F279315

General Info

Members Datasets Scaffolds Average Seq Length
182 144 166 98

Family's Representative Sequence

Representative Sequence 3300028558|Ga0265326_10029220|Ga0265326_100292203
Length 109
Sequence MASRRNTKSERPSPKESFSRWDPADHLKSPSDIAAYLEACMEEAGDDPAFIAAALGDVARARGMAQLARKTGIAREGLYKALAPDGNPSLGTVLKVMKALGLKLTPKAA

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
3 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
4 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
5 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
6 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
7 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
8 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
9 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
10 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
11 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
12 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
13 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
14 2919404418 Luteibacter sp. 3190 Isolate Unclassified
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
34 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
46 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
47 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
48 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
51 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
52 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
69 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
70 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
107 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
108 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
138 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
139 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
143 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
144 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.21
Metatranscriptomes 0
Isolates 8.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 1.65
Rhizoplane 3.85
Rhizosphere 81.87
Stem 0
Stem Tuber 0
Unclassified 8.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10080820 3300005289 Bacteria 3874
2 Ga0070682_100222790 3300005337 Bacteria 1343
3 Ga0070669_101348760 3300005353 Unclassified 618
4 Ga0070674_101149246 3300005356 Unclassified 687
5 Ga0070663_100540275 3300005455 Bacteria 973
6 Ga0070678_100453524 3300005456 Bacteria 1123
7 Ga0068867_100170256 3300005459 Bacteria 1724
8 Ga0068867_102262021 3300005459 Bacteria 516
9 Ga0068855_102554639 3300005563 Unclassified 507
10 Ga0068854_100044627 3300005578 Bacteria 3148
11 Ga0075364_10440012 3300006051 Bacteria 891
12 Ga0075430_100053003 3300006846 Bacteria 3416
13 Ga0075431_100163005 3300006847 Bacteria 2292
14 Ga0105250_10016006 3300009092 Bacteria 3062
15 Ga0105240_10198482 3300009093 Bacteria 2353
16 Ga0105240_11473896 3300009093 Unclassified 714
17 Ga0105246_10959891 3300011119 Bacteria 771
18 Ga0157370_10043415 3300013104 Bacteria 4327
19 Ga0157372_11078695 3300013307 Bacteria 929
20 Ga0182008_10088367 3300014497 Bacteria 1527
21 Ga0213872_10051676 3300021361 Bacteria 1865
22 Ga0207426_1040025 3300025302 Bacteria 1463
23 Ga0207696_1008213 3300025711 Bacteria 4017
24 Ga0207655_1000175 3300025728 Bacteria 115631
25 Ga0207713_1008877 3300025735 Bacteria 5724
26 Ga0207681_11267958 3300025923 Unclassified 619
