F280843

General Info

Members Datasets Scaffolds Average Seq Length
183 135 172 340

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10004314|Ga0157371_100043144
Length 358
Sequence LTPDEDMTNTASDSPVPAGSILCFGEMLLRLSPNQNELLLQSPALSVRPGGAEANVAVSLARFGAPTAMATVLPDNALGRAARDEVRRHGVDTSPIVFTPGRMGLYFLTPGAVRRPSEVLYDRAASAFVEQVNAVFDWDRLLDGVEWLHASGVTPATGPNGSAAAVALIEAAVRKGVKVSYDGNFRGKLWEQWDGDPPATLGRMLAGATIAFADDRDFALVLKTRFDNADPAERRRQAAKAAFAAFPRLEHIACTQRVQDSVADQALSAVMLTRKGDDVTETRAEALHMAGVVDRVGGGDAFAAGVLFGLWSGWSDQQTLDFGLAAAALKHSIPGDFNLASSEDVHAAMGDGGFDIRR

Samples

Sample ID Description Type Environment
1 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
2 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
3 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
4 2739367700 Dyella sp. YR388 Isolate Unclassified
5 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
6 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
7 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
8 2928963466 Dyella japonica 1073 Isolate Unclassified
9 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
10 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
38 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
43 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
72 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
79 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
80 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
89 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
90 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
93 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
94 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
99 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
100 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
101 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
109 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
126 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
127 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
128 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
129 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
130 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
131 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
132 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
133 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
134 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
135 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.44
Metatranscriptomes 0.55
Isolates 6.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 34.43
Nodule 0
Rhizoplane 1.64
Rhizosphere 47.54
Stem 0
Stem Tuber 0
Unclassified 16.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000115 3300002737 Bacteria 88006
2 JGI25162J39368_1000764 3300002737 Bacteria 21773
3 JGI25157J39369_1000132 3300002741 Bacteria 62647
4 JGI25163J39215_1000228 3300002771 Bacteria 21041
5 JGI25164J39214_1000090 3300002772 Bacteria 90565
6 JGI25151J46595_10039822 3300003187 Bacteria 1730
7 JGI25165J46597_1000194 3300003214 Bacteria 91012
8 rootH2_10198112 3300003320 Bacteria 3038
9 Ga0006562J51391_1100915 3300003578 Bacteria 1770
10 Ga0055535_1000106 3300003761 Bacteria 90565
11 Ga0055542_1000150 3300003762 Bacteria 88006
12 Ga0055542_1000245 3300003762 Bacteria 62120
13 Ga0055529_1000168 3300003763 Bacteria 90565
