501033_0138408 3300049570 Bacteria 1761
125 Ga0501034_0019188 3300049571 Bacteria 7000
126 Ga0501036_0001836 3300049572 Bacteria 16487
127 Ga0501036_0054204 3300049572 Bacteria 3396
128 Ga0501037_0105237 3300049573 Bacteria 2034
129 Ga0501037_0111437 3300049573 Bacteria 1971
130 Ga0501038_0009263 3300049574 Bacteria 9030
131 Ga0501039_0056677 3300049575 Bacteria 3035
132 Ga0501042_0060720 3300049578 Bacteria 2700
133 Ga0501046_0020202 3300049580 Bacteria 5513
134 Ga0501046_0020570 3300049580 Bacteria 5455
135 Ga0501048_0007709 3300049582 Bacteria 8159
136 Ga0501072_0115186 3300049588 Bacteria 2140
137 Ga0501073_0130633 3300049589 Bacteria 1741
138 Ga0501075_0181104 3300049591 Bacteria 1607
139 Ga0501079_0181035 3300049741 Bacteria 1644
140 Ga0501080_0340986 3300049742 Bacteria 1354
141 Ga0501083_0005283 3300049744 Bacteria 9132
142 Ga0501035_0033792 3300049822 Bacteria 4649
143 Ga0501035_0034187 3300049822 Bacteria 4620
144 Ga0501044_0020082 3300049823 Bacteria 7133
145 Ga0501045_0005776 3300049824 Bacteria 8562
146 nmdc:mga09592_397756_c1 3300050508 Bacteria 1191
147 nmdc:mga06r32_62147_c1 3300050510 Bacteria 3597
148 Ga0495601_0011588 3300053077 Bacteria 5283
149 Ga0495601_0083923 3300053077 Bacteria 2046
150 Ga0495612_0007360 3300053078 Bacteria 4498
151 Ga0495612_0054438 3300053078 Bacteria 1648
152 Ga0495619_0146186 3300053085 Bacteria 1630
153 Ga0500604_0006317 3300053151 Bacteria 3132
154 Ga0500616_0000466 3300053153 Bacteria 52609
155 Ga0500616_0002325 3300053153 Bacteria 16037
156 Ga0501084_0074266 3300054114 Bacteria 2847
157 Ga0501084_0102230 3300054114 Bacteria 2407
158 Ga0501082_0010105 3300060353 Bacteria 8129
159 Ga0466962_0000056 3300061719 Bacteria 46579
160 2884996502 2884994152 Bacteria 4492978
161 2512032461 2511231221 Bacteria 6846400
162 2523102651 2522572158 Bacteria 6514390
163 2600226910 2599185359 Bacteria 4772316
164 2644082435 2643221613 Bacteria 4622396
165 2644502778 2643221690 Bacteria 4654705
166 2644525145 2643221694 Bacteria 4392972
167 2644666942 2643221721 Bacteria 4486924
168 2644669233 2643221722 Bacteria 4247614
169 2738693841 2738541272 Bacteria 6848551
170 2739326966 2738543027 Bacteria 6409078
171 2739607323 2739367654 Bacteria 6049412
172 2760304768 2758568522 Bacteria 5953541
173 2760621414 2758568621 Bacteria 5967089
174 2784471407 2784132109 Bacteria 3141763
175 2809026202 2808606394 Bacteria 6248540
176 2819715640 2818991466 Bacteria 4748179
177 2839989034 2839986021 Bacteria 3685650
178 2919449202 2919446982 Bacteria 3994487
179 2928529660 2928526807 Bacteria 4760224
180 2928970852 2928968154 Bacteria 4633371
181 2932432142 2932431166 Bacteria 4215299
182 2935892165 2935890801 Bacteria 4593001
183 8054006007 8054002106 Bacteria 7987183
184 8056583132 8056579771 Bacteria 5840325
185 rootH1_10020857
186 Ga0070660_100166787
187 Ga0070689_100154582
188 Ga0070669_100361983
189 Ga0070709_10216680
190 Ga0070714_100014967
191 Ga0070681_10280298
192 Ga0070679_100032408
193 Ga0070684_100293874
194 Ga0068857_100020204
195 Ga0068857_100609917
196 Ga0068854_100145113
197 Ga0068856_100576168
198 Ga0068864_100040448
199 Ga0068858_100287671
200 Ga0075431_100050568
201 Ga0075429_100111178
202 Ga0114129_10412206
203 Ga0105248_10011698
204 Ga0105237_10010275
205 Ga0157369_10084371
206 Ga0157372_10079964
207 Ga0163163_10233943
208 Ga0163163_10313104
209 Ga0163161_10105456
210 Ga0163161_10161874
211 Ga0206353_10978695
212 Ga0209646_1007208
213 Ga0207707_10365612
214 Ga0207671_10035468
215 Ga0207652_10039484
216 Ga0207711_10017763
217 Ga0207640_10005954
218 Ga0207703_10257981
219 Ga0207676_10232024
220 Ga0207674_10023258
221 Ga0207674_10170592
222 Ga0265340_10045618
223 Ga0307513_10001302
224 Ga0316575_10000339
225 Ga0316579_10000580
226 Ga0316579_10025497
227 Ga0316578_10003077
228 Ga0316578_10003502
229 Ga0307405_10000168
230 Ga0316577_10022875
231 Ga0307407_10170901
232 Ga0307412_10000435
233 Ga0307409_100000224
234 Ga0307416_100001216
235 Ga0307415_100000039
236 Ga0307415_100127740
237 Ga0316583_10013756
238 Ga0316585_10004251
239 Ga0316585_10016648
240 Ga0316580_10010272
241 Ga0307507_10000732
242 Ga0316582_0000977
243 Ga0316584_0000908
244 Ga0316584_0141358
245 Ga0395898_0131874
246 Ga0395901_0019933
247 Ga0451789_1142348
248 Ga0451791_0795592
249 Ga0451841_1051321
250 Ga0451843_1595123
251 Ga0451577_0034156
252 Ga0451577_0506143
253 Ga0466969_0070874
254 Ga0466969_0072822
255 Ga0466966_0023404
256 Ga0466966_0025411
257 Ga0466961_0110031
258 Ga0466961_0150454
259 Ga0466963_0029209
260 Ga0453684_0389517
261 Ga0466971_0002291
262 Ga0466971_0031922
263 Ga0466970_0006200
264 Ga0466957_0077144
265 Ga0466959_0021172
266 Ga0466959_0056367
267 Ga0466958_0072317
268 Ga0466958_0079364
269 Ga0466967_0034331
270 Ga0466967_0530954
271 Ga0495592_0046172
272 Ga0495638_0157544
273 Ga0495651_0004811
274 Ga0495628_0013177
275 Ga0495652_0061769
276 Ga0495645_0036172
277 Ga0495625_0019707
278 Ga0495635_0245560
279 Ga0495646_0005424
280 Ga0495600_0115843
281 Ga0496105_0078987
282 Ga0496108_0121416
283 Ga0496109_0007182
284 Ga0496110_0038323
285 Ga0496111_0030747
286 Ga0496114_0010099
287 Ga0496114_0036547
288 Ga0496114_0168851
289 Ga0496117_0070033
290 Ga0496118_0013730
291 Ga0496119_0039916
292 Ga0496120_0072568
293 Ga0496122_0001064
294 Ga0496122_0013869
295 Ga0496122_0042655
296 Ga0496123_0038913
297 Ga0496123_0106813
298 Ga0496124_0000912
299 Ga0496124_0030369
300 Ga0496124_0043607
301 Ga0496124_0088712
302 Ga0496125_0000086
303 Ga0496126_0029853
304 Ga0496126_0079009
305 Ga0496126_0209232
306 Ga0496126_0342708
307 Ga0501032_0015089
308 Ga0501033_0138408
309 Ga0501034_0019188
310 Ga0501036_0001836
311 Ga0501036_0054204
312 Ga0501037_0105237
313 Ga0501037_0111437
314 Ga0501038_0009263
315 Ga0501039_0056677
316 Ga0501042_0060720
317 Ga0501046_0020202
318 Ga0501046_0020570
319 Ga0501048_0007709
320 Ga0501072_0115186
321 Ga0501073_0130633
322 Ga0501075_0181104
323 Ga0501079_0181035
324 Ga0501080_0340986
325 Ga0501083_0005283
326 Ga0501035_0033792
327 Ga0501035_0034187
328 Ga0501044_0020082
329 Ga0501045_0005776
330 nmdc:mga09592_397756_c1
331 nmdc:mga06r32_62147_c1
332 Ga0495601_0011588
333 Ga0495601_0083923
334 Ga0495612_0007360
335 Ga0495612_0054438
336 Ga0495619_0146186
337 Ga0500604_0006317
338 Ga0500616_0000466
339 Ga0500616_0002325
340 Ga0501084_0074266
341 Ga0501084_0102230
342 Ga0501082_0010105
343 Ga0466962_0000056
344 2884996502
345 2512032461
346 2523102651
347 2600226910
348 2644082435
349 2644502778
350 2644525145
351 2644666942
352 2644669233
353 2738693841
354 2739326966
355 2739607323
356 2760304768
357 2760621414
358 2784471407
359 2809026202
360 2819715640
361 2839989034
362 2919449202
363 2928529660
364 2928970852
365 2932432142
366 2935892165
367 8054006007
368 8056583132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

