F274911

General Info

Members Datasets Scaffolds Average Seq Length
180 145 360 129

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10082647|Ga0065707_100826474
Length 130
Sequence MSVALNHTIIWCSDRHRSADFFAAMYGLPEPQDLFHFRVVKLANGVSLDFADHREGPVSPQHYAMLVSEDEFTALYGRILTRGIAHWADPARTRPGEFNHNDGGRGVYFEDPDGHFLEALTVPYGGVADA

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
141 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
142 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
143 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 2928157003 Burkholderia ambifaria 566 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.78
Metatranscriptomes 1.67
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5
Nodule 0
Rhizoplane 1.11
Rhizosphere 91.11
Stem 0
Stem Tuber 0
Unclassified 12.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10082647 3300005295 Bacteria 13064
2 JGI24739J22299_10053284 3300001989 Bacteria 1299
3 rootH1_10218145 3300003323 Unclassified 2203
4 Ga0070658_10561839 3300005327 Bacteria 988
5 Ga0070676_11584109 3300005328 Bacteria 506
6 Ga0070683_100331057 3300005329 Bacteria 1450
7 Ga0070670_100326739 3300005331 Bacteria 1345
8 Ga0070670_100441693 3300005331 Bacteria 1152
9 Ga0070680_100515010 3300005336 Bacteria 1024
10 Ga0070689_101422573 3300005340 Bacteria 627
11 Ga0070692_10940748 3300005345 Bacteria 600
12 Ga0070669_100127137 3300005353 Bacteria 1951
13 Ga0070669_100997120 3300005353 Bacteria 718
14 Ga0070675_100031529 3300005354 Bacteria 4285
15 Ga0070675_100523854 3300005354 Bacteria 1070
16 Ga0070674_102011780 3300005356 Bacteria 526
17 Ga0070673_100457126 3300005364 Unclassified 1149
18 Ga0070673_100607288 3300005364 Bacteria 998
19 Ga0070659_100314903 3300005366 Bacteria 1307
20 Ga0070667_101085180 3300005367 Bacteria 748
21 Ga0070705_100127896 3300005440 Bacteria 1652
22 Ga0070705_101825941 3300005440 Bacteria 516
23 Ga0070694_100355095 3300005444 Unclassified 1137
24 Ga0070663_100598602 3300005455 Bacteria 927
25 Ga0070681_10051226 3300005458 Bacteria 4118
26 Ga0070685_11070778 3300005466 Unclassified 608
27 Ga0070706_100498543 3300005467 Bacteria 1133
28 Ga0070679_100039594 3300005530 Bacteria 4684
29 Ga0070679_101196284 3300005530 Bacteria 705
30 Ga0070684_100332332 3300005535 Bacteria 1397
31 Ga0070697_100746728 3300005536 Bacteria 865
32 Ga0068853_100457665 3300005539 Bacteria 1200
33 Ga0070672_100222013 3300005543 Bacteria 1585
34 Ga0070672_101128719 3300005543 Bacteria 697
35 Ga0070696_100383979 3300005546 Bacteria 1095
36 Ga0070665_100279261 3300005548 Bacteria 1672
37 Ga0070665_101830249 3300005548 Bacteria 613
38 Ga0070704_100885561 3300005549 Bacteria 802
39 Ga0070702_100826607 3300005615 Unclassified 719
40 Ga0068852_101020826 3300005616 Bacteria 846
41 Ga0068852_101302007 3300005616 Bacteria 748
42 Ga0068858_102246136 3300005842 Unclassified 539
43 Ga0068860_100023615 3300005843 Bacteria 5943
44 Ga0068862_100027070 3300005844 Bacteria 4824