14 Ga0055529_1000178 3300003763 Bacteria 86969
15 Ga0055524_1019787 3300003775 Bacteria 2289
16 Ga0055524_1023101 3300003775 Bacteria 2010
17 Ga0055536_1007505 3300003781 Bacteria 4865
18 Ga0055530_10006061 3300003791 Bacteria 5523
19 Ga0055531_10024268 3300003794 Bacteria 2244
20 Ga0055531_10026406 3300003794 Bacteria 2072
21 Ga0070658_10069792 3300005327 Bacteria 2875
22 Ga0070658_10240254 3300005327 Bacteria 1535
23 Ga0070664_100081080 3300005564 Bacteria 2796
24 Ga0068854_100004058 3300005578 Bacteria 9195
25 Ga0068852_100145611 3300005616 Bacteria 2197
26 Ga0068852_100265056 3300005616 Bacteria 1651
27 Ga0097621_100236974 3300006237 Bacteria 1594
28 Ga0105249_10408859 3300009553 Unclassified 1389
29 Ga0157371_10004314 3300013102 Bacteria 12467
30 Ga0157370_10004124 3300013104 Bacteria 16845
31 Ga0157370_10266210 3300013104 Bacteria 1584
32 Ga0157369_10129724 3300013105 Bacteria 2672
33 Ga0157372_10144236 3300013307 Bacteria 2746
34 Ga0157376_10239350 3300014969 Bacteria 1690
35 Ga0183368_1002 3300015687 Bacteria 1865598
36 Ga0209760_100428 3300025207 Bacteria 9912
37 Ga0209784_100053 3300025224 Bacteria 182075
38 Ga0209674_100014 3300025226 Bacteria 704989
39 Ga0209672_100890 3300025228 Bacteria 13609
40 Ga0207427_100061 3300025231 Bacteria 182815
41 Ga0207427_103426 3300025231 Bacteria 3348
42 Ga0209437_100037 3300025233 Bacteria 459730
43 Ga0209437_100279 3300025233 Bacteria 75208
44 Ga0209258_100138 3300025242 Bacteria 167495
45 Ga0209258_101312 3300025242 Bacteria 9195
46 Ga0209258_101601 3300025242 Bacteria 7454
47 Ga0209026_1000104 3300025250 Bacteria 152614
48 Ga0209026_1003277 3300025250 Bacteria 5416
49 Ga0209148_1000001 3300025254 Bacteria 2545271
50 Ga0209148_1000002 3300025254 Bacteria 2399500
51 Ga0209759_1000220 3300025256 Bacteria 87504
52 Ga0209233_1000002 3300025261 Bacteria 2501366
53 Ga0209455_1000079 3300025272 Bacteria 268778
54 Ga0209455_1009432 3300025272 Bacteria 2566
55 Ga0209673_1004312 3300025273 Bacteria 7679
56 Ga0209675_1007301 3300025291 Bacteria 4268
57 Ga0209676_1001203 3300025292 Bacteria 27701
58 Ga0209676_1001964 3300025292 Bacteria 16439
59 Ga0209676_1008509 3300025292 Bacteria 4565
60 Ga0209676_1021452 3300025292 Bacteria 2169
61 Ga0209025_1002579 3300025294 Bacteria 18798
62 Ga0209025_1009687 3300025294 Bacteria 6663
63 Ga0209050_1002830 3300025298 Bacteria 13810
64 Ga0209256_1001631 3300025299 Bacteria 21855
65 Ga0209256_1007439 3300025299 Bacteria 5400
66 Ga0209256_1020487 3300025299 Bacteria 2062
67 Ga0209051_1043565 3300025303 Bacteria 1573
68 Ga0209257_1000261 3300025304 Bacteria 121357
69 Ga0209257_1003094 3300025304 Bacteria 14955
70 Ga0209257_1003679 3300025304 Bacteria 12808
71 Ga0209257_1010596 3300025304 Bacteria 4628
72 Ga0209257_1013395 3300025304 Bacteria 3653
73 Ga0209257_1023297 3300025304 Bacteria 2180
74 Ga0207705_10114140 3300025909 Bacteria 1998
75 Ga0316177_1022067 3300030731 Bacteria 1994
76 Ga0265327_10000039 3300031251 Bacteria 292334
77 Ga0307408_100120689 3300031548 Bacteria 2030
78 Ga0307508_10062489 3300031616 Bacteria 3287
79 Ga0307405_10042353 3300031731 Bacteria 2771
80 Ga0307413_10020529 3300031824 Bacteria 3516
81 Ga0307413_10037943 3300031824 Bacteria 2788
82 Ga0307410_10137921 3300031852 Bacteria 1800
83 Ga0307410_10266941 3300031852 Bacteria 1337
84 Ga0307407_10002736 3300031903 Bacteria 7011
85 Ga0307412_10034629 3300031911 Bacteria 3220
