F274260

General Info

Members Datasets Scaffolds Average Seq Length
179 131 358 372

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0042502|Ga0466965_0042502_932_2047
Length 354
Sequence MKDVLITGGAGFIGSHLADELLAHGYHVKVLDLLHPQVHGEGRRRPSYLDPAVELLTGDVCDKDAVRRALNGVDAVFHFAAAVGVGQSMYEVAHYTRVNNLGTAVLLEALIEKPVQRLVVASSMSLYGEGLYRRASGELADAADRTLDQLVPTPETKAPAIASVYALSKYDQERMCLMIGRAYGIPTVALRFFNAYGPRQALSNPYTGVLAIFASRLLNDSAPAIFEDGLQKRDFVSVHDVARACRLALEVDKAAGEVFNVGSGQPQTVRDIAARLSRVMGKEHIRPEILGKYRVGDIRHCFADITKARQVLGYEPQVTLDDGMAELASWLEGQAAVDRVAQASAELSKRGLTV

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
18 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
22 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
23 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
28 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
29 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
30 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
31 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
50 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
51 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
52 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
53 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
73 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
74 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
77 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
78 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
79 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
80 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
81 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
82 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
83 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
84 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
85 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
95 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
112 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
113 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
114 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
115 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
116 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
117 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
118 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
121 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
122 2738541307 Variovorax sp. GV008 Isolate Unclassified
123 2842677519 Variovorax sp. R-72495 Isolate Unclassified
124 2842747753 Variovorax sp. R-72060 Isolate Unclassified
125 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
126 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
127 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
128 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
129 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
130 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
131 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.85
Metatranscriptomes 0
Isolates 6.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.2
Nodule 1.12
Rhizoplane 1.68
Rhizosphere 74.3
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0042502 3300044683 Bacteria 2242
2 Ga0055535_1000064 3300003761 Bacteria 116295
3 Ga0055542_1000029 3300003762 Bacteria 248836
4 Ga0055537_1000350 3300003773 Bacteria 31388
5 Ga0055534_1000327 3300003784 Bacteria 31396
6 Ga0055528_1000488 3300003790 Bacteria 31396
7 Ga0065165_1039195 3300005262 Bacteria 1421
8 Ga0070658_10078917 3300005327 Bacteria 2703
9 Ga0070658_10097544 3300005327 Bacteria 2427
10 Ga0070691_10152868 3300005341 Bacteria 1184
11 Ga0070685_10000027 3300005466 Bacteria 91882
12 Ga0070679_100105124 3300005530 Bacteria 2810
13 Ga0070704_100220983 3300005549 Unclassified 1540
14 Ga0068855_100091301 3300005563 Bacteria 3513
15 Ga0068852_100218184 3300005616 Bacteria 1813
16 Ga0081538_10003178 3300005981 Bacteria 15616