27 Ga0207694_10198836 3300025924 Bacteria 1630
28 Ga0207667_10473518 3300025949 Unclassified 1272
29 Ga0207640_10016368 3300025981 Bacteria 4313
30 Ga0207678_10658623 3300026067 Bacteria 920
31 Ga0207648_10204430 3300026089 Bacteria 1752
32 Ga0268265_10289904 3300028380 Unclassified 1469
33 Ga0265326_10029220 3300028558 Bacteria 1570
34 Ga0265319_1036908 3300028563 Bacteria 1668
35 Ga0265334_10000739 3300028573 Bacteria 16363
36 Ga0307517_10001029 3300028786 Bacteria 47353
37 Ga0265338_10038228 3300028800 Bacteria 4551
38 Ga0265338_10535318 3300028800 Unclassified 821
39 Ga0265324_10089034 3300029957 Bacteria 1050
40 Ga0265330_10023154 3300031235 Bacteria 2822
41 Ga0265328_10192695 3300031239 Bacteria 773
42 Ga0265320_10007147 3300031240 Bacteria 6960
43 Ga0265325_10013214 3300031241 Unclassified 4705
44 Ga0265331_10009289 3300031250 Bacteria 5532
45 Ga0265331_10018041 3300031250 Unclassified 3668
46 Ga0265331_10163860 3300031250 Unclassified 1007
47 Ga0265327_10008867 3300031251 Bacteria 7394
48 Ga0265316_10020322 3300031344 Bacteria 5656
49 Ga0307513_10750061 3300031456 Bacteria 682
50 Ga0307509_10001212 3300031507 Bacteria 43898
51 Ga0307408_100005150 3300031548 Bacteria 8765
52 Ga0307408_100223033 3300031548 Bacteria 1539
53 Ga0265313_10049895 3300031595 Bacteria 2011
54 Ga0265314_10110523 3300031711 Bacteria 1747
55 Ga0265342_10024805 3300031712 Plasmid 3781
56 Ga0307405_10168880 3300031731 Bacteria 1558
57 Ga0307413_11658089 3300031824 Unclassified 569
58 Ga0307412_10060851 3300031911 Bacteria 2536
59 Ga0307416_100123274 3300032002 Bacteria 2316
60 Ga0373926_0287271 3300035083 Bacteria 641
61 Ga0373943_0381020 3300035170 Unclassified 812
62 Ga0373946_0724341 3300035171 Bacteria 521
63 Ga0373924_0179826 3300035410 Bacteria 931
64 Ga0373931_0504710 3300035691 Bacteria 781
65 Ga0373935_0041833 3300035692 Bacteria 2880
66 Ga0373927_0048054 3300035695 Bacteria 2760
67 Ga0373927_0468154 3300035695 Bacteria 833
68 Ga0373933_0045997 3300035724 Bacteria 2590
69 Ga0373947_0084626 3300035725 Bacteria 1968
70 Ga0373937_0021301 3300036401 Bacteria 5818
71 Ga0373925_0053846 3300037068 Bacteria 3009
72 Ga0395900_0039957 3300037418 Bacteria 4835
73 Ga0395905_0232277 3300037471 Bacteria 1725
74 Ga0395905_0923053 3300037471 Bacteria 776
75 Ga0395901_1360068 3300038443 Bacteria 670
76 Ga0436365_0074482 3300039437 Unclassified 532
77 Ga0436361_0887500 3300039447 Bacteria 2003
78 Ga0436361_1152366 3300039447 Bacteria 848
79 Ga0436363_1471468 3300039450 Bacteria 1796
80 Ga0439436_0116422 3300041404 Bacteria 747
81 Ga0451577_0000099 3300042876 Bacteria 191842
82 Ga0451577_0000104 3300042876 Bacteria 186417
83 Ga0451577_1425050 3300042876 Bacteria 614
84 Ga0466969_0029226 3300044656 Bacteria 2815
85 Ga0453683_0068497 3300044673 Bacteria 2219
86 Ga0453683_0176989 3300044673 Bacteria 1352
87 Ga0453683_0543198 3300044673 Bacteria 756
88 Ga0466965_0088466 3300044683 Unclassified 1573
89 Ga0466966_0231947 3300044684 Unclassified 1113
90 Ga0466961_0001134 3300044693 Bacteria 16341
91 Ga0466961_0124965 3300044693 Unclassified 1614
92 Ga0466961_0228361 3300044693 Bacteria 1146
93 Ga0466963_0769356 3300044694 Unclassified 679
94 Ga0453684_0000063 3300044712 Bacteria 486079
95 Ga0453684_0000350 3300044712 Bacteria 191841
96 Ga0453684_0000364 3300044712 Bacteria 186418
