F268806

General Info

Members Datasets Scaffolds Average Seq Length
176 117 352 183

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0210351|Ga0451576_0210351_1222_1830
Length 202
Sequence MISFNSVNCLYHIPIKDIILNFIPTSLPGVLLVEPKVFQDERGFFLESYQKKNFSEAGIPFDFVQDNHSKSCQGVLRGLHYQIKQPQGKLLRVASGEIFDVAVDIRKSSPTFGKWFGTYLSAENKRMLWVPVGFAHGFYVTSPEAELLYKATDYYAPEWERSILWNDPALDIPWPLQGGAPSLSARDQAGSLLSQSEIFEEL

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
81 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
82 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
83 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
96 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
97 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
98 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
99 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 0
Rhizosphere 93.18
Stem 0
Stem Tuber 0
Unclassified 10.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0210351 3300045051 Bacteria 2031
2 SwRhRL3b_contig_2585758 2162886006 Unclassified 3551
3 SwRhRL3b_contig_4261063 2162886006 Unclassified 3466
4 JGI25406J46586_10000664 3300003203 Bacteria 16016
5 Ga0065704_10076365 3300005289 Bacteria 5146
6 Ga0065704_10458225 3300005289 Bacteria 699
7 Ga0065707_10084462 3300005295 Bacteria 7174
8 Ga0065707_10095291 3300005295 Bacteria 3395
9 Ga0065707_10111434 3300005295 Unclassified 2395
10 Ga0070676_10118826 3300005328 Bacteria 1656
11 Ga0070690_100005240 3300005330 Bacteria 7266
12 Ga0068869_100008093 3300005334 Bacteria 6761
13 Ga0070689_100016452 3300005340 Bacteria 5413
14 Ga0070689_100517182 3300005340 Bacteria 1024
15 Ga0070691_10038144 3300005341 Bacteria 2268
16 Ga0070691_10050318 3300005341 Bacteria 1988
17 Ga0070674_100208536 3300005356 Bacteria 1513
18 Ga0070701_10119403 3300005438 Bacteria 1483
19 Ga0070694_100268340 3300005444 Bacteria 1297
20 Ga0070694_100638482 3300005444 Unclassified 861
21 Ga0070678_100185123 3300005456 Bacteria 1708
22 Ga0068867_100517346 3300005459 Bacteria 1028
23 Ga0070706_100089566 3300005467 Bacteria 2853
24 Ga0070698_100050943 3300005471 Bacteria 4218
25 Ga0070699_101186499 3300005518 Bacteria 700
26 Ga0070697_100811322 3300005536 Bacteria 828
27 Ga0068853_100201100 3300005539 Bacteria 1813
28 Ga0068853_100520910 3300005539 Bacteria 1124
29 Ga0070686_100001500 3300005544 Bacteria 13119
30 Ga0070686_100578153 3300005544 Bacteria 882
31 Ga0070695_100116467 3300005545 Bacteria 1822
32 Ga0070695_100651850 3300005545 Bacteria 831
33 Ga0070693_100344589 3300005547 Bacteria 1018
34 Ga0070704_100060029 3300005549 Bacteria 2716
35 Ga0070704_100105334 3300005549 Bacteria 2135
36 Ga0070704_100555235 3300005549 Bacteria 1004
37 Ga0068857_101010658 3300005577 Bacteria 801
38 Ga0070702_100003313 3300005615 Bacteria 7186
39 Ga0068859_100007750 3300005617 Bacteria 10900
40 Ga0068864_100827062 3300005618 Bacteria 911
41 Ga0068866_10083859 3300005718 Bacteria 1718
42 Ga0068861_100002831 3300005719 Bacteria 11407