45 Ga0081455_10001273 3300005937 Bacteria 31479
46 Ga0081539_10007930 3300005985 Bacteria 9455
47 Ga0075366_10752137 3300006195 Bacteria 606
48 Ga0068871_101438521 3300006358 Bacteria 650
49 Ga0075428_100710141 3300006844 Bacteria 1071
50 Ga0075430_100218218 3300006846 Bacteria 1582
51 Ga0075431_100016243 3300006847 Bacteria 7552
52 Ga0075433_11653869 3300006852 Bacteria 552
53 Ga0068865_101693409 3300006881 Bacteria 570
54 Ga0075436_100019426 3300006914 Bacteria 4656
55 Ga0105240_10633028 3300009093 Bacteria 1174
56 Ga0111539_10177485 3300009094 Bacteria 2488
57 Ga0111539_12207473 3300009094 Bacteria 639
58 Ga0105245_10202772 3300009098 Bacteria 1905
59 Ga0105245_10713007 3300009098 Bacteria 1037
60 Ga0105247_10921613 3300009101 Unclassified 676
61 Ga0114129_10257890 3300009147 Bacteria 2338
62 Ga0105241_12153010 3300009174 Unclassified 552
63 Ga0105248_11252513 3300009177 Unclassified 839
64 Ga0105238_10221791 3300009551 Bacteria 1867
65 Ga0105238_10623921 3300009551 Bacteria 1087
66 Ga0105249_10971005 3300009553 Unclassified 918
67 Ga0105239_10485459 3300010375 Bacteria 1404
68 Ga0163162_11074261 3300013306 Unclassified 911
69 Ga0157372_10551451 3300013307 Bacteria 1344
70 Ga0157375_10034664 3300013308 Bacteria 4810
71 Ga0157375_10516359 3300013308 Bacteria 1358
72 Ga0163163_10925887 3300014325 Bacteria 935
73 Ga0157380_10407916 3300014326 Bacteria 1291
74 Ga0157377_10624076 3300014745 Bacteria 772
75 Ga0157376_12728308 3300014969 Bacteria 534
76 Ga0206356_10749106 3300020070 Bacteria 1891
77 Ga0213874_10107618 3300021377 Bacteria 934
78 Ga0207705_10307358 3300025909 Bacteria 1217
79 Ga0207707_10002851 3300025912 Bacteria 15436
80 Ga0207707_10072146 3300025912 Bacteria 3010
81 Ga0207660_10536140 3300025917 Unclassified 951
82 Ga0207649_10419667 3300025920 Bacteria 1004
83 Ga0207652_10011707 3300025921 Bacteria 7078
84 Ga0207681_10036430 3300025923 Bacteria 3246
85 Ga0207694_10170022 3300025924 Bacteria 1764
86 Ga0207694_10628876 3300025924 Bacteria 904
87 Ga0207650_10946131 3300025925 Bacteria 732
88 Ga0207659_10231781 3300025926 Bacteria 1490
89 Ga0207659_10630098 3300025926 Bacteria 915
90 Ga0207687_10600961 3300025927 Bacteria 927
91 Ga0207687_10902268 3300025927 Bacteria 756
92 Ga0207690_10371575 3300025932 Bacteria 1134
93 Ga0207690_10489538 3300025932 Bacteria 994
94 Ga0207706_10048474 3300025933 Bacteria 3757
95 Ga0207706_10352973 3300025933 Bacteria 1278
96 Ga0207706_10426661 3300025933 Bacteria 1148
97 Ga0207669_10300444 3300025937 Bacteria 1220
98 Ga0207704_10179165 3300025938 Bacteria 1530
99 Ga0207711_10235711 3300025941 Bacteria 1677
100 Ga0207661_10086488 3300025944 Bacteria 2602
101 Ga0207661_10130099 3300025944 Bacteria 2155
102 Ga0207661_10302659 3300025944 Unclassified 1434
103 Ga0207651_10433048 3300025960 Unclassified 1125
104 Ga0207651_10964307 3300025960 Bacteria 761
105 Ga0207668_11541815 3300025972 Bacteria 600
106 Ga0207658_10991920 3300025986 Bacteria 766
107 Ga0207639_10065716 3300026041 Bacteria 2816