97 Ga0453684_0596538 3300044712 Bacteria 1211
98 Ga0466959_0103574 3300045049 Bacteria 2036
99 Ga0451576_0250743 3300045051 Bacteria 1850
100 Ga0466958_0044350 3300045836 Bacteria 2680
101 Ga0466967_0073498 3300045976 Bacteria 3068
102 Ga0466967_0464446 3300045976 Bacteria 1238
103 Ga0495584_0409264 3300046491 Bacteria 689
104 Ga0495643_0001142 3300046522 Bacteria 26045
105 Ga0495648_0121559 3300046524 Bacteria 1403
106 Ga0495658_0043133 3300046683 Bacteria 2521
107 Ga0495683_0000043 3300047323 Bacteria 136876
108 Ga0496102_0859546 3300048905 Bacteria 829
109 Ga0496110_0080542 3300048913 Bacteria 2902
110 Ga0496114_0062755 3300048917 Bacteria 3110
111 Ga0496114_0199327 3300048917 Bacteria 1753
112 Ga0496122_0069953 3300048925 Bacteria 2510
113 Ga0496122_0541412 3300048925 Bacteria 557
114 Ga0496123_0005312 3300048926 Bacteria 13037
115 Ga0496124_0002630 3300048927 Bacteria 23089
116 Ga0496125_0081519 3300048928 Bacteria 2471
117 Ga0496126_0004377 3300048929 Bacteria 16933
118 Ga0495682_0001211 3300049460 Bacteria 14675
119 Ga0501031_0431787 3300049568 Unclassified 851
120 Ga0501032_0045581 3300049569 Bacteria 2965
121 Ga0501032_0047475 3300049569 Bacteria 2899
122 Ga0501032_0518628 3300049569 Unclassified 761
123 Ga0501033_0896902 3300049570 Unclassified 596
124 Ga0501034_0003714 3300049571 Bacteria 17237
125 Ga0501034_0135544 3300049571 Bacteria 2443
126 Ga0501036_1543167 3300049572 Bacteria 537
127 Ga0501037_0070755 3300049573 Bacteria 2538
128 Ga0501037_0304295 3300049573 Bacteria 1106
129 Ga0501037_0539831 3300049573 Unclassified 788
130 Ga0501038_0250023 3300049574 Bacteria 1405
131 Ga0501039_0083465 3300049575 Bacteria 2488
132 Ga0501043_0328333 3300049579 Bacteria 1165
133 Ga0501043_0413654 3300049579 Bacteria 1017
134 Ga0501046_0072429 3300049580 Bacteria 2675
135 Ga0501046_0209337 3300049580 Bacteria 1448
136 Ga0501047_0001415 3300049581 Bacteria 23547
137 Ga0501047_0856962 3300049581 Unclassified 722
138 Ga0501047_1284184 3300049581 Bacteria 546
139 Ga0501067_0000574 3300049583 Bacteria 19877
140 Ga0501069_0152534 3300049585 Bacteria 1328
141 Ga0501070_0001764 3300049586 Bacteria 19132
142 Ga0501070_0326108 3300049586 Unclassified 1248
143 Ga0501072_0014830 3300049588 Bacteria 5975
144 Ga0501073_0004972 3300049589 Bacteria 9978
145 Ga0501073_0144957 3300049589 Bacteria 1646
146 Ga0501073_0366668 3300049589 Unclassified 995
147 Ga0501257_217753 3300049686 Unclassified 555
148 Ga0501079_0060350 3300049741 Bacteria 2925
149 Ga0501079_0509555 3300049741 Unclassified 946
150 Ga0501080_0059482 3300049742 Bacteria 3555
151 Ga0501080_0278523 3300049742 Bacteria 1521
152 Ga0501083_0003275 3300049744 Bacteria 11310
153 Ga0501035_0943509 3300049822 Unclassified 681
154 Ga0501035_1481002 3300049822 Bacteria 518
155 Ga0501044_0499134 3300049823 Bacteria 1118
156 nmdc:mga00v17_42754_c1 3300050491 Bacteria 2726
157 nmdc:mga0yw44_469722_c1 3300050492 Bacteria 853
158 nmdc:mga06r32_1730044_c1 3300050510 Bacteria 562
159 nmdc:mga06r32_2079187_c1 3300050510 Unclassified 501
160 Ga0500647_0357879 3300053091 Bacteria 605
161 Ga0500641_0149588 3300053096 Bacteria 1008
162 Ga0500618_072404 3300053125 Bacteria 773
163 Ga0501084_0751680 3300054114 Unclassified 822
164 Ga0501082_0043792 3300060353 Bacteria 3861
165 Ga0466962_0266180 3300061719 Bacteria 844
166 Ga0466962_0292385 3300061719 Unclassified 805