17 Ga0075363_100016134 3300006048 Bacteria 3684
18 Ga0075363_100091106 3300006048 Bacteria 1678
19 Ga0075432_10011657 3300006058 Bacteria 2986
20 Ga0075362_10092298 3300006177 Bacteria 1407
21 Ga0075367_10055574 3300006178 Bacteria 2350
22 Ga0075370_10000081 3300006353 Bacteria 29152
23 Ga0075370_10002462 3300006353 Bacteria 8586
24 Ga0068865_100000064 3300006881 Bacteria 55421
25 Ga0079104_1026140 3300006946 Bacteria 1512
26 Ga0099826_10016429 3300006948 Bacteria 5590
27 Ga0105240_10010564 3300009093 Bacteria 12968
28 Ga0105238_10011702 3300009551 Bacteria 8844
29 Ga0157369_10000051 3300013105 Bacteria 165672
30 Ga0182008_10018690 3300014497 Bacteria 3587
31 Ga0182006_1032117 3300015261 Bacteria 2112
32 Ga0183362_10002 3300015683 Bacteria 1432711
33 Ga0183369_1012 3300015685 Bacteria 251554
34 Ga0213872_10020533 3300021361 Bacteria 3045
35 Ga0213876_10130802 3300021384 Bacteria 1334
36 Ga0213875_10011503 3300021388 Bacteria 4401
37 Ga0209672_100447 3300025228 Bacteria 23339
38 Ga0209147_101419 3300025229 Bacteria 8755
39 Ga0209258_100018 3300025242 Bacteria 567561
40 Ga0209148_1000030 3300025254 Bacteria 567582
41 Ga0209565_1000175 3300025263 Bacteria 81833
42 Ga0209673_1000099 3300025273 Bacteria 193248
43 Ga0209673_1006451 3300025273 Bacteria 5659
44 Ga0209675_1000054 3300025291 Bacteria 193248
45 Ga0209676_1024695 3300025292 Bacteria 1940
46 Ga0209758_1043730 3300025297 Bacteria 1646
47 Ga0207426_1009525 3300025302 Bacteria 3834
48 Ga0209051_1059495 3300025303 Bacteria 1211
49 Ga0207695_10314563 3300025913 Bacteria 1456
50 Ga0207652_10023754 3300025921 Bacteria 5082
51 Ga0207652_10207065 3300025921 Bacteria 1766
52 Ga0207704_10000084 3300025938 Bacteria 55496
53 Ga0207667_10130635 3300025949 Bacteria 2587
54 Ga0316176_1157199 3300030732 Bacteria 2627
55 Ga0314311_1092240 3300030733 Bacteria 7298
56 Ga0316178_1091591 3300030735 Bacteria 2272
57 Ga0316181_1045309 3300030744 Bacteria 3154
58 Ga0316181_1166250 3300030744 Bacteria 4425
59 Ga0316182_1127554 3300030745 Bacteria 2891
60 Ga0316182_1357217 3300030745 Bacteria 4222
61 Ga0307408_100052990 3300031548 Bacteria 2928
62 Ga0307408_100109847 3300031548 Bacteria 2116
63 Ga0307408_100161487 3300031548 Bacteria 1780
64 Ga0307408_100196996 3300031548 Bacteria 1627
65 Ga0307405_10018570 3300031731 Bacteria 3840
66 Ga0307405_10027084 3300031731 Bacteria 3318
67 Ga0307405_10059907 3300031731 Bacteria 2401
68 Ga0307405_10164321 3300031731 Bacteria 1576
69 Ga0307413_10084106 3300031824 Bacteria 2050
70 Ga0307413_10084899 3300031824 Bacteria 2042
71 Ga0307413_10090477 3300031824 Bacteria 1991
72 Ga0307410_10000647 3300031852 Bacteria 14363
73 Ga0307406_10044188 3300031901 Bacteria 2791
74 Ga0307407_10001859 3300031903 Bacteria 7943
75 Ga0307407_10096081 3300031903 Bacteria 1828
76 Ga0307412_10005763 3300031911 Bacteria 6968
77 Ga0307412_10020108 3300031911 Bacteria 4057
78 Ga0307412_10102616 3300031911 Bacteria 2025
79 Ga0307409_100003868 3300031995 Bacteria 8274
80 Ga0307409_100006041 3300031995 Bacteria 7066
81 Ga0307409_100016833 3300031995 Bacteria 4852
82 Ga0307409_100109944 3300031995 Bacteria 2309
83 Ga0307409_100221325 3300031995 Bacteria 1709
84 Ga0307416_100022114 3300032002 Bacteria 4582
85 Ga0307416_100113228 3300032002 Bacteria 2397
86 Ga0307416_100462998 3300032002 Bacteria 1323
87 Ga0307411_10003219 3300032005 Bacteria 7518
88 Ga0307411_10078197 3300032005 Bacteria 2267
89 Ga0307411_10114738 3300032005 Bacteria 1936
90 Ga0307415_100091115 3300032126 Bacteria 2207
91 Ga0395899_0155623 3300037312 Bacteria 1617
92 Ga0395900_0007457 3300037418 Bacteria 11305
93 Ga0395900_0016525 3300037418 Bacteria 7528
94 Ga0395900_0362903 3300037418 Bacteria 1419
95 Ga0395898_0034696 3300037466 Bacteria 5023
96 Ga0395898_0284210 3300037466 Bacteria 1578
97 Ga0395905_0002026 3300037471 Bacteria 23151
98 Ga0395905_0002109 3300037471 Bacteria 22602