86 Ga0307409_100089387 3300031995 Bacteria 2518
87 Ga0307416_100285716 3300032002 Bacteria 1630
88 Ga0307416_100726347 3300032002 Bacteria 1084
89 Ga0307414_10079741 3300032004 Bacteria 2391
90 Ga0307510_10281306 3300033180 Bacteria 1134
91 Ga0373948_0003936 3300034817 Bacteria 2321
92 Ga0373931_0012116 3300035691 Bacteria 4174
93 Ga0395899_0000013 3300037312 Bacteria 510397
94 Ga0395899_0003573 3300037312 Bacteria 12310
95 Ga0395898_0000336 3300037466 Bacteria 106457
96 Ga0395905_0476111 3300037471 Unclassified 1148
97 Ga0395901_0078381 3300038443 Bacteria 3450
98 Ga0436361_0799233 3300039447 Bacteria 3745
99 Ga0436361_1192945 3300039447 Bacteria 1784
100 Ga0439436_0026410 3300041404 Bacteria 1703
101 Ga0439465_0001261 3300041413 Bacteria 8161
102 Ga0466961_0000103 3300044693 Bacteria 55501
103 Ga0466963_0030631 3300044694 Bacteria 3474
104 Ga0453684_0045081 3300044712 Bacteria 5887
105 Ga0466967_0091556 3300045976 Bacteria 2764
106 Ga0495638_0000062 3300046460 Bacteria 188223
107 Ga0495650_0000841 3300046471 Bacteria 36967
108 Ga0495606_0000791 3300046507 Bacteria 48283
109 Ga0495610_0000020 3300046512 Bacteria 344007
110 Ga0495620_0018780 3300046515 Bacteria 3418
111 Ga0495622_0002862 3300046557 Bacteria 8237
112 Ga0495625_0020616 3300046660 Bacteria 5085
113 Ga0495625_0025970 3300046660 Bacteria 4432
114 Ga0495649_0000785 3300046694 Bacteria 25518
115 Ga0495673_0096244 3300047469 Bacteria 1203
116 Ga0495681_0000052 3300047470 Bacteria 106939
117 Ga0495686_0000632 3300047472 Bacteria 48487
118 Ga0496101_0090742 3300048904 Bacteria 2273
119 Ga0496115_0000095 3300048918 Bacteria 82835
120 Ga0496115_0000096 3300048918 Bacteria 82735
121 Ga0496116_0000035 3300048919 Bacteria 402424
122 Ga0496117_0046310 3300048920 Bacteria 3129
123 Ga0496118_0021660 3300048921 Bacteria 5649
124 Ga0496119_0071912 3300048922 Bacteria 2023
125 Ga0496121_0001115 3300048924 Bacteria 47276
126 Ga0496122_0004393 3300048925 Bacteria 17555
127 Ga0496123_0007465 3300048926 Bacteria 10281
128 Ga0496124_0001947 3300048927 Bacteria 28226
129 Ga0496124_0003936 3300048927 Bacteria 17744
130 Ga0496124_0008156 3300048927 Bacteria 10993
131 Ga0496125_0036876 3300048928 Bacteria 4259
132 Ga0496126_0000084 3300048929 Bacteria 217111
133 Ga0496126_0013103 3300048929 Bacteria 8456
134 Ga0496126_0261111 3300048929 Unclassified 1440
135 Ga0495678_079838 3300049459 Unclassified 1177
136 Ga0495682_0002735 3300049460 Bacteria 8178
137 Ga0501031_0158718 3300049568 Bacteria 1478
138 Ga0501032_0016436 3300049569 Bacteria 5204
139 Ga0501033_0005649 3300049570 Bacteria 9880
140 Ga0501033_0105939 3300049570 Bacteria 2048
141 Ga0501034_0097747 3300049571 Bacteria 2932
142 Ga0501038_0188196 3300049574 Bacteria 1662
143 Ga0501039_0096878 3300049575 Bacteria 2300
144 Ga0501043_0004737 3300049579 Bacteria 11033
145 Ga0501043_0007468 3300049579 Bacteria 8680
146 Ga0501043_0026031 3300049579 Bacteria 4590
147 Ga0501043_0033993 3300049579 Bacteria 4011
148 Ga0501043_0042713 3300049579 Bacteria 3563
149 Ga0501046_0053438 3300049580 Bacteria 3181
150 Ga0501046_0134264 3300049580 Bacteria 1875
151 Ga0501047_0061646 3300049581 Bacteria 3618
152 Ga0501047_0108478 3300049581 Bacteria 2658
153 Ga0501047_0212595 3300049581 Bacteria 1792
154 Ga0501048_0103488 3300049582 Bacteria 2009
155 Ga0501070_0008274 3300049586 Bacteria 8794
