F276055

General Info

Members Datasets Scaffolds Average Seq Length
180 115 360 113

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0053506|Ga0466966_0053506_1951_2346
Length 131
Sequence LDIPSGIAPVDPQFEVTFMAQKHIVQLIDDIDGGEASETVSFALDGASYAIDLSDNNAAKLRDALAIYIANARRSSRGPGRPAGSGRRGRGARTDREQTQAIREWARKNGHRVGEKGRIPATILDAYNAAH

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
34 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
81 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
82 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
90 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
91 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
92 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
93 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
107 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
108 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
113 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
114 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
115 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 8.33
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.11
Nodule 0
Rhizoplane 5
Rhizosphere 82.22
Stem 0
Stem Tuber 0
Unclassified 12.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0053506 3300044684 Bacteria 2561
2 JGI24735J21928_10002999 3300002067 Bacteria 5806
3 Ga0058859_10773340 3300004798 Unclassified 815
4 Ga0070658_10950819 3300005327 Bacteria 747
5 Ga0070666_10028532 3300005335 Bacteria 3663
6 Ga0070682_100984799 3300005337 Bacteria 699
7 Ga0070682_101191040 3300005337 Unclassified 642
8 Ga0070692_10657389 3300005345 Bacteria 700
9 Ga0070668_100013317 3300005347 Bacteria 6138
10 Ga0070671_100037004 3300005355 Bacteria 4047
11 Ga0070659_100394307 3300005366 Bacteria 1168
12 Ga0070714_100000010 3300005435 Bacteria 262871
13 Ga0070714_100050157 3300005435 Bacteria 3554
14 Ga0070714_100215496 3300005435 Unclassified 1762
15 Ga0070708_101303806 3300005445 Bacteria 678
16 Ga0070706_101787421 3300005467 Bacteria 559
17 Ga0070698_100696362 3300005471 Bacteria 958
18 Ga0070665_100004373 3300005548 Bacteria 14855
19 Ga0068855_100056403 3300005563 Bacteria 4610
20 Ga0068855_100992075 3300005563 Bacteria 883
21 Ga0070664_101198972 3300005564 Bacteria 716
22 Ga0068857_101125554 3300005577 Bacteria 759
23 Ga0068856_100020640 3300005614 Bacteria 6401
24 Ga0068852_100447475 3300005616 Bacteria 1278
25 Ga0068852_100802044 3300005616 Bacteria 956
26 Ga0068859_100008695 3300005617 Bacteria 10267
27 Ga0068863_100005804 3300005841 Bacteria 12099
28 Ga0068860_100000297 3300005843 Bacteria 69029
29 Ga0070717_10000052 3300006028 Bacteria 100329
30 Ga0070717_10064611 3300006028 Unclassified 3040
31 Ga0097620_100008695 3300006931 Bacteria 10267
32 Ga0105240_10286216 3300009093 Bacteria 1891
33 Ga0105240_10586077 3300009093 Bacteria 1230
34 Ga0105247_10001689 3300009101 Bacteria 15569
35 Ga0105241_10132462 3300009174 Bacteria 2020
36 Ga0105237_10073988 3300009545 Bacteria 3398
37 Ga0105237_10217306 3300009545 Bacteria 1911
38 Ga0105237_10832403 3300009545 Bacteria 930
39 Ga0105238_10187128 3300009551 Bacteria 2047
40 Ga0105238_10213215 3300009551 Bacteria 1907
41 Ga0105238_10761528 3300009551 Bacteria 982
42 Ga0105238_11038945 3300009551 Bacteria 841
43 Ga0099796_10091587 3300010159 Unclassified 1131
44 Ga0105239_10079075 3300010375 Bacteria 3619
45 Ga0105239_10192068 3300010375 Bacteria 2285
46 Ga0105239_10593551 3300010375 Bacteria 1263
47 Ga0157321_1028049 3300012487 Bacteria 558