99 Ga0395905_0019127 3300037471 Bacteria 6496
100 Ga0395905_0036722 3300037471 Bacteria 4602
101 Ga0395905_0059728 3300037471 Bacteria 3565
102 Ga0395905_0173574 3300037471 Bacteria 2024
103 Ga0395905_0254136 3300037471 Bacteria 1641
104 Ga0436364_0452882 3300037853 Bacteria 11545
105 Ga0395901_0010994 3300038443 Bacteria 9172
106 Ga0395901_0052534 3300038443 Bacteria 4235
107 Ga0395901_0101210 3300038443 Bacteria 3024
108 Ga0395901_0113253 3300038443 Bacteria 2849
109 Ga0395901_0142610 3300038443 Bacteria 2518
110 Ga0395901_0147759 3300038443 Bacteria 2470
111 Ga0436365_0156937 3300039437 Bacteria 3178
112 Ga0436365_1282234 3300039437 Bacteria 2398
113 Ga0436361_1015224 3300039447 Bacteria 3053
114 Ga0439436_0009121 3300041404 Bacteria 3043
115 Ga0439447_021673 3300041407 Bacteria 1690
116 Ga0451853_0468994 3300041512 Bacteria 2760
117 Ga0439432_003691 3300042006 Bacteria 5666
118 Ga0439432_010310 3300042006 Bacteria 3240
119 Ga0439449_0001838 3300042007 Bacteria 8355
120 Ga0439449_0004904 3300042007 Bacteria 5153
121 Ga0439452_017772 3300042010 Bacteria 1904
122 Ga0439462_0019244 3300042015 Bacteria 1776
123 Ga0450923_000636 3300042125 Bacteria 4056
124 Ga0450894_002470 3300042131 Bacteria 2483
125 Ga0450906_003292 3300042145 Bacteria 3489
126 Ga0439446_0003991 3300042156 Bacteria 3712
127 Ga0450908_003443 3300042184 Bacteria 3074
128 Ga0439434_0003640 3300042435 Bacteria 4508
129 Ga0451577_0079780 3300042876 Bacteria 2918
130 Ga0466969_0004319 3300044656 Bacteria 7562
131 Ga0466965_0025272 3300044683 Bacteria 2875
132 Ga0466966_0005797 3300044684 Bacteria 8144
133 Ga0453684_0368918 3300044712 Bacteria 1614
134 Ga0466968_0037984 3300044735 Bacteria 2022
135 Ga0466970_0003091 3300044765 Bacteria 8076
136 Ga0466959_0052667 3300045049 Bacteria 2980
137 Ga0466959_0055258 3300045049 Bacteria 2899
138 Ga0466967_0033288 3300045976 Bacteria 4361
139 Ga0466967_0258110 3300045976 Bacteria 1667
140 Ga0495642_0026102 3300046528 Bacteria 2319
141 Ga0495636_0053856 3300047318 Bacteria 1690
142 Ga0496101_0129707 3300048904 Bacteria 1914
143 Ga0496109_0064621 3300048912 Bacteria 3349
144 Ga0496111_0017787 3300048914 Bacteria 4916
145 Ga0501034_0036521 3300049571 Bacteria 4977
146 Ga0501067_0035748 3300049583 Bacteria 2759
147 Ga0501068_0064394 3300049584 Bacteria 2231
148 Ga0501069_0094439 3300049585 Bacteria 1692
149 Ga0501072_0106142 3300049588 Bacteria 2234
150 Ga0501073_0053152 3300049589 Bacteria 2836
151 Ga0501249_002780 3300049679 Bacteria 3525
152 Ga0501080_0006517 3300049742 Bacteria 10486
153 Ga0501080_0129150 3300049742 Bacteria 2340
154 Ga0501081_0215855 3300049743 Bacteria 1394
155 Ga0501083_0087007 3300049744 Bacteria 2066
156 Ga0501262_000034 3300049759 Bacteria 17713
157 Ga0501044_0000912 3300049823 Bacteria 35572
158 nmdc:mga03683_4972_c1 3300050489 Bacteria 3287
159 nmdc:mga03n38_4527_c1 3300050490 Bacteria 4623
160 nmdc:mga06z11_97112_c1 3300050494 Bacteria 1610
161 nmdc:mga07m45_4720_c1 3300050496 Bacteria 6692
162 Ga0500573_0011874 3300053140 Bacteria 4882
163 Ga0590071_001462 3300059421 Bacteria 6237
164 Ga0590071_005154 3300059421 Bacteria 3152
165 Ga0590075_005362 3300059424 Bacteria 3029
166 Ga0590077_001173 3300059426 Bacteria 6373
167 Ga0501082_0081390 3300060353 Bacteria 2794
168 Ga0530510_0076301 3300061734 Bacteria 2435
169 2523102438 2522572158 Bacteria 6514390
170 2738884321 2738541307 Bacteria 8606193
171 2842678496 2842677519 Bacteria 5615038
172 2842752409 2842747753 Bacteria 5578255
173 2842919171 2842918807 Bacteria 4289178
174 2881101298 2881101125 Bacteria 4590519
175 2919465078 2919462493 Bacteria 5817112
176 2945948630 2945945610 Bacteria 5951079
177 2945986668 2945984333 Bacteria 7358892
178 2953994553 2953994433 Bacteria 4303959
179 2954772831 2954767861 Bacteria 5535784
180 Ga0466965_0042502
181 Ga0055535_1000064
182 Ga0055542_1000029
183 Ga0055537_1000350
184 Ga0055534_1000327
