F282949

General Info

Members Datasets Scaffolds Average Seq Length
184 104 368 427

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_013555|Ga0400483_013555_42_1583
Length 502
Sequence MEKEIDKEMNKKAFLPATVMAQGEGTKYTVQADDWLSKLADKAYGDPLAYPAIVHYTNEMAASDSSYTTIENPDLIEVGWVIYMPTADETTAFLGGSVGEPITLTYLVADTETDQLRAKALVDAYTTLHPNVTIEIENRPGGGDGDNIVKTRLATGEMTDLFSYNAGSLLQALNPSDTLVDLTDESFMKVVDDAFKQTVAQNGQVFGVPDQTAMGGGILYNKKVYEDLGLNVPKSWDEFAANNEIIKEAGIAPVIATYGDTWTSQLFVLADYYNVQAANPNFAEEYTANQAKYATTPAAMAGFEYLQEGYEKEWYQQDFATATFNQGLEMLANGEGAHYPMLSFALPTIATNWPDKVNDIGFFAQPGPSADSNGATIWMLLANYIPQTTTGEKLEAAKDFLAFTVSPQAVAVLNETVPPSGPYLIKGASLPGDVLPGVVDIKDYIDSGNSAPALEFLSPVKGPNLEHLCVAVGTGQMTAEEAAAAYDEDVKKQAQQLGLEGW