48 Ga0157342_1038534 3300012507 Bacteria 631
49 Ga0157370_10049896 3300013104 Bacteria 4002
50 Ga0157369_10099173 3300013105 Bacteria 3106
51 Ga0157374_10483187 3300013296 Bacteria 1242
52 Ga0157372_10000024 3300013307 Bacteria 197716
53 Ga0157372_11121131 3300013307 Unclassified 910
54 Ga0157372_13187922 3300013307 Bacteria 523
55 Ga0157379_10353797 3300014968 Bacteria 1345
56 Ga0197907_10836329 3300020069 Bacteria 1674
57 Ga0206356_10356310 3300020070 Bacteria 839
58 Ga0206349_1741735 3300020075 Bacteria 551
59 Ga0206350_10723478 3300020080 Bacteria 573
60 Ga0206354_10824002 3300020081 Bacteria 532
61 Ga0206354_11562449 3300020081 Bacteria 1369
62 Ga0206353_11085048 3300020082 Bacteria 1519
63 Ga0206353_11716242 3300020082 Bacteria 1191
64 Ga0206353_11835860 3300020082 Bacteria 539
65 Ga0213875_10046160 3300021388 Unclassified 2044
66 Ga0213875_10076299 3300021388 Bacteria 1564
67 Ga0224712_10607977 3300022467 Bacteria 534
68 Ga0207710_10002746 3300025900 Bacteria 8064
69 Ga0207680_10068603 3300025903 Bacteria 2188
70 Ga0207647_10158743 3300025904 Bacteria 1320
71 Ga0207654_10464773 3300025911 Bacteria 889
72 Ga0207695_10239062 3300025913 Bacteria 1718
73 Ga0207695_11246238 3300025913 Bacteria 624
74 Ga0207671_10180016 3300025914 Bacteria 1645
75 Ga0207694_10143805 3300025924 Bacteria 1919
76 Ga0207694_10740420 3300025924 Bacteria 830
77 Ga0207694_11610323 3300025924 Bacteria 547
78 Ga0207664_10000009 3300025929 Bacteria 299246
79 Ga0207664_10044993 3300025929 Bacteria 3459
80 Ga0207664_10718589 3300025929 Unclassified 898
81 Ga0207644_10289767 3300025931 Bacteria 1316
82 Ga0207667_11754519 3300025949 Unclassified 586
83 Ga0207668_10083032 3300025972 Bacteria 2330
84 Ga0207658_10003933 3300025986 Bacteria 10445
85 Ga0207702_10114507 3300026078 Bacteria 2403
86 Ga0207702_10844158 3300026078 Bacteria 906
87 Ga0207674_10980549 3300026116 Bacteria 814
88 Ga0268264_10000353 3300028381 Bacteria 69101
89 Ga0307513_10214069 3300031456 Bacteria 1755
90 Ga0307513_10686814 3300031456 Unclassified 730
91 Ga0436364_0301618 3300037853 Bacteria 3468
92 Ga0436364_0690083 3300037853 Bacteria 7338
93 Ga0436365_0763888 3300039437 Bacteria 1492
94 Ga0436365_1668091 3300039437 Bacteria 1305
95 Ga0436363_0027186 3300039450 Bacteria 1241
96 Ga0436363_0526495 3300039450 Unclassified 653
97 Ga0466972_0004318 3300044658 Bacteria 7103
98 Ga0466972_0126428 3300044658 Bacteria 1205
99 Ga0466972_0137251 3300044658 Bacteria 1151
100 Ga0466972_0169628 3300044658 Bacteria 1025
101 Ga0466965_0132698 3300044683 Bacteria 1292
102 Ga0466966_0048671 3300044684 Bacteria 2700
103 Ga0466966_0049115 3300044684 Bacteria 2688
104 Ga0466961_0124971 3300044693 Bacteria 1614
105 Ga0466963_0000152 3300044694 Bacteria 27762
106 Ga0466963_0030632 3300044694 Bacteria 3474
107 Ga0466963_0061756 3300044694 Bacteria 2506
108 Ga0466963_0085494 3300044694 Bacteria 2141
109 Ga0466963_0274376 3300044694 Bacteria 1185
110 Ga0466963_1139697 3300044694 Unclassified 548
111 Ga0466964_0031575 3300044706 Bacteria 2101
112 Ga0466971_0053955 3300044719 Bacteria 1811
113 Ga0466971_0200232 3300044719 Unclassified 942
114 Ga0466971_0377338 3300044719 Bacteria 689
115 Ga0466971_0597609 3300044719 Bacteria 550
116 Ga0466968_0078499 3300044735 Bacteria 1447
117 Ga0466970_0021525 3300044765 Bacteria 3358
118 Ga0466970_0216784 3300044765 Bacteria 1067
119 Ga0466970_0333856 3300044765 Bacteria 858
120 Ga0466957_0031908 3300044842 Bacteria 3151
121 Ga0466957_0181032 3300044842 Bacteria 1376