43 Ga0068870_10152419 3300005840 Bacteria 1363
44 Ga0068870_10207046 3300005840 Bacteria 1192
45 Ga0068858_100022854 3300005842 Bacteria 5833
46 Ga0068862_100064780 3300005844 Bacteria 3146
47 Ga0081539_10003286 3300005985 Bacteria 20260
48 Ga0075427_10000958 3300006194 Bacteria 3564
49 Ga0097621_100181559 3300006237 Bacteria 1818
50 Ga0068871_100001992 3300006358 Bacteria 13825
51 Ga0075428_100071204 3300006844 Bacteria 3800
52 Ga0075428_100172725 3300006844 Bacteria 2342
53 Ga0075430_100344292 3300006846 Bacteria 1231
54 Ga0075431_100033448 3300006847 Bacteria 5298
55 Ga0075431_100205257 3300006847 Bacteria 2015
56 Ga0075431_100904021 3300006847 Bacteria 852
57 Ga0075433_10799334 3300006852 Bacteria 824
58 Ga0075433_10982630 3300006852 Bacteria 735
59 Ga0075429_100029504 3300006880 Bacteria 4764
60 Ga0075429_100168757 3300006880 Unclassified 1917
61 Ga0075429_100194018 3300006880 Bacteria 1779
62 Ga0075429_100385231 3300006880 Bacteria 1227
63 Ga0068865_100116885 3300006881 Bacteria 1976
64 Ga0097620_100007750 3300006931 Bacteria 10900
65 Ga0111539_10220837 3300009094 Bacteria 2207
66 Ga0105245_10000503 3300009098 Bacteria 35833
67 Ga0114129_10008354 3300009147 Bacteria 14757
68 Ga0114129_10009191 3300009147 Bacteria 14090
69 Ga0114129_10094811 3300009147 Bacteria 4134
70 Ga0114129_10239032 3300009147 Unclassified 2442
71 Ga0114129_10310784 3300009147 Bacteria 2098
72 Ga0114129_11454357 3300009147 Bacteria 844
73 Ga0114129_11479312 3300009147 Unclassified 835
74 Ga0105243_10003257 3300009148 Bacteria 13213
75 Ga0105242_10004193 3300009176 Bacteria 11239
76 Ga0105242_10357519 3300009176 Bacteria 1351
77 Ga0105248_10113571 3300009177 Bacteria 3055
78 Ga0105249_10010761 3300009553 Bacteria 8038
79 Ga0105246_10143966 3300011119 Bacteria 1796
80 Ga0157374_10122669 3300013296 Bacteria 2509
81 Ga0157378_10129946 3300013297 Bacteria 2331
82 Ga0157378_10129963 3300013297 Bacteria 2331
83 Ga0163162_10154636 3300013306 Bacteria 2413
84 Ga0157380_10019402 3300014326 Bacteria 5067
85 Ga0157380_10541354 3300014326 Bacteria 1140
86 Ga0157379_10049475 3300014968 Bacteria 3753
87 Ga0213874_10216679 3300021377 Unclassified 694
88 Ga0209129_1045057 3300025258 Bacteria 687
89 Ga0207643_10155831 3300025908 Bacteria 1372
90 Ga0207646_10389546 3300025922 Bacteria 1259
91 Ga0207687_10009290 3300025927 Bacteria 6431
92 Ga0207700_10253207 3300025928 Bacteria 1505
93 Ga0207686_11173962 3300025934 Bacteria 628
94 Ga0207670_10008393 3300025936 Bacteria 5830
95 Ga0207704_10456270 3300025938 Bacteria 1021
96 Ga0207711_10314943 3300025941 Bacteria 1445
97 Ga0207689_10003415 3300025942 Bacteria 14498
98 Ga0207712_10729242 3300025961 Bacteria 867
99 Ga0207677_10610927 3300026023 Bacteria 958
100 Ga0207639_10163370 3300026041 Bacteria 1879
101 Ga0207708_10021032 3300026075 Bacteria 4923
102 Ga0207648_10041274 3300026089 Bacteria 4052
103 Ga0207676_10601630 3300026095 Bacteria 1056
104 Ga0207674_10462734 3300026116 Bacteria 1226
105 Ga0207675_100004569 3300026118 Bacteria 13354
