F279421

General Info

Members Datasets Scaffolds Average Seq Length
182 142 364 348

Family's Representative Sequence

Representative Sequence 3300035089|Ga0373944_0049711|Ga0373944_0049711_21_1244
Length 407
Sequence VLVWQRQEVQGLSREGLTTVPSPGSAGSDAVGTDPLDYGAELTALSSRARAAAEYLHLDHLRAELTRLETEVADPDLWNDGEHARRVTTAYGRTKADVEELETLLGRIADAETLLELAAEEGGDAIGEVDEELRSTIGEVTRILDVLELRSLFSGEYDERDAIAEIHGGAGGTDAQDWAEMMLRMYLRWAERHGFEVEIDEVSAGGEAGILSATFIVKGRHAYGLLGAERGVHRLVRMSPFDSQHRRQTSFASFEVTPSLDALDDKVEIDEKDLRIDTYRSSGAGGQHVNVTDSAVRLTHLPTGVVVSCQNERSQLQNKAKAMQVLAAKLAERQREERKAELSGLSGPQQDVGWGSQIRSYVMAPYQLVKDLRTGYETGNVDAVLDGDLDDFMSSYLRWRRAGDSTG

Samples

Sample ID Description Type Environment
1 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
98 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
99 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
128 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
129 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
130 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
131 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
137 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
138 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
139 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
142 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.15
Metatranscriptomes 2.75
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 0
Rhizoplane 5.49
Rhizosphere 88.46
Stem 0
Stem Tuber 0
Unclassified 4.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373944_0049711 3300035089 Bacteria 1318
2 Ga0065704_10127608 3300005289 Unclassified 1673
3 Ga0065707_10002942 3300005295 Bacteria 6043
4 Ga0070658_10032611 3300005327 Bacteria 4189
5 Ga0070670_100015620 3300005331 Bacteria 6520
6 Ga0070670_100072038 3300005331 Bacteria 2967
7 Ga0070661_100022735 3300005344 Bacteria 4490
8 Ga0070669_100115370 3300005353 Bacteria 2043
9 Ga0070675_100032871 3300005354 Bacteria 4201
10 Ga0070671_100002093 3300005355 Bacteria 15372
11 Ga0070671_100052913 3300005355 Bacteria 3375
12 Ga0070688_100047141 3300005365 Bacteria 2672
13 Ga0070659_100061459 3300005366 Bacteria 2968
14 Ga0070667_100018738 3300005367 Bacteria 5741
15 Ga0070713_100040912 3300005436 Bacteria 3772
16 Ga0070711_100000006 3300005439 Bacteria 187224
17 Ga0070708_100259766 3300005445 Bacteria 1633
18 Ga0070681_10041687 3300005458 Bacteria 4601
19 Ga0070698_100260949 3300005471 Bacteria 1665
20 Ga0070698_100454103 3300005471 Bacteria 1217
21 Ga0070679_100195909 3300005530 Bacteria 1988
22 Ga0070679_100197906 3300005530 Bacteria 1976
23 Ga0068853_100091783 3300005539 Bacteria 2671
24 Ga0068853_100108732 3300005539 Bacteria 2460
25 Ga0068853_100521190 3300005539 Bacteria 1124
26 Ga0070704_100161245 3300005549 Bacteria 1774
27 Ga0070664_100026726 3300005564 Bacteria 4791
28 Ga0068852_100041244 3300005616 Bacteria 3899
29 Ga0068859_100022067 3300005617 Bacteria 6383
30 Ga0068864_100084341 3300005618 Unclassified 2791
31 Ga0068861_100192876 3300005719 Bacteria 1704
32 Ga0068863_100079678 3300005841 Bacteria 3102
33 Ga0068858_100009694 3300005842 Bacteria 9176
34 Ga0068860_100213643 3300005843 Bacteria 1871
35 Ga0070717_10106812 3300006028 Bacteria 2384
36 Ga0075365_10068804 3300006038 Bacteria 2379
37 Ga0070716_100075854 3300006173 Bacteria 1991
38 Ga0070712_100036794 3300006175 Bacteria 3333
39 Ga0070712_100160019 3300006175 Bacteria 1738
40 Ga0075428_100094600 3300006844 Bacteria 3257
41 Ga0075436_100000278 3300006914 Bacteria 32285
42 Ga0097620_100022067 3300006931 Bacteria 6383
43 Ga0111539_10106053 3300009094 Bacteria 3297
44 Ga0105245_10133310 3300009098 Bacteria 2332