156 Ga0501249_000039 3300049679 Bacteria 58314
157 Ga0501080_0022588 3300049742 Bacteria 5828
158 Ga0501035_0006581 3300049822 Bacteria 10884
159 Ga0501035_0066844 3300049822 Bacteria 3190
160 Ga0501044_0054225 3300049823 Bacteria 4122
161 Ga0501204_006769 3300049850 Bacteria 1279
162 Ga0500651_0000231 3300053093 Bacteria 34629
163 Ga0500651_0054888 3300053093 Bacteria 2496
164 Ga0500556_0000055 3300053104 Bacteria 115798
165 Ga0500595_008740 3300053119 Bacteria 4122
166 Ga0500608_000854 3300053122 Bacteria 11004
167 Ga0500642_0000008 3300053130 Bacteria 293258
168 Ga0500559_0041761 3300053136 Bacteria 1999
169 Ga0500564_002038 3300053138 Bacteria 7291
170 Ga0500625_000002 3300053729 Bacteria 371909
171 Ga0500645_000682 3300053730 Bacteria 21220
172 Ga0500645_017971 3300053730 Bacteria 2213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031903 Ga0307407_10002736 Ga0307407_100027362 302
2 3300053138 Ga0500564_002038 Ga0500564_002038_6302_7246 314
3 3300025909 Ga0207705_10114140 Ga0207705_101141402 315
4 3300048927 Ga0496124_0001947 Ga0496124_0001947_20310_21290 320
5 3300044712 Ga0453684_0045081 Ga0453684_0045081_777_1817 321
6 3300031251 Ga0265327_10000039 Ga0265327_10000039132 323
7 3300053119 Ga0500595_008740 Ga0500595_008740_504_1535 324
8 3300032002 Ga0307416_100285716 Ga0307416_1002857162 326
9 3300005327 Ga0070658_10240254 Ga0070658_102402542 327
10 3300005564 Ga0070664_100081080 Ga0070664_1000810802 327
11 3300005616 Ga0068852_100145611 Ga0068852_1001456111 327
12 3300006237 Ga0097621_100236974 Ga0097621_1002369741 327
13 3300009553 Ga0105249_10408859 Ga0105249_104088591 327
14 3300014969 Ga0157376_10239350 Ga0157376_102393502 327
15 3300053730 Ga0500645_017971 Ga0500645_017971_1109_2122 327
16 3300049580 Ga0501046_0134264 Ga0501046_0134264_315_1361 329
17 3300013104 Ga0157370_10266210 Ga0157370_102662102 330
18 3300013307 Ga0157372_10144236 Ga0157372_101442362 330
19 3300037312 Ga0395899_0000013 Ga0395899_0000013_90630_91652 330
20 3300037471 Ga0395905_0476111 Ga0395905_0476111_68_1078 330
21 3300049570 Ga0501033_0105939 Ga0501033_0105939_17_1057 330
22 3300049574 Ga0501038_0188196 Ga0501038_0188196_179_1219 330
23 3300049579 Ga0501043_0004737 Ga0501043_0004737_167_1207 330
24 3300049581 Ga0501047_0108478 Ga0501047_0108478_493_1533 330
25 3300049822 Ga0501035_0006581 Ga0501035_0006581_9827_10867 330
26 3300005578 Ga0068854_100004058 Ga0068854_1000040586 331
27 3300039447 Ga0436361_1192945 Ga0436361_1192945_442_1461 331
28 iso_pu_bacteria 2885429604 2885430830 331
29 iso_pu_bacteria 8003014200 8003015519 331
30 3300049570 Ga0501033_0005649 Ga0501033_0005649_4933_5979 332
31 iso_pu_bacteria 2818991438 2819552312 332
32 3300031824 Ga0307413_10037943 Ga0307413_100379432 334
33 3300034817 Ga0373948_0003936 Ga0373948_0003936_537_1541 334
34 3300035691 Ga0373931_0012116 Ga0373931_0012116_372_1376 334
35 3300053093 Ga0500651_0000231 Ga0500651_0000231_28978_30000 334
36 3300003187 JGI25151J46595_10039822 JGI25151J46595_100398221 335
37 3300003775 Ga0055524_1019787 Ga0055524_10197871 335
38 3300003794 Ga0055531_10024268 Ga0055531_100242682 335
39 3300005327 Ga0070658_10069792 Ga0070658_100697923 335
40 3300025273 Ga0209673_1004312 Ga0209673_10043123 335
41 3300025292 Ga0209676_1008509 Ga0209676_10085092 335
42 3300025299 Ga0209256_1001631 Ga0209256_10016319 335