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0769356 Ga0466963_0769356_423_665 78
2 3300009093 Ga0105240_10198482 Ga0105240_101984823 86
3 3300048929 Ga0496126_0004377 Ga0496126_0004377_3961_4269 86
4 iso_pu_bacteria 2919404418 2919407722 88
5 3300045976 Ga0466967_0464446 Ga0466967_0464446_299_622 89
6 iso_pu_bacteria 2593339239 2595452920 89
7 iso_pu_bacteria 2808606384 2808974233 90
8 iso_pu_bacteria 2808606390 2809009019 90
9 iso_pu_bacteria 2808606391 2809016170 90
10 iso_pu_bacteria 8020953355 8020958983 90
11 iso_pu_bacteria 8039098773 8039103992 90
12 iso_pu_bacteria 2574179768 2574429675 91
13 3300039437 Ga0436365_0074482 Ga0436365_0074482_143_421 92
14 3300044712 Ga0453684_0596538 Ga0453684_0596538_569_847 92
15 3300049568 Ga0501031_0431787 Ga0501031_0431787_418_696 92
16 3300049569 Ga0501032_0047475 Ga0501032_0047475_2411_2689 92
17 3300049573 Ga0501037_0070755 Ga0501037_0070755_2105_2383 92
18 3300049575 Ga0501039_0083465 Ga0501039_0083465_938_1216 92
19 3300049585 Ga0501069_0152534 Ga0501069_0152534_595_873 92
20 3300049586 Ga0501070_0326108 Ga0501070_0326108_658_936 92
21 3300049589 Ga0501073_0366668 Ga0501073_0366668_421_699 92
22 3300049741 Ga0501079_0060350 Ga0501079_0060350_2494_2772 92
23 3300049742 Ga0501080_0278523 Ga0501080_0278523_1091_1369 92
24 3300049460 Ga0495682_0001211 Ga0495682_0001211_580_861 93
25 iso_pu_bacteria 2599185306 2599965269 93
26 iso_pu_bacteria 2599185313 2600006916 93
27 iso_pu_bacteria 2599185324 2600070364 93
28 iso_pu_bacteria 2842324504 2842332527 93
29 iso_pu_bacteria 2842348783 2842356930 93
30 iso_pu_bacteria 2842454564 2842461394 93
31 3300005337 Ga0070682_100222790 Ga0070682_1002227901 94
32 3300005353 Ga0070669_101348760 Ga0070669_1013487602 94
33 3300005356 Ga0070674_101149246 Ga0070674_1011492462 94
34 3300005455 Ga0070663_100540275 Ga0070663_1005402752 94
35 3300005459 Ga0068867_100170256 Ga0068867_1001702564 94
36 3300005563 Ga0068855_102554639 Ga0068855_1025546392 94
37 3300005578 Ga0068854_100044627 Ga0068854_1000446272 94
38 3300006051 Ga0075364_10440012 Ga0075364_104400122 94
39 3300006846 Ga0075430_100053003 Ga0075430_1000530035 94
40 3300013104 Ga0157370_10043415 Ga0157370_100434155 94
41 3300013307 Ga0157372_11078695 Ga0157372_110786952 94
42 3300014497 Ga0182008_10088367 Ga0182008_100883672 94
43 3300025302 Ga0207426_1040025 Ga0207426_10400252 94
44 3300025923 Ga0207681_11267958 Ga0207681_112679581 94
45 3300025924 Ga0207694_10198836 Ga0207694_101988362 94
46 3300025949 Ga0207667_10473518 Ga0207667_104735183 94
47 3300025981 Ga0207640_10016368 Ga0207640_100163683 94
48 3300026067 Ga0207678_10658623 Ga0207678_106586232 94
49 3300026089 Ga0207648_10204430 Ga0207648_102044304 94
50 3300028380 Ga0268265_10289904 Ga0268265_102899043 94
51 3300028558 Ga0265326_10029220 Ga0265326_100292203 94
52 3300028563 Ga0265319_1036908 Ga0265319_10369083 94
53 3300028573 Ga0265334_10000739 Ga0265334_1000073915 94
54 3300031235 Ga0265330_10023154 Ga0265330_100231544 94
55 3300031239 Ga0265328_10192695 Ga0265328_101926952 94
56 3300031240 Ga0265320_10007147 Ga0265320_100071475 94
57 3300031241 Ga0265325_10013214 Ga0265325_100132145 94
58 3300031250 Ga0265331_10009289 Ga0265331_100092893 94
59 3300031344 Ga0265316_10020322 Ga0265316_100203226 94
60 3300031595 Ga0265313_10049895 Ga0265313_100498955 94
61 3300031712 Ga0265342_10024805 Ga0265342_100248055 94
62 3300031824 Ga0307413_11658089 Ga0307413_116580892 94
63 3300035083 Ga0373926_0287271 Ga0373926_0287271_281_568 94
64 3300035170 Ga0373943_0381020 Ga0373943_0381020_123_410 94
65 3300035171 Ga0373946_0724341 Ga0373946_0724341_59_346 94