45 Ga0105247_10005596 3300009101 Bacteria 7889
46 Ga0114129_10025487 3300009147 Bacteria 8380
47 Ga0105249_10113925 3300009553 Bacteria 2560
48 Ga0105239_10201809 3300010375 Unclassified 2228
49 Ga0157369_10124034 3300013105 Bacteria 2740
50 Ga0163162_10180163 3300013306 Unclassified 2239
51 Ga0163162_10364075 3300013306 Bacteria 1579
52 Ga0157372_10119259 3300013307 Bacteria 3028
53 Ga0157372_10320824 3300013307 Bacteria 1804
54 Ga0157372_10499752 3300013307 Bacteria 1418
55 Ga0163163_10077200 3300014325 Bacteria 3326
56 Ga0163163_10079068 3300014325 Bacteria 3286
57 Ga0157380_10095757 3300014326 Bacteria 2460
58 Ga0182008_10104590 3300014497 Bacteria 1400
59 Ga0163161_10002984 3300017792 Bacteria 11971
60 Ga0206356_10803138 3300020070 Bacteria 2012
61 Ga0206351_10435147 3300020077 Bacteria 2100
62 Ga0206352_10250241 3300020078 Bacteria 1673
63 Ga0206350_10656175 3300020080 Bacteria 2623
64 Ga0224712_10000830 3300022467 Bacteria 6559
65 Ga0224572_1007416 3300024225 Bacteria 2009
66 Ga0207692_10035299 3300025898 Bacteria 2429
67 Ga0207699_10000002 3300025906 Bacteria 662194
68 Ga0207645_10188881 3300025907 Bacteria 1353
69 Ga0207705_10038744 3300025909 Bacteria 3414
70 Ga0207663_10000024 3300025916 Bacteria 118449
71 Ga0207681_10091373 3300025923 Bacteria 2175
72 Ga0207650_10003676 3300025925 Bacteria 10488
73 Ga0207659_10015368 3300025926 Bacteria 4958
74 Ga0207659_10019857 3300025926 Bacteria 4431
75 Ga0207664_10028673 3300025929 Bacteria 4233
76 Ga0207664_10138511 3300025929 Bacteria 2056
77 Ga0207706_10018512 3300025933 Bacteria 6267
78 Ga0207665_10073278 3300025939 Bacteria 2341
79 Ga0207691_10170119 3300025940 Bacteria 1908
80 Ga0207712_10017924 3300025961 Bacteria 4608
81 Ga0207668_10086881 3300025972 Bacteria 2286
82 Ga0207658_10000776 3300025986 Bacteria 27307
83 Ga0207703_10005575 3300026035 Bacteria 10103
84 Ga0207639_10001381 3300026041 Bacteria 16383
85 Ga0207641_10049232 3300026088 Bacteria 3560
86 Ga0207641_10140714 3300026088 Unclassified 2177
87 Ga0207648_10059311 3300026089 Bacteria 3337
88 Ga0207676_10074344 3300026095 Bacteria 2737
89 Ga0207676_10147012 3300026095 Bacteria 2025
90 Ga0207676_10273616 3300026095 Bacteria 1530
91 Ga0207676_10341468 3300026095 Bacteria 1382
92 Ga0207676_10479984 3300026095 Bacteria 1177
93 Ga0207674_10319150 3300026116 Bacteria 1503
94 Ga0207675_100121926 3300026118 Bacteria 2467
95 Ga0207683_10128017 3300026121 Bacteria 2283
96 Ga0207698_10056146 3300026142 Bacteria 3039
97 Ga0207428_10085262 3300027907 Bacteria 2460
98 Ga0268264_10015772 3300028381 Bacteria 6187
99 Ga0268264_10083350 3300028381 Unclassified 2738
100 Ga0265318_10055095 3300028577 Bacteria 1489
101 Ga0265336_10051751 3300028666 Bacteria 1240
102 Ga0265320_10098220 3300031240 Bacteria 1350
103 Ga0307408_100275409 3300031548 Bacteria 1399
104 Ga0307516_10129638 3300031730 Bacteria 2303
105 Ga0307405_10074312 3300031731 Bacteria 2198
106 Ga0307405_10166304 3300031731 Bacteria 1568
107 Ga0307413_10028142 3300031824 Bacteria 3125
108 Ga0307413_10031810 3300031824 Bacteria 2982
109 Ga0307413_10071106 3300031824 Bacteria 2191
110 Ga0307413_10388443 3300031824 Bacteria 1090
111 Ga0307410_10000135 3300031852 Bacteria 26235
112 Ga0307410_10047234 3300031852 Bacteria 2876
113 Ga0307410_10085160 3300031852 Bacteria 2230
114 Ga0307406_10028582 3300031901 Bacteria 3370
115 Ga0307406_10080157 3300031901 Bacteria 2167
116 Ga0307406_10083487 3300031901 Bacteria 2130
117 Ga0307407_10053164 3300031903 Bacteria 2329
118 Ga0307412_10059048 3300031911 Bacteria 2569
119 Ga0307409_100004866 3300031995 Bacteria 7631
120 Ga0307409_100008204 3300031995 Bacteria 6319