185 Ga0055528_1000488
186 Ga0065165_1039195
187 Ga0070658_10078917
188 Ga0070658_10097544
189 Ga0070691_10152868
190 Ga0070685_10000027
191 Ga0070679_100105124
192 Ga0070704_100220983
193 Ga0068855_100091301
194 Ga0068852_100218184
195 Ga0081538_10003178
196 Ga0075363_100016134
197 Ga0075363_100091106
198 Ga0075432_10011657
199 Ga0075362_10092298
200 Ga0075367_10055574
201 Ga0075370_10000081
202 Ga0075370_10002462
203 Ga0068865_100000064
204 Ga0079104_1026140
205 Ga0099826_10016429
206 Ga0105240_10010564
207 Ga0105238_10011702
208 Ga0157369_10000051
209 Ga0182008_10018690
210 Ga0182006_1032117
211 Ga0183362_10002
212 Ga0183369_1012
213 Ga0213872_10020533
214 Ga0213876_10130802
215 Ga0213875_10011503
216 Ga0209672_100447
217 Ga0209147_101419
218 Ga0209258_100018
219 Ga0209148_1000030
220 Ga0209565_1000175
221 Ga0209673_1000099
222 Ga0209673_1006451
223 Ga0209675_1000054
224 Ga0209676_1024695
225 Ga0209758_1043730
226 Ga0207426_1009525
227 Ga0209051_1059495
228 Ga0207695_10314563
229 Ga0207652_10023754
230 Ga0207652_10207065
231 Ga0207704_10000084
232 Ga0207667_10130635
233 Ga0316176_1157199
234 Ga0314311_1092240
235 Ga0316178_1091591
236 Ga0316181_1045309
237 Ga0316181_1166250
238 Ga0316182_1127554
239 Ga0316182_1357217
240 Ga0307408_100052990
241 Ga0307408_100109847
242 Ga0307408_100161487
243 Ga0307408_100196996
244 Ga0307405_10018570
245 Ga0307405_10027084
246 Ga0307405_10059907
247 Ga0307405_10164321
248 Ga0307413_10084106
249 Ga0307413_10084899
250 Ga0307413_10090477
251 Ga0307410_10000647
252 Ga0307406_10044188
253 Ga0307407_10001859
254 Ga0307407_10096081
255 Ga0307412_10005763
256 Ga0307412_10020108
257 Ga0307412_10102616
258 Ga0307409_100003868
259 Ga0307409_100006041
260 Ga0307409_100016833
261 Ga0307409_100109944
262 Ga0307409_100221325
263 Ga0307416_100022114
264 Ga0307416_100113228
265 Ga0307416_100462998
266 Ga0307411_10003219
267 Ga0307411_10078197
268 Ga0307411_10114738
269 Ga0307415_100091115
270 Ga0395899_0155623
271 Ga0395900_0007457
272 Ga0395900_0016525
273 Ga0395900_0362903
274 Ga0395898_0034696
275 Ga0395898_0284210
276 Ga0395905_0002026
277 Ga0395905_0002109
278 Ga0395905_0019127
279 Ga0395905_0036722
280 Ga0395905_0059728
281 Ga0395905_0173574
282 Ga0395905_0254136
283 Ga0436364_0452882
284 Ga0395901_0010994
285 Ga0395901_0052534
286 Ga0395901_0101210
287 Ga0395901_0113253
288 Ga0395901_0142610
289 Ga0395901_0147759
290 Ga0436365_0156937
291 Ga0436365_1282234
292 Ga0436361_1015224
293 Ga0439436_0009121
294 Ga0439447_021673
295 Ga0451853_0468994
296 Ga0439432_003691
297 Ga0439432_010310
298 Ga0439449_0001838
299 Ga0439449_0004904
300 Ga0439452_017772
301 Ga0439462_0019244
302 Ga0450923_000636
303 Ga0450894_002470
304 Ga0450906_003292
305 Ga0439446_0003991
306 Ga0450908_003443
307 Ga0439434_0003640
308 Ga0451577_0079780
309 Ga0466969_0004319
310 Ga0466965_0025272
311 Ga0466966_0005797
312 Ga0453684_0368918
313 Ga0466968_0037984
314 Ga0466970_0003091
315 Ga0466959_0052667
316 Ga0466959_0055258
317 Ga0466967_0033288
318 Ga0466967_0258110
319 Ga0495642_0026102
320 Ga0495636_0053856
321 Ga0496101_0129707
322 Ga0496109_0064621
323 Ga0496111_0017787
324 Ga0501034_0036521
325 Ga0501067_0035748
326 Ga0501068_0064394
327 Ga0501069_0094439
328 Ga0501072_0106142
329 Ga0501073_0053152
330 Ga0501249_002780
331 Ga0501080_0006517
332 Ga0501080_0129150
333 Ga0501081_0215855
334 Ga0501083_0087007
335 Ga0501262_000034
336 Ga0501044_0000912
337 nmdc:mga03683_4972_c1
338 nmdc:mga03n38_4527_c1
339 nmdc:mga06z11_97112_c1
340 nmdc:mga07m45_4720_c1
341 Ga0500573_0011874
342 Ga0590071_001462
343 Ga0590071_005154
344 Ga0590075_005362
345 Ga0590077_001173
346 Ga0501082_0081390
347 Ga0530510_0076301
348 2523102438
349 2738884321
350 2842678496
351 2842752409
352 2842919171
353 2881101298
354 2919465078
355 2945948630
356 2945986668
357 2953994553
358 2954772831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