50

188

0.9

PF00892

EamA

EamA-like transporter family

193

330

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7766 10 275
5i20-assembly2.cif.gz_B crystal structure of protein 0.7641 7 275
5i20-assembly1.cif.gz_A crystal structure of protein 0.7538 5 282
7b0k-assembly1.cif.gz_A membrane protein structure 0.751 4 275
5i20-assembly3.cif.gz_C crystal structure of protein 0.7477 4 275
ID Description Score Start End Superfamily
af_P27844_148_285_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8905 140 277 1.25.10.10
af_P27844_148_285_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8721 140 277 1.25.10.10
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8174 205 278 1.10.3730.20
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7167 6 277 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6918 4 278 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A1H4LQ63-F1-model_v4 Chloramphenicol-sensitive protein RarD 0.9821 3 288 GO:0005886
AF-A0A3D5CF38-F1-model_v4 EamA family transporter RarD 0.9787 3 262 GO:0005886
AF-A0A0Q5NB72-F1-model_v4 Protein rarD 0.9723 5 297 GO:0005886
AF-A0A6J6HIF8-F1-model_v4 Unannotated protein 0.971 3 282 GO:0005886
AF-A0A433JRQ3-F1-model_v4 EamA family transporter RarD 0.9706 4 293 GO:0005886

Map