108 Ga0207639_11609149 3300026041 Bacteria 609
109 Ga0207678_10057460 3300026067 Bacteria 3348
110 Ga0207648_10893799 3300026089 Bacteria 829
111 Ga0207698_10269273 3300026142 Bacteria 1569
112 Ga0207428_10335841 3300027907 Bacteria 1114
113 Ga0268264_10200351 3300028381 Bacteria 1826
114 Ga0268264_11970698 3300028381 Bacteria 593
115 Ga0307513_10230510 3300031456 Bacteria 1665
116 Ga0307408_100466506 3300031548 Bacteria 1098
117 Ga0307405_10039205 3300031731 Bacteria 2861
118 Ga0307405_10583622 3300031731 Unclassified 909
119 Ga0307413_10780116 3300031824 Unclassified 801
120 Ga0307410_10228064 3300031852 Bacteria 1436
121 Ga0307406_10161155 3300031901 Bacteria 1612
122 Ga0307407_10245658 3300031903 Bacteria 1223
123 Ga0307412_10235559 3300031911 Bacteria 1412
124 Ga0307409_100186311 3300031995 Bacteria 1842
125 Ga0307409_100943467 3300031995 Unclassified 878
126 Ga0307414_10203948 3300032004 Bacteria 1611
127 Ga0307414_10252457 3300032004 Unclassified 1467
128 Ga0307411_10197640 3300032005 Bacteria 1541
129 Ga0307415_100032329 3300032126 Bacteria 3382
130 Ga0316593_10038020 3300032168 Unclassified 1592
131 Ga0316593_10047832 3300032168 Unclassified 1439
132 Ga0373927_0697583 3300035695 Unclassified 671
133 Ga0395900_0000178 3300037418 Bacteria 102491
134 Ga0395898_0000276 3300037466 Bacteria 124774
135 Ga0436363_0259973 3300039450 Bacteria 1031
136 Ga0451804_0953611 3300041463 Bacteria 691
137 Ga0451807_0257725 3300041486 Bacteria 613
138 Ga0439444_0070358 3300042437 Unclassified 748
139 Ga0466966_0000267 3300044684 Bacteria 34233
140 Ga0466961_0000056 3300044693 Bacteria 67114
141 Ga0466963_0349985 3300044694 Bacteria 1040
142 Ga0466957_0387241 3300044842 Bacteria 954
143 Ga0466957_1114314 3300044842 Bacteria 569
144 Ga0466959_0187712 3300045049 Bacteria 1443
145 Ga0466958_0040426 3300045836 Bacteria 2802
146 Ga0495638_0107174 3300046460 Bacteria 1664
147 Ga0495651_0957464 3300046462 Bacteria 521
148 Ga0495580_0938180 3300046472 Unclassified 554
149 Ga0495582_0057741 3300046473 Bacteria 2140
150 Ga0495630_0952038 3300046517 Bacteria 653
151 Ga0495586_0035691 3300046535 Bacteria 2671
152 Ga0495656_0406202 3300046615 Bacteria 713
153 Ga0495625_0033015 3300046660 Bacteria 3831
154 Ga0495625_0735743 3300046660 Bacteria 579
155 Ga0495635_0276865 3300046663 Bacteria 1128
156 Ga0495635_0411183 3300046663 Bacteria 898
157 Ga0495669_0085816 3300046684 Bacteria 1449
158 Ga0495669_0385379 3300046684 Bacteria 679
159 Ga0495675_0756214 3300047444 Bacteria 541
160 Ga0501042_0708817 3300049578 Bacteria 732
161 Ga0501047_0958225 3300049581 Bacteria 669
162 Ga0501044_0002114 3300049823 Bacteria 22843
163 nmdc:mga0k408_607304_c1 3300050493 Bacteria 645
164 nmdc:mga07m45_52921_c1 3300050496 Bacteria 2293
165 nmdc:mga07m45_53863_c2 3300050496 Bacteria 1836
166 nmdc:mga05p37_637909_c1 3300050507 Bacteria 1195
167 nmdc:mga09592_183641_c1 3300050508 Bacteria 1809
168 nmdc:mga0qj67_1101056_c1 3300050509 Bacteria 620