66 3300035410 Ga0373924_0179826 Ga0373924_0179826_442_729 94
67 3300035692 Ga0373935_0041833 Ga0373935_0041833_2443_2730 94
68 3300035695 Ga0373927_0048054 Ga0373927_0048054_1021_1308 94
69 3300035724 Ga0373933_0045997 Ga0373933_0045997_2000_2287 94
70 3300035725 Ga0373947_0084626 Ga0373947_0084626_1350_1637 94
71 3300036401 Ga0373937_0021301 Ga0373937_0021301_3691_3978 94
72 3300037068 Ga0373925_0053846 Ga0373925_0053846_1744_2031 94
73 3300042876 Ga0451577_1425050 Ga0451577_1425050_215_499 94
74 3300044673 Ga0453683_0068497 Ga0453683_0068497_1498_1782 94
75 3300044673 Ga0453683_0176989 Ga0453683_0176989_184_468 94
76 3300044693 Ga0466961_0001134 Ga0466961_0001134_6119_6412 94
77 3300044712 Ga0453684_0000063 Ga0453684_0000063_27670_27960 94
78 3300045049 Ga0466959_0103574 Ga0466959_0103574_1633_1926 94
79 3300045051 Ga0451576_0250743 Ga0451576_0250743_216_500 94
80 3300045836 Ga0466958_0044350 Ga0466958_0044350_887_1180 94
81 3300045976 Ga0466967_0073498 Ga0466967_0073498_1657_1941 94
82 3300046683 Ga0495658_0043133 Ga0495658_0043133_2129_2416 94
83 3300048925 Ga0496122_0541412 Ga0496122_0541412_113_397 94
84 3300049569 Ga0501032_0045581 Ga0501032_0045581_189_473 94
85 3300049569 Ga0501032_0518628 Ga0501032_0518628_254_556 94
86 3300049570 Ga0501033_0896902 Ga0501033_0896902_104_388 94
87 3300049571 Ga0501034_0003714 Ga0501034_0003714_9693_9995 94
88 3300049571 Ga0501034_0135544 Ga0501034_0135544_718_1002 94
89 3300049572 Ga0501036_1543167 Ga0501036_1543167_75_362 94
90 3300049573 Ga0501037_0304295 Ga0501037_0304295_46_330 94
91 3300049573 Ga0501037_0539831 Ga0501037_0539831_160_462 94
92 3300049574 Ga0501038_0250023 Ga0501038_0250023_866_1150 94
93 3300049579 Ga0501043_0328333 Ga0501043_0328333_154_456 94
94 3300049579 Ga0501043_0413654 Ga0501043_0413654_267_554 94
95 3300049580 Ga0501046_0072429 Ga0501046_0072429_1323_1607 94
96 3300049580 Ga0501046_0209337 Ga0501046_0209337_960_1262 94
97 3300049581 Ga0501047_0001415 Ga0501047_0001415_16016_16318 94
98 3300049581 Ga0501047_0856962 Ga0501047_0856962_408_692 94
99 3300049581 Ga0501047_1284184 Ga0501047_1284184_215_502 94
100 3300049583 Ga0501067_0000574 Ga0501067_0000574_12340_12642 94
101 3300049586 Ga0501070_0001764 Ga0501070_0001764_11232_11534 94
102 3300049588 Ga0501072_0014830 Ga0501072_0014830_5663_5965 94
103 3300049589 Ga0501073_0004972 Ga0501073_0004972_2626_2928 94
104 3300049589 Ga0501073_0144957 Ga0501073_0144957_85_372 94
105 3300049741 Ga0501079_0509555 Ga0501079_0509555_540_842 94
106 3300049742 Ga0501080_0059482 Ga0501080_0059482_2407_2709 94
107 3300049744 Ga0501083_0003275 Ga0501083_0003275_10277_10579 94
108 3300049822 Ga0501035_0943509 Ga0501035_0943509_228_512 94
109 3300049822 Ga0501035_1481002 Ga0501035_1481002_128_415 94
110 3300049823 Ga0501044_0499134 Ga0501044_0499134_764_1066 94
111 3300050491 nmdc:mga00v17_42754_c1 nmdc:mga00v17_42754_c1_231_515 94
112 3300050492 nmdc:mga0yw44_469722_c1 nmdc:mga0yw44_469722_c1_119_403 94
113 3300050510 nmdc:mga06r32_1730044_c1 nmdc:mga06r32_1730044_c1_141_440 94
114 3300050510 nmdc:mga06r32_2079187_c1 nmdc:mga06r32_2079187_c1_127_435 94
115 3300054114 Ga0501084_0751680 Ga0501084_0751680_298_600 94
116 3300060353 Ga0501082_0043792 Ga0501082_0043792_1050_1352 94
117 3300061719 Ga0466962_0266180 Ga0466962_0266180_214_507 94
118 iso_pu_bacteria 2852657418 2852663282 94
119 iso_pu_bacteria 2895395659 2895395888 94
120 3300006847 Ga0075431_100163005 Ga0075431_1001630052 95
121 3300009093 Ga0105240_11473896 Ga0105240_114738962 95
122 3300021361 Ga0213872_10051676 Ga0213872_100516763 95
123 3300028800 Ga0265338_10535318 Ga0265338_105353181 95
124 3300029957 Ga0265324_10089034 Ga0265324_100890343 95