121 Ga0307409_100262420 3300031995 Unclassified 1586
122 Ga0307409_100369889 3300031995 Bacteria 1359
123 Ga0307416_100248542 3300032002 Bacteria 1729
124 Ga0307414_10079968 3300032004 Bacteria 2389
125 Ga0307411_10017083 3300032005 Bacteria 4123
126 Ga0307411_10143260 3300032005 Bacteria 1765
127 Ga0307415_100016921 3300032126 Bacteria 4360
128 Ga0307415_100021206 3300032126 Bacteria 3988
129 Ga0307415_100177611 3300032126 Bacteria 1667
130 Ga0307415_100239777 3300032126 Bacteria 1466
131 Ga0373928_0000495 3300035084 Bacteria 7763
132 Ga0373928_0006960 3300035084 Bacteria 2179
133 Ga0373929_0010817 3300035085 Bacteria 1711
134 Ga0373932_0000164 3300035112 Bacteria 19470
135 Ga0373946_0042195 3300035171 Bacteria 1874
136 Ga0373931_0000010 3300035691 Bacteria 334069
137 Ga0373931_0000052 3300035691 Bacteria 60603
138 Ga0373927_0001998 3300035695 Bacteria 15040
139 Ga0373925_0003281 3300037068 Bacteria 12585
140 Ga0436364_1164816 3300037853 Bacteria 25233
141 Ga0395901_0608790 3300038443 Bacteria 1101
142 Ga0436361_0338158 3300039447 Bacteria 5732
143 Ga0436362_0348207 3300039453 Bacteria 2153
144 Ga0436362_0358516 3300039453 Bacteria 2094
145 Ga0453684_0011029 3300044712 Bacteria 15266
146 Ga0466957_0150738 3300044842 Bacteria 1504
147 Ga0466959_0131890 3300045049 Bacteria 1770
148 Ga0495603_0021294 3300046455 Bacteria 3926
149 Ga0495594_0015795 3300046499 Bacteria 3971
150 Ga0495628_0218443 3300046516 Bacteria 1432
151 Ga0495645_0072069 3300046543 Bacteria 2490
152 Ga0495668_0000956 3300046616 Bacteria 32070
153 Ga0495658_0016997 3300046683 Bacteria 3751
154 Ga0495672_0056571 3300047320 Bacteria 2281
155 Ga0496102_0132826 3300048905 Bacteria 2331
156 Ga0496103_0192937 3300048906 Bacteria 1310
157 Ga0496104_0045078 3300048907 Bacteria 4146
158 Ga0496105_0086628 3300048908 Bacteria 2588
159 Ga0496106_0211806 3300048909 Bacteria 1544
160 Ga0496109_0016495 3300048912 Bacteria 6458
161 Ga0496110_0131144 3300048913 Bacteria 2263
162 Ga0496114_0135105 3300048917 Bacteria 2132
163 Ga0496115_0001471 3300048918 Bacteria 16916
164 Ga0496115_0037734 3300048918 Bacteria 3830
165 Ga0501227_039748 3300049665 Bacteria 1159
166 Ga0501249_013151 3300049679 Bacteria 1757
167 Ga0501221_008770 3300049704 Bacteria 1764
168 Ga0501225_0012269 3300049705 Bacteria 2407
169 Ga0501273_004377 3300049770 Bacteria 1549
170 nmdc:mga0yw44_21494_c1 3300050492 Bacteria 3600
171 nmdc:mga0yw44_38154_c1 3300050492 Bacteria 2349
172 nmdc:mga08y16_63242_c1 3300050511 Unclassified 3865
173 nmdc:mga08x19_15_c1 3300050514 Bacteria 354290
174 nmdc:mga0a205_134929_c1 3300050515 Bacteria 2368
175 nmdc:mga0a205_243506_c1 3300050515 Unclassified 1679
176 Ga0495619_0047201 3300053085 Bacteria 2835
177 Ga0500559_0001339 3300053136 Bacteria 14135
178 Ga0500573_0032062 3300053140 Bacteria 3032
179 Ga0500577_0004601 3300053142 Bacteria 3662
180 Ga0500616_0000136 3300053153 Bacteria 126636
181 2812362057 2811994880 Bacteria 4147780
182 2848552901 2848551377 Bacteria 3720646
183 Ga0373944_0049711
184 Ga0065704_10127608
185 Ga0065707_10002942
186 Ga0070658_10032611
187 Ga0070670_100015620
188 Ga0070670_100072038
189 Ga0070661_100022735
190 Ga0070669_100115370
191 Ga0070675_100032871
192 Ga0070671_100002093
193 Ga0070671_100052913
194 Ga0070688_100047141
195 Ga0070659_100061459
196 Ga0070667_100018738
197 Ga0070713_100040912
198 Ga0070711_100000006
199 Ga0070708_100259766
200 Ga0070681_10041687
201 Ga0070698_100260949
202 Ga0070698_100454103
203 Ga0070679_100195909
204 Ga0070679_100197906
205 Ga0068853_100091783
206 Ga0068853_100108732
207 Ga0068853_100521190
208 Ga0070704_100161245
209 Ga0070664_100026726