43 3300025299 Ga0209256_1020487 Ga0209256_10204872 335
44 3300025304 Ga0209257_1000261 Ga0209257_10002613 335
45 3300025304 Ga0209257_1010596 Ga0209257_10105962 335
46 3300049679 Ga0501249_000039 Ga0501249_000039_43274_44284 335
47 3300049850 Ga0501204_006769 Ga0501204_006769_74_1084 335
48 3300053122 Ga0500608_000854 Ga0500608_000854_7248_8255 335
49 3300025294 Ga0209025_1009687 Ga0209025_10096872 336
50 3300031616 Ga0307508_10062489 Ga0307508_100624892 336
51 3300031731 Ga0307405_10042353 Ga0307405_100423533 336
52 3300033180 Ga0307510_10281306 Ga0307510_102813061 336
53 3300048904 Ga0496101_0090742 Ga0496101_0090742_892_1902 336
54 3300048919 Ga0496116_0000035 Ga0496116_0000035_211126_212136 336
55 3300048920 Ga0496117_0046310 Ga0496117_0046310_1134_2144 336
56 3300048921 Ga0496118_0021660 Ga0496118_0021660_3409_4419 336
57 3300048924 Ga0496121_0001115 Ga0496121_0001115_33422_34432 336
58 3300048925 Ga0496122_0004393 Ga0496122_0004393_9963_10973 336
59 3300048926 Ga0496123_0007465 Ga0496123_0007465_68_1078 336
60 3300048927 Ga0496124_0003936 Ga0496124_0003936_11060_12070 336
61 3300048927 Ga0496124_0008156 Ga0496124_0008156_4761_5771 336
62 3300048928 Ga0496125_0036876 Ga0496125_0036876_448_1458 336
63 3300048929 Ga0496126_0000084 Ga0496126_0000084_5849_6859 336
64 iso_pu_bacteria 2928963466 2928966949 336
65 iso_pu_bacteria 2739367700 2739733014 337
66 3300003775 Ga0055524_1023101 Ga0055524_10231012 338
67 3300003781 Ga0055536_1007505 Ga0055536_10075053 338
68 3300003791 Ga0055530_10006061 Ga0055530_100060614 338
69 3300003794 Ga0055531_10026406 Ga0055531_100264062 338
70 3300005616 Ga0068852_100265056 Ga0068852_1002650562 338
71 3300025291 Ga0209675_1007301 Ga0209675_10073012 338
72 3300025292 Ga0209676_1001203 Ga0209676_10012033 338
73 3300025292 Ga0209676_1001964 Ga0209676_100196413 338
74 3300025292 Ga0209676_1021452 Ga0209676_10214522 338
75 3300025294 Ga0209025_1002579 Ga0209025_100257916 338
76 3300025298 Ga0209050_1002830 Ga0209050_100283010 338
77 3300025299 Ga0209256_1007439 Ga0209256_10074391 338
78 3300025303 Ga0209051_1043565 Ga0209051_10435651 338
79 3300025304 Ga0209257_1003094 Ga0209257_100309411 338
80 3300025304 Ga0209257_1003679 Ga0209257_10036792 338
81 3300025304 Ga0209257_1013395 Ga0209257_10133952 338
82 3300025304 Ga0209257_1023297 Ga0209257_10232972 338
83 3300030731 Ga0316177_1022067 Ga0316177_10220672 338
84 3300031548 Ga0307408_100120689 Ga0307408_1001206892 338
85 3300031824 Ga0307413_10020529 Ga0307413_100205292 338
86 3300031852 Ga0307410_10137921 Ga0307410_101379212 338
87 3300031911 Ga0307412_10034629 Ga0307412_100346293 338
88 3300031995 Ga0307409_100089387 Ga0307409_1000893872 338
89 3300032004 Ga0307414_10079741 Ga0307414_100797412 338
90 3300041404 Ga0439436_0026410 Ga0439436_0026410_520_1680 338
91 3300041413 Ga0439465_0001261 Ga0439465_0001261_2724_3884 338
92 3300046471 Ga0495650_0000841 Ga0495650_0000841_35788_36813 338
93 3300046512 Ga0495610_0000020 Ga0495610_0000020_124181_125206 338
94 3300046515 Ga0495620_0018780 Ga0495620_0018780_514_1539 338
95 3300046660 Ga0495625_0025970 Ga0495625_0025970_1559_2578 338
96 3300047469 Ga0495673_0096244 Ga0495673_0096244_86_1102 338
97 3300047470 Ga0495681_0000052 Ga0495681_0000052_70122_71147 338
98 3300047472 Ga0495686_0000632 Ga0495686_0000632_30406_31422 338
99 3300048922 Ga0496119_0071912 Ga0496119_0071912_306_1322 338