125 3300031250 Ga0265331_10018041 Ga0265331_100180417 95
126 3300031456 Ga0307513_10750061 Ga0307513_107500612 95
127 3300031507 Ga0307509_10001212 Ga0307509_1000121243 95
128 3300035691 Ga0373931_0504710 Ga0373931_0504710_439_726 95
129 3300035695 Ga0373927_0468154 Ga0373927_0468154_417_719 95
130 3300039447 Ga0436361_0887500 Ga0436361_0887500_1166_1453 95
131 3300041404 Ga0439436_0116422 Ga0439436_0116422_186_476 95
132 3300042876 Ga0451577_0000104 Ga0451577_0000104_89736_90023 95
133 3300044673 Ga0453683_0543198 Ga0453683_0543198_454_741 95
134 3300044712 Ga0453684_0000364 Ga0453684_0000364_96396_96683 95
135 3300005456 Ga0070678_100453524 Ga0070678_1004535242 96
136 3300005459 Ga0068867_102262021 Ga0068867_1022620212 96
137 3300011119 Ga0105246_10959891 Ga0105246_109598912 96
138 3300031250 Ga0265331_10163860 Ga0265331_101638603 96
139 3300031251 Ga0265327_10008867 Ga0265327_100088673 96
140 3300031548 Ga0307408_100005150 Ga0307408_1000051509 96
141 3300031548 Ga0307408_100223033 Ga0307408_1002230332 96
142 3300031911 Ga0307412_10060851 Ga0307412_100608511 96
143 3300032002 Ga0307416_100123274 Ga0307416_1001232743 96
144 3300037418 Ga0395900_0039957 Ga0395900_0039957_3468_3788 96
145 3300037471 Ga0395905_0923053 Ga0395905_0923053_368_688 96
146 3300038443 Ga0395901_1360068 Ga0395901_1360068_64_384 96
147 3300039447 Ga0436361_1152366 Ga0436361_1152366_26_316 96
148 3300039450 Ga0436363_1471468 Ga0436363_1471468_1361_1660 96
149 3300042876 Ga0451577_0000099 Ga0451577_0000099_178065_178361 96
150 3300044712 Ga0453684_0000350 Ga0453684_0000350_13482_13778 96
151 3300048905 Ga0496102_0859546 Ga0496102_0859546_329_628 96
152 3300048913 Ga0496110_0080542 Ga0496110_0080542_2475_2774 96
153 3300048917 Ga0496114_0199327 Ga0496114_0199327_1114_1413 96
154 3300005289 Ga0065704_10080820 Ga0065704_100808203 97
155 3300009092 Ga0105250_10016006 Ga0105250_100160063 97
156 3300025711 Ga0207696_1008213 Ga0207696_10082132 97
157 3300025728 Ga0207655_1000175 Ga0207655_100017547 97
158 3300025735 Ga0207713_1008877 Ga0207713_10088776 97
159 3300028786 Ga0307517_10001029 Ga0307517_1000102928 97
160 3300028800 Ga0265338_10038228 Ga0265338_100382281 97
161 3300031711 Ga0265314_10110523 Ga0265314_101105233 97
162 3300031731 Ga0307405_10168880 Ga0307405_101688802 97
163 3300037471 Ga0395905_0232277 Ga0395905_0232277_331_672 97
164 3300044656 Ga0466969_0029226 Ga0466969_0029226_484_786 97
165 3300044683 Ga0466965_0088466 Ga0466965_0088466_819_1115 97
166 3300044684 Ga0466966_0231947 Ga0466966_0231947_514_816 97
167 3300044693 Ga0466961_0124965 Ga0466961_0124965_622_924 97
168 3300044693 Ga0466961_0228361 Ga0466961_0228361_458_754 97
169 3300046491 Ga0495584_0409264 Ga0495584_0409264_101_394 97
170 3300046522 Ga0495643_0001142 Ga0495643_0001142_6632_6928 97
171 3300046524 Ga0495648_0121559 Ga0495648_0121559_845_1138 97
172 3300047323 Ga0495683_0000043 Ga0495683_0000043_115449_115742 97
173 3300048917 Ga0496114_0062755 Ga0496114_0062755_949_1245 97
174 3300048925 Ga0496122_0069953 Ga0496122_0069953_786_1082 97
175 3300048926 Ga0496123_0005312 Ga0496123_0005312_11313_11609 97
176 3300048927 Ga0496124_0002630 Ga0496124_0002630_17356_17661 97
177 3300048928 Ga0496125_0081519 Ga0496125_0081519_1760_2056 97
178 3300049686 Ga0501257_217753 Ga0501257_217753_108_407 97
179 3300053091 Ga0500647_0357879 Ga0500647_0357879_200_493 97
180 3300053096 Ga0500641_0149588 Ga0500641_0149588_123_521 97
181 3300053125 Ga0500618_072404 Ga0500618_072404_381_680 97
182 3300061719 Ga0466962_0292385 Ga0466962_0292385_167_463 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21716