169 nmdc:mga06r32_150211_c1 3300050510 Bacteria 2308
170 nmdc:mga08y16_157031_c1 3300050511 Bacteria 2364
171 nmdc:mga08x19_17174_c1 3300050514 Bacteria 4424
172 Ga0495601_0140537 3300053077 Bacteria 1575
173 Ga0495619_0029657 3300053085 Bacteria 3536
174 Ga0500643_022358 3300053087 Bacteria 2036
175 Ga0500559_0399357 3300053136 Bacteria 639
176 Ga0500622_0000145 3300053156 Bacteria 75417
177 Ga0500645_037925 3300053730 Bacteria 1431
178 Ga0500645_091964 3300053730 Bacteria 860
179 Ga0466962_0072580 3300061719 Bacteria 1644
180 2928159394 2928157003 Bacteria 7522202
181 Ga0065707_10082647
182 JGI24739J22299_10053284
183 rootH1_10218145
184 Ga0070658_10561839
185 Ga0070676_11584109
186 Ga0070683_100331057
187 Ga0070670_100326739
188 Ga0070670_100441693
189 Ga0070680_100515010
190 Ga0070689_101422573
191 Ga0070692_10940748
192 Ga0070669_100127137
193 Ga0070669_100997120
194 Ga0070675_100031529
195 Ga0070675_100523854
196 Ga0070674_102011780
197 Ga0070673_100457126
198 Ga0070673_100607288
199 Ga0070659_100314903
200 Ga0070667_101085180
201 Ga0070705_100127896
202 Ga0070705_101825941
203 Ga0070694_100355095
204 Ga0070663_100598602
205 Ga0070681_10051226
206 Ga0070685_11070778
207 Ga0070706_100498543
208 Ga0070679_100039594
209 Ga0070679_101196284
210 Ga0070684_100332332
211 Ga0070697_100746728
212 Ga0068853_100457665
213 Ga0070672_100222013
214 Ga0070672_101128719
215 Ga0070696_100383979
216 Ga0070665_100279261
217 Ga0070665_101830249
218 Ga0070704_100885561
219 Ga0070702_100826607
220 Ga0068852_101020826
221 Ga0068852_101302007
222 Ga0068858_102246136
223 Ga0068860_100023615
224 Ga0068862_100027070
225 Ga0081455_10001273
226 Ga0081539_10007930
227 Ga0075366_10752137
228 Ga0068871_101438521
229 Ga0075428_100710141
230 Ga0075430_100218218
231 Ga0075431_100016243
232 Ga0075433_11653869
233 Ga0068865_101693409
234 Ga0075436_100019426
235 Ga0105240_10633028
236 Ga0111539_10177485
237 Ga0111539_12207473
238 Ga0105245_10202772
239 Ga0105245_10713007
240 Ga0105247_10921613
241 Ga0114129_10257890
242 Ga0105241_12153010
243 Ga0105248_11252513
244 Ga0105238_10221791
245 Ga0105238_10623921
246 Ga0105249_10971005
247 Ga0105239_10485459
248 Ga0163162_11074261
249 Ga0157372_10551451
250 Ga0157375_10034664
251 Ga0157375_10516359
252 Ga0163163_10925887
253 Ga0157380_10407916
254 Ga0157377_10624076
255 Ga0157376_12728308
256 Ga0206356_10749106
257 Ga0213874_10107618
258 Ga0207705_10307358
259 Ga0207707_10002851
260 Ga0207707_10072146
261 Ga0207660_10536140
262 Ga0207649_10419667
263 Ga0207652_10011707
264 Ga0207681_10036430
265 Ga0207694_10170022
266 Ga0207694_10628876
267 Ga0207650_10946131
268 Ga0207659_10231781
269 Ga0207659_10630098
270 Ga0207687_10600961
271 Ga0207687_10902268
272 Ga0207690_10371575
273 Ga0207690_10489538
274 Ga0207706_10048474
275 Ga0207706_10352973
276 Ga0207706_10426661
277 Ga0207669_10300444
278 Ga0207704_10179165
279 Ga0207711_10235711
280 Ga0207661_10086488
281 Ga0207661_10130099
282 Ga0207661_10302659