4

262

0.91

PF05368

NmrA

NmrA-like family

4

121

0.89

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

5

327

0.84

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

4

124

0.82

PF08659

KR

KR domain

3

153

0.79

PF07993

NAD_binding_4

Male sterility protein

6

245

0.73

PF13460

NAD_binding_10

NAD(P)H-binding

8

152

0.73

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

5

287

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kv9-assembly1.cif.gz_A-2 moee5 in complex with udp-glucuronic acid and nad 0.9392 5 351
6kvc-assembly1.cif.gz_A-2 moee5 in complex with udp-glucose and nad 0.9331 5 351
6kv9-assembly1.cif.gz_A-2 moee5 in complex with udp-glucuronic acid and nad 0.924 5 351
6kvc-assembly1.cif.gz_A-2 moee5 in complex with udp-glucose and nad 0.9151 5 351
3vps-assembly2.cif.gz_B structure of a novel nad dependent-ndp-hexosamine 5,6-dehydratase, tuna, involved in tunicamycin biosynthesis 0.9146 4 357
ID Description Score Start End Superfamily
af_L7N670_2_342_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9196 6 347 3.40.50.720
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9128 171 349 3.40.50.720
af_L7N670_2_342_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9126 6 347 3.40.50.720
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9115 4 281 3.40.50.720
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9072 4 281 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A537M5A6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9888 188 373
AF-A0A1E4AFP6-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9874 3 373
AF-A0A1E4AFP6-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9848 3 373
AF-A0A537M5A6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9835 188 373
AF-A0A538M237-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9827 3 373

Map