dnstrm_HI1420

Probable addiction module antidote protein

17

108

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h4c-assembly1.cif.gz_D a polyamorous repressor: deciphering the evolutionary strategy used by the phage-inducible chromosomal islands to spread in nature. 0.8132 34 88
5woq-assembly2.cif.gz_C crystal structure of an xre family protein transcriptional regulator from mycobacterium smegmatis 0.8018 40 88
2b5a-assembly1.cif.gz_A c.bcli, control element of the bcli restriction-modification system 0.8017 37 88
1adr-assembly1.cif.gz_A determination of the nuclear magnetic resonance structure of the dna-binding domain of the p22 c2 repressor (1-76) in solution and comparison with the dna-binding domain of the 434 repressor 0.7996 37 88
1y7y-assembly1.cif.gz_B high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.7986 40 88
ID Description Score Start End Superfamily
2b5aC00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8062 37 88 1.10.260.40
2b5aB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8059 37 88 1.10.260.40
2b5aA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8017 37 88 1.10.260.40
1adrA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.7996 37 88 1.10.260.40
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.7986 40 88 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A139BPI2-F1-model_v4 Transcriptional regulator 0.9873 25 94 GO:0003677
AF-A0A5C8CFP1-F1-model_v4 Putative addiction module antidote protein 0.9849 5 93 GO:0003677
AF-A0A1I3ICE9-F1-model_v4 Probable addiction module antidote protein 0.983 1 96 GO:0003677
AF-A0A7X7QR23-F1-model_v4 Putative addiction module antidote protein 0.9802 1 93 GO:0003677
AF-A0A537M837-F1-model_v4 Putative addiction module antidote protein 0.9798 13 96 GO:0003677

Feature Viewer

pLDDT pTM Quality
91.23 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map