210 Ga0068852_100041244
211 Ga0068859_100022067
212 Ga0068864_100084341
213 Ga0068861_100192876
214 Ga0068863_100079678
215 Ga0068858_100009694
216 Ga0068860_100213643
217 Ga0070717_10106812
218 Ga0075365_10068804
219 Ga0070716_100075854
220 Ga0070712_100036794
221 Ga0070712_100160019
222 Ga0075428_100094600
223 Ga0075436_100000278
224 Ga0097620_100022067
225 Ga0111539_10106053
226 Ga0105245_10133310
227 Ga0105247_10005596
228 Ga0114129_10025487
229 Ga0105249_10113925
230 Ga0105239_10201809
231 Ga0157369_10124034
232 Ga0163162_10180163
233 Ga0163162_10364075
234 Ga0157372_10119259
235 Ga0157372_10320824
236 Ga0157372_10499752
237 Ga0163163_10077200
238 Ga0163163_10079068
239 Ga0157380_10095757
240 Ga0182008_10104590
241 Ga0163161_10002984
242 Ga0206356_10803138
243 Ga0206351_10435147
244 Ga0206352_10250241
245 Ga0206350_10656175
246 Ga0224712_10000830
247 Ga0224572_1007416
248 Ga0207692_10035299
249 Ga0207699_10000002
250 Ga0207645_10188881
251 Ga0207705_10038744
252 Ga0207663_10000024
253 Ga0207681_10091373
254 Ga0207650_10003676
255 Ga0207659_10015368
256 Ga0207659_10019857
257 Ga0207664_10028673
258 Ga0207664_10138511
259 Ga0207706_10018512
260 Ga0207665_10073278
261 Ga0207691_10170119
262 Ga0207712_10017924
263 Ga0207668_10086881
264 Ga0207658_10000776
265 Ga0207703_10005575
266 Ga0207639_10001381
267 Ga0207641_10049232
268 Ga0207641_10140714
269 Ga0207648_10059311
270 Ga0207676_10074344
271 Ga0207676_10147012
272 Ga0207676_10273616
273 Ga0207676_10341468
274 Ga0207676_10479984
275 Ga0207674_10319150
276 Ga0207675_100121926
277 Ga0207683_10128017
278 Ga0207698_10056146
279 Ga0207428_10085262
280 Ga0268264_10015772
281 Ga0268264_10083350
282 Ga0265318_10055095
283 Ga0265336_10051751
284 Ga0265320_10098220
285 Ga0307408_100275409
286 Ga0307516_10129638
287 Ga0307405_10074312
288 Ga0307405_10166304
289 Ga0307413_10028142
290 Ga0307413_10031810
291 Ga0307413_10071106
292 Ga0307413_10388443
293 Ga0307410_10000135
294 Ga0307410_10047234
295 Ga0307410_10085160
296 Ga0307406_10028582
297 Ga0307406_10080157
298 Ga0307406_10083487
299 Ga0307407_10053164
300 Ga0307412_10059048
301 Ga0307409_100004866
302 Ga0307409_100008204
303 Ga0307409_100262420
304 Ga0307409_100369889
305 Ga0307416_100248542
306 Ga0307414_10079968
307 Ga0307411_10017083
308 Ga0307411_10143260
309 Ga0307415_100016921
310 Ga0307415_100021206
311 Ga0307415_100177611
312 Ga0307415_100239777
313 Ga0373928_0000495
314 Ga0373928_0006960
315 Ga0373929_0010817
316 Ga0373932_0000164
317 Ga0373946_0042195
318 Ga0373931_0000010
319 Ga0373931_0000052
320 Ga0373927_0001998
321 Ga0373925_0003281
322 Ga0436364_1164816
323 Ga0395901_0608790
324 Ga0436361_0338158
325 Ga0436362_0348207
326 Ga0436362_0358516
327 Ga0453684_0011029
328 Ga0466957_0150738
329 Ga0466959_0131890
330 Ga0495603_0021294
331 Ga0495594_0015795
332 Ga0495628_0218443
333 Ga0495645_0072069
334 Ga0495668_0000956
335 Ga0495658_0016997
336 Ga0495672_0056571
337 Ga0496102_0132826
338 Ga0496103_0192937
339 Ga0496104_0045078
340 Ga0496105_0086628
341 Ga0496106_0211806
342 Ga0496109_0016495
343 Ga0496110_0131144
344 Ga0496114_0135105
345 Ga0496115_0001471
346 Ga0496115_0037734
347 Ga0501227_039748
348 Ga0501249_013151
349 Ga0501221_008770
350 Ga0501225_0012269
351 Ga0501273_004377
352 nmdc:mga0yw44_21494_c1
353 nmdc:mga0yw44_38154_c1
354 nmdc:mga08y16_63242_c1
355 nmdc:mga08x19_15_c1
356 nmdc:mga0a205_134929_c1
357 nmdc:mga0a205_243506_c1
358 Ga0495619_0047201
359 Ga0500559_0001339
360 Ga0500573_0032062
361 Ga0500577_0004601
362 Ga0500616_0000136
363 2812362057
364 2848552901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00472