122 Ga0466960_0176040 3300044901 Bacteria 1157
123 Ga0466960_0443762 3300044901 Bacteria 753
124 Ga0466959_0145862 3300045049 Bacteria 1670
125 Ga0466959_0286586 3300045049 Bacteria 1129
126 Ga0466959_0709146 3300045049 Bacteria 674
127 Ga0466958_0001028 3300045836 Bacteria 12732
128 Ga0466958_0015834 3300045836 Bacteria 4331
129 Ga0466958_0373463 3300045836 Bacteria 919
130 Ga0466967_0003456 3300045976 Bacteria 10311
131 Ga0466967_0064848 3300045976 Bacteria 3250
132 Ga0466967_0829391 3300045976 Bacteria 918
133 Ga0466967_1384255 3300045976 Bacteria 701
134 Ga0495641_0140045 3300046461 Bacteria 1081
135 Ga0495641_0256604 3300046461 Unclassified 786
136 Ga0495668_0797096 3300046616 Unclassified 523
137 Ga0495676_0130446 3300047321 Unclassified 1815
138 Ga0496101_0159377 3300048904 Bacteria 1730
139 Ga0496102_0000029 3300048905 Bacteria 222195
140 Ga0496102_0011911 3300048905 Bacteria 7508
141 Ga0496103_0000080 3300048906 Bacteria 110513
142 Ga0496103_0008739 3300048906 Bacteria 6010
143 Ga0496103_0195033 3300048906 Bacteria 1302
144 Ga0496105_0572964 3300048908 Bacteria 879
145 Ga0496109_0103171 3300048912 Bacteria 2647
146 Ga0496113_0690079 3300048916 Unclassified 815
147 Ga0496117_0111595 3300048920 Bacteria 1702
148 Ga0496118_0043302 3300048921 Bacteria 3541
149 Ga0496118_0057162 3300048921 Bacteria 2927
150 Ga0496119_0000217 3300048922 Bacteria 82068
151 Ga0496119_0019909 3300048922 Bacteria 4917
152 Ga0496120_0020531 3300048923 Bacteria 4196
153 Ga0496126_0132374 3300048929 Bacteria 2154
154 Ga0501031_0140490 3300049568 Bacteria 1578
155 Ga0501033_0118157 3300049570 Bacteria 1926
156 Ga0501034_0027652 3300049571 Bacteria 5768
157 Ga0501038_0234867 3300049574 Bacteria 1457
158 Ga0501043_0534087 3300049579 Bacteria 873
159 Ga0501043_0712168 3300049579 Bacteria 732
160 Ga0501046_0466036 3300049580 Bacteria 907
161 Ga0501047_0047032 3300049581 Bacteria 4169
162 Ga0501047_0282917 3300049581 Bacteria 1503
163 Ga0501048_0022401 3300049582 Bacteria 4621
164 Ga0501069_0851317 3300049585 Bacteria 554
165 Ga0501070_0277778 3300049586 Bacteria 1367
166 Ga0501035_0231067 3300049822 Bacteria 1576
167 Ga0501035_0975371 3300049822 Bacteria 668
168 Ga0501044_0315787 3300049823 Bacteria 1488
169 Ga0501044_0452201 3300049823 Bacteria 1191
170 Ga0501044_0708941 3300049823 Bacteria 891
171 Ga0500562_113252 3300053108 Unclassified 739
172 Ga0500559_0008484 3300053136 Bacteria 4501
173 Ga0587084_078550 3300059477 Unclassified 635
174 Ga0587066_204201 3300059490 Unclassified 521
175 Ga0587070_202856 3300059491 Unclassified 528
176 Ga0587079_098574 3300059647 Unclassified 695
177 Ga0466962_0020991 3300061719 Bacteria 3138
178 2558908653 2558860112 Bacteria 9931328
179 2891328655 2891326441 Bacteria 6439512
180 8047719306 8047710418 Bacteria 11023148
181 Ga0466966_0053506
182 JGI24735J21928_10002999
183 Ga0058859_10773340
184 Ga0070658_10950819
185 Ga0070666_10028532
186 Ga0070682_100984799
187 Ga0070682_101191040
188 Ga0070692_10657389
189 Ga0070668_100013317
190 Ga0070671_100037004
191 Ga0070659_100394307
192 Ga0070714_100000010
193 Ga0070714_100050157
194 Ga0070714_100215496
195 Ga0070708_101303806
196 Ga0070706_101787421
197 Ga0070698_100696362
198 Ga0070665_100004373
199 Ga0068855_100056403
200 Ga0068855_100992075
201 Ga0070664_101198972
202 Ga0068857_101125554
203 Ga0068856_100020640
204 Ga0068852_100447475
205 Ga0068852_100802044
206 Ga0068859_100008695
207 Ga0068863_100005804
208 Ga0068860_100000297
209 Ga0070717_10000052