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
74 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
75 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
76 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
77 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
78 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
86 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
87 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
90 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
91 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
92 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
93 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
94 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
95 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
96 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
97 2643221580 Devosia sp. Root635 Isolate Unclassified
98 2643221591 Devosia sp. Root685 Isolate Unclassified
99 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
100 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
101 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
102 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
103 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
104 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.3
Metatranscriptomes 3.26
Isolates 5.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.72
Nodule 1.09
Rhizoplane 1.09
Rhizosphere 89.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_013555 3300039062 Bacteria 1972
2 JGI24740J21852_10010403 3300001979 Bacteria 3585
3 JGI24739J22299_10007337 3300001989 Bacteria 4140
4 JGI24737J22298_10008912 3300001990 Bacteria 3346
5 JGI24738J21930_10013147 3300002075 Bacteria 1795
6 Ga0006778J45830_1025763 3300003162 Bacteria 2788
7 JGI25406J46586_10004579 3300003203 Bacteria 6437
8 JGI25406J46586_10005900 3300003203 Bacteria 5668
9 Ga0006777J48905_1048579 3300003308 Bacteria 2184
10 JGI25407J50210_10000666 3300003373 Bacteria 7098
11 JGI25407J50210_10002895 3300003373 Bacteria 4084
12 JGI25407J50210_10014627 3300003373 Bacteria 2023
13 JGI25407J50210_10015585 3300003373 Bacteria 1964
14 Ga0007417J51691_1048096 3300003544 Bacteria 1797
15 Ga0007429J51699_1038944 3300003579 Bacteria 2764
16 Ga0032354_1012541 3300003693 Bacteria 3377
17 Ga0006780_1020471 3300003735 Bacteria 1948
18 Ga0065707_10002054 3300005295 Bacteria 8100
19 Ga0065707_10005822 3300005295 Bacteria 3016
20 Ga0065707_10010264 3300005295 Bacteria 2579
21 Ga0070683_100058544 3300005329 Bacteria 3579
22 Ga0070689_100051186 3300005340 Bacteria 3192
23 Ga0070668_100035790 3300005347 Bacteria 3788
24 Ga0070659_100085608 3300005366 Bacteria 2521
25 Ga0070698_100020523 3300005471 Bacteria 6927
26 Ga0070698_100079517 3300005471 Bacteria 3275
27 Ga0070684_100199242 3300005535 Bacteria 1823
28 Ga0070665_100176288 3300005548 Bacteria 2139
29 Ga0068857_100069018 3300005577 Bacteria 3147
30 Ga0068859_100020083 3300005617 Bacteria 6707
31 Ga0068864_100013414 3300005618 Bacteria 6792
32 Ga0068862_100061007 3300005844 Bacteria 3241
33 Ga0081455_10000616 3300005937 Bacteria 46154
34 Ga0081455_10013171 3300005937 Bacteria 8194
35 Ga0081455_10069421 3300005937 Bacteria 2930
36 Ga0081455_10084676 3300005937 Bacteria 2587
37 Ga0081455_10148387 3300005937 Bacteria 1810
38 Ga0081455_10159581 3300005937 Bacteria 1730
39 Ga0081538_10000041 3300005981 Bacteria 116233
40 Ga0081538_10000757 3300005981 Bacteria 35243
41 Ga0081538_10002193 3300005981 Bacteria 19357
42 Ga0081538_10002470 3300005981 Bacteria 18059
43 Ga0081538_10005987 3300005981 Bacteria 10822
44 Ga0081538_10007792 3300005981 Bacteria 9198
45 Ga0081538_10009784 3300005981 Bacteria 7938
46 Ga0081538_10014168 3300005981 Bacteria 6264
47 Ga0081538_10020128 3300005981 Bacteria 4928
48 Ga0081538_10026503 3300005981 Bacteria 4052
49 Ga0081538_10036695 3300005981 Bacteria 3194
50 Ga0081540_1012735 3300005983 Bacteria 5513
51 Ga0081539_10000625 3300005985 Bacteria 71667
52 Ga0081539_10002462 3300005985 Bacteria 26092
53 Ga0081539_10006382 3300005985 Bacteria 11346
54 Ga0081539_10006724 3300005985 Bacteria 10828
55 Ga0075364_10027775 3300006051 Bacteria 3618
56 Ga0075432_10001232 3300006058 Bacteria 8241
57 Ga0075427_10003554 3300006194 Bacteria 2159
58 Ga0075430_100043620 3300006846 Bacteria 3792
59 Ga0075431_100093841 3300006847 Bacteria 3097
60 Ga0075433_10006208 3300006852 Bacteria 9428
61 Ga0075434_100001137 3300006871 Bacteria 21927
62 Ga0075434_100033851 3300006871 Bacteria 5044
63 Ga0075436_100002245 3300006914 Bacteria 13338
64 Ga0111539_10002824 3300009094 Bacteria 23091
65 Ga0111539_10016000 3300009094 Bacteria 9316
66 Ga0111539_10031331 3300009094 Bacteria 6460
67 Ga0111539_10258253 3300009094 Bacteria 2028
68 Ga0105245_10001931 3300009098 Bacteria 18838
69 Ga0114129_10033303 3300009147 Bacteria 7281
70 Ga0114129_10068425 3300009147 Bacteria 4951