283 Ga0207651_10433048
284 Ga0207651_10964307
285 Ga0207668_11541815
286 Ga0207658_10991920
287 Ga0207639_10065716
288 Ga0207639_11609149
289 Ga0207678_10057460
290 Ga0207648_10893799
291 Ga0207698_10269273
292 Ga0207428_10335841
293 Ga0268264_10200351
294 Ga0268264_11970698
295 Ga0307513_10230510
296 Ga0307408_100466506
297 Ga0307405_10039205
298 Ga0307405_10583622
299 Ga0307413_10780116
300 Ga0307410_10228064
301 Ga0307406_10161155
302 Ga0307407_10245658
303 Ga0307412_10235559
304 Ga0307409_100186311
305 Ga0307409_100943467
306 Ga0307414_10203948
307 Ga0307414_10252457
308 Ga0307411_10197640
309 Ga0307415_100032329
310 Ga0316593_10038020
311 Ga0316593_10047832
312 Ga0373927_0697583
313 Ga0395900_0000178
314 Ga0395898_0000276
315 Ga0436363_0259973
316 Ga0451804_0953611
317 Ga0451807_0257725
318 Ga0439444_0070358
319 Ga0466966_0000267
320 Ga0466961_0000056
321 Ga0466963_0349985
322 Ga0466957_0387241
323 Ga0466957_1114314
324 Ga0466959_0187712
325 Ga0466958_0040426
326 Ga0495638_0107174
327 Ga0495651_0957464
328 Ga0495580_0938180
329 Ga0495582_0057741
330 Ga0495630_0952038
331 Ga0495586_0035691
332 Ga0495656_0406202
333 Ga0495625_0033015
334 Ga0495625_0735743
335 Ga0495635_0276865
336 Ga0495635_0411183
337 Ga0495669_0085816
338 Ga0495669_0385379
339 Ga0495675_0756214
340 Ga0501042_0708817
341 Ga0501047_0958225
342 Ga0501044_0002114
343 nmdc:mga0k408_607304_c1
344 nmdc:mga07m45_52921_c1
345 nmdc:mga07m45_53863_c2
346 nmdc:mga05p37_637909_c1
347 nmdc:mga09592_183641_c1
348 nmdc:mga0qj67_1101056_c1
349 nmdc:mga06r32_150211_c1
350 nmdc:mga08y16_157031_c1
351 nmdc:mga08x19_17174_c1
352 Ga0495601_0140537
353 Ga0495619_0029657
354 Ga0500643_022358
355 Ga0500559_0399357
356 Ga0500622_0000145
357 Ga0500645_037925
358 Ga0500645_091964
359 Ga0466962_0072580
360 2928159394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a52-assembly1.cif.gz_A oxidase chap-h1 0.9766 2 127
7wcc-assembly2.cif.gz_D-3 oxidase chap-d49l/q91c mutant 0.9704 2 123
6a52-assembly1.cif.gz_A oxidase chap-h1 0.9689 2 127
6a4z-assembly1.cif.gz_B oxidase chap 0.9644 1 123
8he6-assembly1.cif.gz_B crystal structure of a fosfomycin and bleomycin resistant protein (all3014) from anabaena/nostoc cyanobacterium at 1.70 a resolution 0.9557 1 122
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7996 58 122 3.30.720.110
5wewB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7994 1 122 3.10.180.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7936 1 122 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7902 59 118 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7875 58 122 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7X3HKR4-F1-model_v4 VOC family protein 0.9954 1 126
AF-A0A7W9UV64-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9952 60 124 GO:0016829
GO:0051213
AF-A0A3N8AKL1-F1-model_v4 deleted 0.9942 1 127
AF-A0A3N8FH24-F1-model_v4 VOC family protein 0.9931 1 127
AF-A0A4Q3G1V5-F1-model_v4 VOC family protein 0.9929 1 114

Map