RF-1

RF-1 domain

262

373

0.91

PF03462

PCRF

PCRF domain

61

254

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6boh-assembly2.cif.gz_OC antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.9227 98 204
6boh-assembly2.cif.gz_OC antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.8914 98 204
5j30-assembly1.cif.gz_QY thermus thermophilus 70s termination complex containing e. coli rf1 0.8536 94 345
6bok-assembly2.cif.gz_HD e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.848 98 345
5o2r-assembly1.cif.gz_v cryo-em structure of the proline-rich antimicrobial peptide api137 bound to the terminating ribosome 0.847 106 345
ID Description Score Start End Superfamily
af_A0A1D6IEG8_11_112_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9923 104 204 3.30.70.1660
af_P30775_152_262_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9748 104 207 3.30.70.1660
af_A0A1D6IEG8_11_112_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9732 104 204 3.30.70.1660
af_Q54RE7_180_291_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9585 102 214 3.30.70.1660
1gqeA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9522 103 346 3.30.70.1660
ID Description Score Start End GO Terms
AF-X1A613-F1-model_v4 Peptide chain release factor domain-containing protein 0.9977 96 197 GO:0006415
AF-A0A353RCV6-F1-model_v4 Peptide chain release factor 2 0.9925 94 191 GO:0006415
AF-X1NS20-F1-model_v4 Peptide chain release factor domain-containing protein 0.976 48 204 GO:0006415
AF-X1A613-F1-model_v4 Peptide chain release factor domain-containing protein 0.9601 96 197 GO:0006415
AF-X1NS20-F1-model_v4 Peptide chain release factor domain-containing protein 0.9581 48 204 GO:0006415

Map