71 Ga0114129_10118691 3300009147 Bacteria 3644
72 Ga0114129_10177967 3300009147 Bacteria 2896
73 Ga0114129_10266966 3300009147 Bacteria 2291
74 Ga0114129_10546678 3300009147 Bacteria 1507
75 Ga0105248_10002635 3300009177 Bacteria 19942
76 Ga0105249_10058390 3300009553 Bacteria 3536
77 Ga0105249_10096214 3300009553 Bacteria 2777
78 Ga0105239_10258328 3300010375 Bacteria 1957
79 Ga0105246_10066289 3300011119 Bacteria 2527
80 Ga0105246_10105223 3300011119 Bacteria 2062
81 Ga0157369_10300620 3300013105 Bacteria 1669
82 Ga0163162_10242041 3300013306 Bacteria 1935
83 Ga0209130_1000160 3300025284 Bacteria 100965
84 Ga0207426_1000098 3300025302 Bacteria 264264
85 Ga0207647_10030730 3300025904 Bacteria 3462
86 Ga0207670_10067597 3300025936 Bacteria 2459
87 Ga0207711_10002594 3300025941 Bacteria 16079
88 Ga0207712_10108528 3300025961 Bacteria 2077
89 Ga0207674_10056417 3300026116 Bacteria 3989
90 Ga0207428_10000406 3300027907 Bacteria 53545
91 Ga0207428_10001364 3300027907 Bacteria 25917
92 Ga0207428_10009989 3300027907 Bacteria 8495
93 Ga0268265_10085362 3300028380 Bacteria 2505
94 Ga0307517_10022630 3300028786 Bacteria 7866
95 Ga0307515_10004188 3300028794 Bacteria 30009
96 Ga0307512_10125259 3300030522 Bacteria 1634
97 Ga0307408_100003972 3300031548 Bacteria 10076
98 Ga0307408_100030407 3300031548 Bacteria 3750
99 Ga0307516_10003260 3300031730 Bacteria 21043
100 Ga0307405_10001497 3300031731 Bacteria 9888
101 Ga0307405_10001620 3300031731 Bacteria 9574
102 Ga0307413_10000943 3300031824 Bacteria 10393
103 Ga0307413_10003973 3300031824 Bacteria 6346
104 Ga0307413_10143783 3300031824 Bacteria 1652
105 Ga0307410_10000463 3300031852 Bacteria 16402
106 Ga0307410_10007859 3300031852 Bacteria 5872
107 Ga0307410_10069919 3300031852 Bacteria 2430
108 Ga0326468_10000145 3300031889 Bacteria 6744
109 Ga0307406_10001384 3300031901 Bacteria 13507
110 Ga0307406_10006687 3300031901 Bacteria 6374
111 Ga0307406_10076266 3300031901 Bacteria 2214
112 Ga0307406_10091462 3300031901 Bacteria 2050
113 Ga0307407_10000161 3300031903 Bacteria 20840
114 Ga0307407_10000233 3300031903 Bacteria 16468
115 Ga0307407_10000600 3300031903 Bacteria 11452
116 Ga0307412_10025442 3300031911 Bacteria 3667
117 Ga0307412_10027940 3300031911 Bacteria 3524
118 Ga0307412_10035289 3300031911 Bacteria 3194
119 Ga0307409_100000365 3300031995 Bacteria 18961
120 Ga0307409_100004762 3300031995 Bacteria 7689
121 Ga0307409_100046180 3300031995 Bacteria 3295
122 Ga0307409_100110880 3300031995 Bacteria 2300
123 Ga0307409_100113707 3300031995 Bacteria 2276
124 Ga0307416_100002461 3300032002 Bacteria 10643
125 Ga0307416_100003770 3300032002 Bacteria 8992
126 Ga0307416_100009272 3300032002 Bacteria 6430
127 Ga0307416_100010810 3300032002 Bacteria 6048
128 Ga0307416_100015719 3300032002 Bacteria 5236
129 Ga0307416_100055087 3300032002 Bacteria 3200
130 Ga0307416_100127522 3300032002 Bacteria 2282
131 Ga0307416_100134162 3300032002 Bacteria 2236
132 Ga0307416_100197218 3300032002 Bacteria 1906
133 Ga0307414_10001071 3300032004 Bacteria 13995
134 Ga0307414_10007961 3300032004 Bacteria 5984
135 Ga0307411_10009090 3300032005 Bacteria 5200
136 Ga0307411_10018363 3300032005 Bacteria 4009
137 Ga0307415_100000221 3300032126 Bacteria 24952
138 Ga0307415_100000295 3300032126 Bacteria 21639
139 Ga0307415_100009865 3300032126 Bacteria 5381
140 Ga0373951_0000086 3300035091 Bacteria 36308
141 Ga0373961_0030538 3300035241 Bacteria 1500
142 Ga0242420_008544 3300038996 Bacteria 1665
143 Ga0400483_066491 3300039062 Bacteria 56152
144 Ga0400483_095015 3300039062 Bacteria 13623
145 Ga0400483_228778 3300039062 Bacteria 97865
146 Ga0439448_0003473 3300042005 Bacteria 4366
147 Ga0439444_0003871 3300042437 Bacteria 2142
148 Ga0439464_0013674 3300042439 Bacteria 2177
149 Ga0453684_0312702 3300044712 Bacteria 1782
150 Ga0451576_0076054 3300045051 Bacteria 3494
151 Ga0495656_0038319 3300046615 Bacteria 1985
152 Ga0496102_0254033 3300048905 Bacteria 1657
153 Ga0496110_0190319 3300048913 Bacteria 1863
154 Ga0501034_0001463 3300049571 Bacteria 31261
155 nmdc:mga05p37_49668_c1 3300050507 Bacteria 5160
156 nmdc:mga05p37_52859_c1 3300050507 Bacteria 4996
157 nmdc:mga05p37_83722_c1 3300050507 Bacteria 3929
158 nmdc:mga09592_221213_c1 3300050508 Bacteria 1640
159 nmdc:mga09592_38291_c1 3300050508 Bacteria 4025
160 nmdc:mga0qj67_2430_c1 3300050509 Bacteria 13263
161 nmdc:mga0qj67_86433_c1 3300050509 Bacteria 2516
162 nmdc:mga06r32_293458_c1 3300050510 Bacteria 1613
163 nmdc:mga06r32_63506_c1 3300050510 Bacteria 3560
164 nmdc:mga08y16_13278_c1 3300050511 Bacteria 8661
165 nmdc:mga08y16_55889_c1 3300050511 Bacteria 4125
166 nmdc:mga0n895_28554_c1 3300050512 Bacteria 5308
167 nmdc:mga0n895_36096_c1 3300050512 Bacteria 4771
168 nmdc:mga08x19_2298_c1 3300050514 Bacteria 11613
169 nmdc:mga0a205_185971_c1 3300050515 Bacteria 1970
170 nmdc:mga0a205_326_c1 3300050515 Bacteria 35634
171 nmdc:mga0a205_6607_c1 3300050515 Bacteria 10491