106 Ga0207683_10246359 3300026121 Bacteria 1630
107 Ga0207428_10202124 3300027907 Bacteria 1495
108 Ga0268265_10016538 3300028380 Bacteria 5071
109 Ga0265326_10038132 3300028558 Bacteria 1366
110 Ga0265323_10001427 3300028653 Bacteria 11756
111 Ga0265323_10031643 3300028653 Bacteria 1965
112 Ga0265322_10035462 3300028654 Bacteria 1421
113 Ga0265336_10059560 3300028666 Bacteria 1146
114 Ga0265340_10016815 3300031247 Bacteria 3783
115 Ga0265316_10035196 3300031344 Bacteria 4060
116 Ga0265316_10207253 3300031344 Bacteria 1451
117 Ga0316576_10243603 3300031727 Bacteria 1350
118 Ga0307405_10228472 3300031731 Bacteria 1370
119 Ga0307410_10060434 3300031852 Bacteria 2590
120 Ga0307407_10061715 3300031903 Unclassified 2192
121 Ga0307412_10428196 3300031911 Bacteria 1084
122 Ga0307416_100527070 3300032002 Bacteria 1251
123 Ga0307415_101047701 3300032126 Bacteria 761
124 Ga0373954_0017518 3300035118 Bacteria 3219
125 Ga0316584_0034888 3300036712 Bacteria 3731
126 Ga0400484_15048 3300038725 Bacteria 2630
127 Ga0400490_37632 3300038726 Bacteria 1997
128 Ga0400488_41622 3300038741 Bacteria 2526
129 Ga0400488_53457 3300038741 Bacteria 17602
130 Ga0400483_117260 3300039062 Bacteria 2103
131 Ga0400483_289536 3300039062 Bacteria 1234
132 Ga0400489_26707 3300039093 Bacteria 2224
133 Ga0400489_84981 3300039093 Bacteria 1516
134 Ga0451577_0000472 3300042876 Bacteria 69166
135 Ga0451577_0306799 3300042876 Bacteria 1438
136 Ga0451577_0818796 3300042876 Unclassified 841
137 Ga0451577_1049806 3300042876 Bacteria 730
138 Ga0453683_0006921 3300044673 Bacteria 7733
139 Ga0453683_0078380 3300044673 Unclassified 2069
140 Ga0453683_0416115 3300044673 Bacteria 867
141 Ga0453684_0000263 3300044712 Bacteria 226494
142 Ga0453684_0012708 3300044712 Bacteria 13824
143 Ga0453684_0122717 3300044712 Bacteria 3133
144 Ga0453684_0188427 3300044712 Unclassified 2415
145 Ga0453684_0238723 3300044712 Bacteria 2093
146 Ga0453684_1618104 3300044712 Unclassified 664
147 Ga0451576_0030469 3300045051 Bacteria 5766
148 Ga0451576_0047522 3300045051 Bacteria 4512
149 Ga0451576_0222423 3300045051 Bacteria 1971
150 Ga0451576_0271097 3300045051 Unclassified 1774
151 Ga0451576_0275391 3300045051 Unclassified 1759
152 Ga0451576_0731232 3300045051 Unclassified 1040
153 Ga0495592_0299332 3300046454 Bacteria 1046
154 Ga0496125_0575563 3300048928 Bacteria 619
155 Ga0501031_0590785 3300049568 Bacteria 715
156 Ga0501039_0615299 3300049575 Bacteria 851
157 Ga0501075_0143739 3300049591 Bacteria 1818
158 Ga0501076_0051448 3300049592 Bacteria 3261
159 Ga0501081_0165534 3300049743 Bacteria 1595
160 Ga0501083_0282978 3300049744 Bacteria 1079
161 nmdc:mga05p37_302651_c1 3300050507 Bacteria 1899
162 nmdc:mga05p37_45905_c1 3300050507 Bacteria 5373
163 nmdc:mga05p37_5146_c1 3300050507 Bacteria 14995
164 nmdc:mga05p37_58726_c1 3300050507 Bacteria 3797
165 nmdc:mga05p37_6183_c1 3300050507 Bacteria 14094
166 nmdc:mga09592_113460_c1 3300050508 Unclassified 2326