100 3300049575 Ga0501039_0096878 Ga0501039_0096878_1205_2245 338
101 3300049579 Ga0501043_0007468 Ga0501043_0007468_6668_7711 338
102 3300049579 Ga0501043_0026031 Ga0501043_0026031_1203_2219 338
103 3300049579 Ga0501043_0042713 Ga0501043_0042713_939_1979 338
104 3300049580 Ga0501046_0053438 Ga0501046_0053438_1683_2723 338
105 3300049581 Ga0501047_0061646 Ga0501047_0061646_975_2015 338
106 3300049582 Ga0501048_0103488 Ga0501048_0103488_374_1414 338
107 3300053104 Ga0500556_0000055 Ga0500556_0000055_72712_73731 338
108 3300053130 Ga0500642_0000008 Ga0500642_0000008_138019_139038 338
109 3300053136 Ga0500559_0041761 Ga0500559_0041761_120_1160 338
110 3300053729 Ga0500625_000002 Ga0500625_000002_29267_30310 338
111 3300053730 Ga0500645_000682 Ga0500645_000682_18871_19890 338
112 iso_pu_bacteria 2739367664 2739652078 338
113 iso_pu_bacteria 2739367865 2740030552 338
114 3300025228 Ga0209672_100890 Ga0209672_1008906 339
115 3300025272 Ga0209455_1009432 Ga0209455_10094322 339
116 3300046460 Ga0495638_0000062 Ga0495638_0000062_135564_136607 339
117 3300046507 Ga0495606_0000791 Ga0495606_0000791_30997_32040 339
118 3300046557 Ga0495622_0002862 Ga0495622_0002862_105_1148 339
119 3300046660 Ga0495625_0020616 Ga0495625_0020616_1737_2780 339
120 3300046694 Ga0495649_0000785 Ga0495649_0000785_1440_2465 339
121 3300048918 Ga0496115_0000096 Ga0496115_0000096_74002_75027 339
122 3300048929 Ga0496126_0013103 Ga0496126_0013103_293_1318 339
123 3300048929 Ga0496126_0261111 Ga0496126_0261111_103_1146 339
124 3300049459 Ga0495678_079838 Ga0495678_079838_34_1059 339
125 3300049460 Ga0495682_0002735 Ga0495682_0002735_118_1161 339
126 3300002737 JGI25162J39368_1000764 JGI25162J39368_100076411 340
127 3300003762 Ga0055542_1000245 Ga0055542_100024514 340
128 3300015687 Ga0183368_1002 Ga0183368_10021368 340
129 3300025226 Ga0209674_100014 Ga0209674_10001492 340
130 3300025231 Ga0207427_103426 Ga0207427_1034262 340
131 3300025233 Ga0209437_100279 Ga0209437_10027917 340
132 3300025242 Ga0209258_101312 Ga0209258_1013122 340
133 3300025242 Ga0209258_101601 Ga0209258_1016012 340
134 3300025250 Ga0209026_1003277 Ga0209026_10032773 340
135 3300025254 Ga0209148_1000002 Ga0209148_1000002255 340
136 3300031852 Ga0307410_10266941 Ga0307410_102669412 340
137 3300032002 Ga0307416_100726347 Ga0307416_1007263471 340
138 3300037312 Ga0395899_0003573 Ga0395899_0003573_3156_4202 340
139 3300037466 Ga0395898_0000336 Ga0395898_0000336_26005_27051 340
140 3300038443 Ga0395901_0078381 Ga0395901_0078381_1488_2534 340
141 3300039447 Ga0436361_0799233 Ga0436361_0799233_742_1764 340
142 3300044693 Ga0466961_0000103 Ga0466961_0000103_13689_14723 340
143 3300044694 Ga0466963_0030631 Ga0466963_0030631_2315_3343 340
144 3300045976 Ga0466967_0091556 Ga0466967_0091556_1700_2728 340
145 3300048918 Ga0496115_0000095 Ga0496115_0000095_19675_20706 340
146 3300049568 Ga0501031_0158718 Ga0501031_0158718_358_1404 340
147 3300049569 Ga0501032_0016436 Ga0501032_0016436_3762_4808 340
148 3300049571 Ga0501034_0097747 Ga0501034_0097747_1137_2183 340
149 3300049579 Ga0501043_0033993 Ga0501043_0033993_1336_2382 340
150 3300049581 Ga0501047_0212595 Ga0501047_0212595_44_1090 340
151 3300049586 Ga0501070_0008274 Ga0501070_0008274_2818_3855 340
152 3300049742 Ga0501080_0022588 Ga0501080_0022588_1059_2096 340
153 3300049822 Ga0501035_0066844 Ga0501035_0066844_1757_2800 340