172 Ga0500568_0016452 3300053139 Bacteria 3288
173 Ga0500634_0000011 3300053161 Bacteria 133329
174 Ga0590077_015880 3300059426 Bacteria 1577
175 2511193525 2510917030 Bacteria 7460662
176 2643912664 2643221580 Bacteria 3816678
177 2643965436 2643221591 Bacteria 4397626
178 2676483880 2675903059 Bacteria 8644972
179 2778179822 2775507266 Bacteria 7392367
180 2778180128 2775507266 Bacteria 7392367
181 2799183183 2799112218 Bacteria 4315149
182 2870624954 2870622029 Bacteria 3643329
183 2883824550 2883821847 Bacteria 5121194
184 2945970406 2945968032 Bacteria 4111363
185 Ga0400483_013555
186 JGI24740J21852_10010403
187 JGI24739J22299_10007337
188 JGI24737J22298_10008912
189 JGI24738J21930_10013147
190 Ga0006778J45830_1025763
191 JGI25406J46586_10004579
192 JGI25406J46586_10005900
193 Ga0006777J48905_1048579
194 JGI25407J50210_10000666
195 JGI25407J50210_10002895
196 JGI25407J50210_10014627
197 JGI25407J50210_10015585
198 Ga0007417J51691_1048096
199 Ga0007429J51699_1038944
200 Ga0032354_1012541
201 Ga0006780_1020471
202 Ga0065707_10002054
203 Ga0065707_10005822
204 Ga0065707_10010264
205 Ga0070683_100058544
206 Ga0070689_100051186
207 Ga0070668_100035790
208 Ga0070659_100085608
209 Ga0070698_100020523
210 Ga0070698_100079517
211 Ga0070684_100199242
212 Ga0070665_100176288
213 Ga0068857_100069018
214 Ga0068859_100020083
215 Ga0068864_100013414
216 Ga0068862_100061007
217 Ga0081455_10000616
218 Ga0081455_10013171
219 Ga0081455_10069421
220 Ga0081455_10084676
221 Ga0081455_10148387
222 Ga0081455_10159581
223 Ga0081538_10000041
224 Ga0081538_10000757
225 Ga0081538_10002193
226 Ga0081538_10002470
227 Ga0081538_10005987
228 Ga0081538_10007792
229 Ga0081538_10009784
230 Ga0081538_10014168
231 Ga0081538_10020128
232 Ga0081538_10026503
233 Ga0081538_10036695
234 Ga0081540_1012735
235 Ga0081539_10000625
236 Ga0081539_10002462
237 Ga0081539_10006382
238 Ga0081539_10006724
239 Ga0075364_10027775
240 Ga0075432_10001232
241 Ga0075427_10003554
242 Ga0075430_100043620
243 Ga0075431_100093841
244 Ga0075433_10006208
245 Ga0075434_100001137
246 Ga0075434_100033851
247 Ga0075436_100002245
248 Ga0111539_10002824
249 Ga0111539_10016000
250 Ga0111539_10031331
251 Ga0111539_10258253
252 Ga0105245_10001931
253 Ga0114129_10033303
254 Ga0114129_10068425
255 Ga0114129_10118691
256 Ga0114129_10177967
257 Ga0114129_10266966
258 Ga0114129_10546678
259 Ga0105248_10002635
260 Ga0105249_10058390
261 Ga0105249_10096214
262 Ga0105239_10258328
263 Ga0105246_10066289
264 Ga0105246_10105223
265 Ga0157369_10300620
266 Ga0163162_10242041
267 Ga0209130_1000160
268 Ga0207426_1000098
269 Ga0207647_10030730
270 Ga0207670_10067597
271 Ga0207711_10002594
272 Ga0207712_10108528
273 Ga0207674_10056417
274 Ga0207428_10000406
275 Ga0207428_10001364
276 Ga0207428_10009989
277 Ga0268265_10085362
278 Ga0307517_10022630
279 Ga0307515_10004188
280 Ga0307512_10125259
281 Ga0307408_100003972
282 Ga0307408_100030407
283 Ga0307516_10003260
284 Ga0307405_10001497
285 Ga0307405_10001620
286 Ga0307413_10000943
287 Ga0307413_10003973
288 Ga0307413_10143783
289 Ga0307410_10000463
290 Ga0307410_10007859
291 Ga0307410_10069919
292 Ga0326468_10000145
293 Ga0307406_10001384
294 Ga0307406_10006687
295 Ga0307406_10076266
296 Ga0307406_10091462
297 Ga0307407_10000161
298 Ga0307407_10000233
299 Ga0307407_10000600
300 Ga0307412_10025442
301 Ga0307412_10027940
302 Ga0307412_10035289
303 Ga0307409_100000365
304 Ga0307409_100004762
305 Ga0307409_100046180
306 Ga0307409_100110880
307 Ga0307409_100113707
308 Ga0307416_100002461
309 Ga0307416_100003770
310 Ga0307416_100009272
311 Ga0307416_100010810
312 Ga0307416_100015719
313 Ga0307416_100055087
314 Ga0307416_100127522
315 Ga0307416_100134162
316 Ga0307416_100197218
317 Ga0307414_10001071
318 Ga0307414_10007961
319 Ga0307411_10009090
320 Ga0307411_10018363
321 Ga0307415_100000221
322 Ga0307415_100000295
323 Ga0307415_100009865
324 Ga0373951_0000086
325 Ga0373961_0030538
326 Ga0242420_008544
327 Ga0400483_066491
328 Ga0400483_095015
329 Ga0400483_228778
330 Ga0439448_0003473
331 Ga0439444_0003871
332 Ga0439464_0013674
333 Ga0453684_0312702
334 Ga0451576_0076054
335 Ga0495656_0038319
336 Ga0496102_0254033
337 Ga0496110_0190319
338 Ga0501034_0001463
339 nmdc:mga05p37_49668_c1
340 nmdc:mga05p37_52859_c1
341 nmdc:mga05p37_83722_c1
342 nmdc:mga09592_221213_c1
343 nmdc:mga09592_38291_c1
344 nmdc:mga0qj67_2430_c1
345 nmdc:mga0qj67_86433_c1
346 nmdc:mga06r32_293458_c1
347 nmdc:mga06r32_63506_c1
348 nmdc:mga08y16_13278_c1
349 nmdc:mga08y16_55889_c1
350 nmdc:mga0n895_28554_c1
351 nmdc:mga0n895_36096_c1
352 nmdc:mga08x19_2298_c1
353 nmdc:mga0a205_185971_c1
354 nmdc:mga0a205_326_c1
355 nmdc:mga0a205_6607_c1
356 Ga0500568_0016452
357 Ga0500634_0000011
358 Ga0590077_015880
359 2511193525
360 2643912664
361 2643965436
362 2676483880
363 2778179822
364 2778180128
365 2799183183
366 2870624954
367 2883824550
368 2945970406