167 nmdc:mga09592_163888_c1 3300050508 Unclassified 1921
168 nmdc:mga09592_2125_c1 3300050508 Bacteria 16003
169 nmdc:mga0qj67_268837_c1 3300050509 Bacteria 1382
170 nmdc:mga0qj67_41206_c1 3300050509 Unclassified 3631
171 nmdc:mga06r32_308797_c1 3300050510 Bacteria 1567
172 nmdc:mga06r32_89659_c1 3300050510 Bacteria 3003
173 nmdc:mga08y16_475203_c1 3300050511 Bacteria 1272
174 nmdc:mga08y16_820317_c1 3300050511 Bacteria 922
175 Ga0500562_033222 3300053108 Bacteria 1363
176 Ga0501084_0121755 3300054114 Bacteria 2194
177 Ga0451576_0210351
178 SwRhRL3b_contig_2585758
179 SwRhRL3b_contig_4261063
180 JGI25406J46586_10000664
181 Ga0065704_10076365
182 Ga0065704_10458225
183 Ga0065707_10084462
184 Ga0065707_10095291
185 Ga0065707_10111434
186 Ga0070676_10118826
187 Ga0070690_100005240
188 Ga0068869_100008093
189 Ga0070689_100016452
190 Ga0070689_100517182
191 Ga0070691_10038144
192 Ga0070691_10050318
193 Ga0070674_100208536
194 Ga0070701_10119403
195 Ga0070694_100268340
196 Ga0070694_100638482
197 Ga0070678_100185123
198 Ga0068867_100517346
199 Ga0070706_100089566
200 Ga0070698_100050943
201 Ga0070699_101186499
202 Ga0070697_100811322
203 Ga0068853_100201100
204 Ga0068853_100520910
205 Ga0070686_100001500
206 Ga0070686_100578153
207 Ga0070695_100116467
208 Ga0070695_100651850
209 Ga0070693_100344589
210 Ga0070704_100060029
211 Ga0070704_100105334
212 Ga0070704_100555235
213 Ga0068857_101010658
214 Ga0070702_100003313
215 Ga0068859_100007750
216 Ga0068864_100827062
217 Ga0068866_10083859
218 Ga0068861_100002831
219 Ga0068870_10152419
220 Ga0068870_10207046
221 Ga0068858_100022854
222 Ga0068862_100064780
223 Ga0081539_10003286
224 Ga0075427_10000958
225 Ga0097621_100181559
226 Ga0068871_100001992
227 Ga0075428_100071204
228 Ga0075428_100172725
229 Ga0075430_100344292
230 Ga0075431_100033448
231 Ga0075431_100205257
232 Ga0075431_100904021
233 Ga0075433_10799334
234 Ga0075433_10982630
235 Ga0075429_100029504
236 Ga0075429_100168757
237 Ga0075429_100194018
238 Ga0075429_100385231
239 Ga0068865_100116885
240 Ga0097620_100007750
241 Ga0111539_10220837
242 Ga0105245_10000503
243 Ga0114129_10008354
244 Ga0114129_10009191
245 Ga0114129_10094811
246 Ga0114129_10239032
247 Ga0114129_10310784
248 Ga0114129_11454357
249 Ga0114129_11479312
250 Ga0105243_10003257
251 Ga0105242_10004193
252 Ga0105242_10357519
253 Ga0105248_10113571
254 Ga0105249_10010761
255 Ga0105246_10143966
256 Ga0157374_10122669
257 Ga0157378_10129946
258 Ga0157378_10129963
259 Ga0163162_10154636
260 Ga0157380_10019402
261 Ga0157380_10541354
262 Ga0157379_10049475
263 Ga0213874_10216679
264 Ga0209129_1045057
265 Ga0207643_10155831
266 Ga0207646_10389546
267 Ga0207687_10009290
268 Ga0207700_10253207
269 Ga0207686_11173962
270 Ga0207670_10008393
271 Ga0207704_10456270
272 Ga0207711_10314943
273 Ga0207689_10003415
274 Ga0207712_10729242
275 Ga0207677_10610927
276 Ga0207639_10163370
277 Ga0207708_10021032
278 Ga0207648_10041274
279 Ga0207676_10601630
280 Ga0207674_10462734
281 Ga0207675_100004569