154 3300049823 Ga0501044_0054225 Ga0501044_0054225_2494_3537 340
155 iso_pu_bacteria 2643221577 2643896049 340
156 iso_pu_bacteria 2643221685 2644478256 340
157 iso_pu_bacteria 2928972540 2928975287 340
158 iso_pu_bacteria 2977240413 2977241725 340
159 3300002737 JGI25162J39368_1000115 JGI25162J39368_100011513 341
160 3300002741 JGI25157J39369_1000132 JGI25157J39369_100013240 341
161 3300002771 JGI25163J39215_1000228 JGI25163J39215_10002286 341
162 3300002772 JGI25164J39214_1000090 JGI25164J39214_100009062 341
163 3300003214 JGI25165J46597_1000194 JGI25165J46597_100019418 341
164 3300003320 rootH2_10198112 rootH2_101981122 341
165 3300003578 Ga0006562J51391_1100915 Ga0006562J51391_11009152 341
166 3300003761 Ga0055535_1000106 Ga0055535_100010662 341
167 3300003762 Ga0055542_1000150 Ga0055542_100015013 341
168 3300003763 Ga0055529_1000168 Ga0055529_100016818 341
169 3300003763 Ga0055529_1000178 Ga0055529_100017863 341
170 3300013102 Ga0157371_10004314 Ga0157371_100043144 341
171 3300013104 Ga0157370_10004124 Ga0157370_1000412416 341
172 3300013105 Ga0157369_10129724 Ga0157369_101297242 341
173 3300025207 Ga0209760_100428 Ga0209760_1004282 341
174 3300025224 Ga0209784_100053 Ga0209784_100053103 341
175 3300025231 Ga0207427_100061 Ga0207427_10006154 341
176 3300025233 Ga0209437_100037 Ga0209437_100037213 341
177 3300025242 Ga0209258_100138 Ga0209258_100138120 341
178 3300025250 Ga0209026_1000104 Ga0209026_100010454 341
179 3300025254 Ga0209148_1000001 Ga0209148_1000001297 341
180 3300025256 Ga0209759_1000220 Ga0209759_100022060 341
181 3300025261 Ga0209233_1000002 Ga0209233_10000021934 341
182 3300025272 Ga0209455_1000079 Ga0209455_100007954 341
183 3300053093 Ga0500651_0054888 Ga0500651_0054888_442_1509 341

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

18

340

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2afb-assembly1.cif.gz_B crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution 0.9625 5 333
4gm6-assembly1.cif.gz_F crystal structure of pfkb family carbohydrate kinase(target efi-502146 from listeria grayi dsm 20601 0.9609 5 333
2afb-assembly1.cif.gz_A crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution 0.9604 4 330
4gm6-assembly1.cif.gz_F crystal structure of pfkb family carbohydrate kinase(target efi-502146 from listeria grayi dsm 20601 0.9551 5 333
2afb-assembly1.cif.gz_B crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution 0.9539 5 333
ID Description Score Start End Superfamily
4gm6A00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9602 5 333 3.40.1190.20
1j5vB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9571 6 330 3.40.1190.20
4gm6A00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9544 5 333 3.40.1190.20
1j5vB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9424 6 330 3.40.1190.20
3ktnA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9092 5 341 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A7M1C3T2-F1-model_v4 deleted 0.9773 6 112
AF-A0A2R7IN84-F1-model_v4 2-keto-3-deoxygluconate kinase 0.9764 5 245 GO:0016301
AF-J8SDQ8-F1-model_v4 deleted 0.9732 4 172
AF-A0A1G9TBF2-F1-model_v4 PfkB family carbohydrate kinase 0.9731 5 114 GO:0016301
AF-A0A3R7EIH7-F1-model_v4 Sugar kinase 0.973 6 93 GO:0016301

Feature Viewer

pLDDT pTM Quality
93.1 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map