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

109

411

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2heu-assembly3.cif.gz_C atomic resolution structure of apo-form of rafe from streptococcus pneumoniae 0.8399 33 435
2heu-assembly3.cif.gz_C atomic resolution structure of apo-form of rafe from streptococcus pneumoniae 0.8339 33 435
7eho-assembly2.cif.gz_B chitin oligosaccharide binding protein 0.8261 40 436
4zze-assembly2.cif.gz_B raffinose and panose binding protein from bifidobacterium animalis subsp. lactis bl-04, bound with panose 0.8259 40 435
4r6h-assembly1.cif.gz_A crystal structure of putative binding protein msme from bacillus subtilis subsp. subtilis str. 168, target efi-510764, an open conformation 0.8231 35 439
ID Description Score Start End Superfamily
3qufA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.849 38 146 3.40.190.10
1eu8A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8487 41 149 3.40.190.10
2b3fA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8396 40 149 3.40.190.10
4c1tA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8389 41 149 3.40.190.10
3k02A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8386 39 149 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7J0B4Z1-F1-model_v4 deleted 0.9485 150 443
AF-A0A7J0B4Z1-F1-model_v4 deleted 0.9422 150 443
AF-F5YF37-F1-model_v4 Extracellular solute-binding protein family 1 0.9052 1 443
AF-F5YF37-F1-model_v4 Extracellular solute-binding protein family 1 0.9032 1 443
AF-A0A660TXK0-F1-model_v4 Carbohydrate ABC transporter substrate-binding protein 0.9001 27 443 GO:0030313

Map