282 Ga0207683_10246359
283 Ga0207428_10202124
284 Ga0268265_10016538
285 Ga0265326_10038132
286 Ga0265323_10001427
287 Ga0265323_10031643
288 Ga0265322_10035462
289 Ga0265336_10059560
290 Ga0265340_10016815
291 Ga0265316_10035196
292 Ga0265316_10207253
293 Ga0316576_10243603
294 Ga0307405_10228472
295 Ga0307410_10060434
296 Ga0307407_10061715
297 Ga0307412_10428196
298 Ga0307416_100527070
299 Ga0307415_101047701
300 Ga0373954_0017518
301 Ga0316584_0034888
302 Ga0400484_15048
303 Ga0400490_37632
304 Ga0400488_41622
305 Ga0400488_53457
306 Ga0400483_117260
307 Ga0400483_289536
308 Ga0400489_26707
309 Ga0400489_84981
310 Ga0451577_0000472
311 Ga0451577_0306799
312 Ga0451577_0818796
313 Ga0451577_1049806
314 Ga0453683_0006921
315 Ga0453683_0078380
316 Ga0453683_0416115
317 Ga0453684_0000263
318 Ga0453684_0012708
319 Ga0453684_0122717
320 Ga0453684_0188427
321 Ga0453684_0238723
322 Ga0453684_1618104
323 Ga0451576_0030469
324 Ga0451576_0047522
325 Ga0451576_0222423
326 Ga0451576_0271097
327 Ga0451576_0275391
328 Ga0451576_0731232
329 Ga0495592_0299332
330 Ga0496125_0575563
331 Ga0501031_0590785
332 Ga0501039_0615299
333 Ga0501075_0143739
334 Ga0501076_0051448
335 Ga0501081_0165534
336 Ga0501083_0282978
337 nmdc:mga05p37_302651_c1
338 nmdc:mga05p37_45905_c1
339 nmdc:mga05p37_5146_c1
340 nmdc:mga05p37_58726_c1
341 nmdc:mga05p37_6183_c1
342 nmdc:mga09592_113460_c1
343 nmdc:mga09592_163888_c1
344 nmdc:mga09592_2125_c1
345 nmdc:mga0qj67_268837_c1
346 nmdc:mga0qj67_41206_c1
347 nmdc:mga06r32_308797_c1
348 nmdc:mga06r32_89659_c1
349 nmdc:mga08y16_475203_c1
350 nmdc:mga08y16_820317_c1
351 Ga0500562_033222
352 Ga0501084_0121755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

24

195

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.976 2 181
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.9724 2 181
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9709 2 181
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9709 2 177
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.968 2 178
ID Description Score Start End Superfamily
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9721 2 181 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9642 2 181 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9564 2 181 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9538 2 181 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9477 1 177 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A432R1U7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9974 44 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7C8XNS0-F1-model_v4 deleted 0.9935 43 167
AF-A0A850R3L1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9928 42 174 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1F0F8S9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9902 28 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A432R1U7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9902 44 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map