210 Ga0070717_10064611
211 Ga0097620_100008695
212 Ga0105240_10286216
213 Ga0105240_10586077
214 Ga0105247_10001689
215 Ga0105241_10132462
216 Ga0105237_10073988
217 Ga0105237_10217306
218 Ga0105237_10832403
219 Ga0105238_10187128
220 Ga0105238_10213215
221 Ga0105238_10761528
222 Ga0105238_11038945
223 Ga0099796_10091587
224 Ga0105239_10079075
225 Ga0105239_10192068
226 Ga0105239_10593551
227 Ga0157321_1028049
228 Ga0157342_1038534
229 Ga0157370_10049896
230 Ga0157369_10099173
231 Ga0157374_10483187
232 Ga0157372_10000024
233 Ga0157372_11121131
234 Ga0157372_13187922
235 Ga0157379_10353797
236 Ga0197907_10836329
237 Ga0206356_10356310
238 Ga0206349_1741735
239 Ga0206350_10723478
240 Ga0206354_10824002
241 Ga0206354_11562449
242 Ga0206353_11085048
243 Ga0206353_11716242
244 Ga0206353_11835860
245 Ga0213875_10046160
246 Ga0213875_10076299
247 Ga0224712_10607977
248 Ga0207710_10002746
249 Ga0207680_10068603
250 Ga0207647_10158743
251 Ga0207654_10464773
252 Ga0207695_10239062
253 Ga0207695_11246238
254 Ga0207671_10180016
255 Ga0207694_10143805
256 Ga0207694_10740420
257 Ga0207694_11610323
258 Ga0207664_10000009
259 Ga0207664_10044993
260 Ga0207664_10718589
261 Ga0207644_10289767
262 Ga0207667_11754519
263 Ga0207668_10083032
264 Ga0207658_10003933
265 Ga0207702_10114507
266 Ga0207702_10844158
267 Ga0207674_10980549
268 Ga0268264_10000353
269 Ga0307513_10214069
270 Ga0307513_10686814
271 Ga0436364_0301618
272 Ga0436364_0690083
273 Ga0436365_0763888
274 Ga0436365_1668091
275 Ga0436363_0027186
276 Ga0436363_0526495
277 Ga0466972_0004318
278 Ga0466972_0126428
279 Ga0466972_0137251
280 Ga0466972_0169628
281 Ga0466965_0132698
282 Ga0466966_0048671
283 Ga0466966_0049115
284 Ga0466961_0124971
285 Ga0466963_0000152
286 Ga0466963_0030632
287 Ga0466963_0061756
288 Ga0466963_0085494
289 Ga0466963_0274376
290 Ga0466963_1139697
291 Ga0466964_0031575
292 Ga0466971_0053955
293 Ga0466971_0200232
294 Ga0466971_0377338
295 Ga0466971_0597609
296 Ga0466968_0078499
297 Ga0466970_0021525
298 Ga0466970_0216784
299 Ga0466970_0333856
300 Ga0466957_0031908
301 Ga0466957_0181032
302 Ga0466960_0176040
303 Ga0466960_0443762
304 Ga0466959_0145862
305 Ga0466959_0286586
306 Ga0466959_0709146
307 Ga0466958_0001028
308 Ga0466958_0015834
309 Ga0466958_0373463
310 Ga0466967_0003456
311 Ga0466967_0064848
312 Ga0466967_0829391
313 Ga0466967_1384255
314 Ga0495641_0140045
315 Ga0495641_0256604
316 Ga0495668_0797096
317 Ga0495676_0130446
318 Ga0496101_0159377
319 Ga0496102_0000029
320 Ga0496102_0011911
321 Ga0496103_0000080
322 Ga0496103_0008739
323 Ga0496103_0195033
324 Ga0496105_0572964
325 Ga0496109_0103171
326 Ga0496113_0690079
327 Ga0496117_0111595
328 Ga0496118_0043302
329 Ga0496118_0057162
330 Ga0496119_0000217
331 Ga0496119_0019909
332 Ga0496120_0020531
333 Ga0496126_0132374
334 Ga0501031_0140490
335 Ga0501033_0118157
336 Ga0501034_0027652
337 Ga0501038_0234867
338 Ga0501043_0534087
339 Ga0501043_0712168
340 Ga0501046_0466036
341 Ga0501047_0047032
342 Ga0501047_0282917
343 Ga0501048_0022401
344 Ga0501069_0851317
345 Ga0501070_0277778
346 Ga0501035_0231067
347 Ga0501035_0975371
348 Ga0501044_0315787
349 Ga0501044_0452201
350 Ga0501044_0708941
351 Ga0500562_113252
352 Ga0500559_0008484
353 Ga0587084_078550
354 Ga0587066_204201
355 Ga0587070_202856
356 Ga0587079_098574
357 Ga0466962_0020991
358 2558908653
359 2891328655
360 8047719306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11774

Lsr2

Lsr2

19

76

0.99

PF23359

94

130

0.98

Map