F266852

General Info

Members Datasets Scaffolds Average Seq Length
175 137 175 119

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0174447|Ga0466959_0174447_504_884
Length 126
Sequence MQFDYPFHFDGRGHTARTDEDEHLRDMIEQVLFTSPGERVNRPTFGCGLLRLIFAPNSDALAAATQLTVQGSLQQWLGDLIQVETVEVSNDDSTLRVLVQYVIRRTQQRQVAQFSSAGPLSGGAVL

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
81 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
82 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
83 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
94 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
95 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
96 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
97 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
121 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
122 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
123 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
132 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
133 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 0.57
Rhizosphere 96.57
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10518492 3300005289 Unclassified 655
2 Ga0065707_10669655 3300005295 Bacteria 654
3 Ga0070683_101621547 3300005329 Bacteria 622
4 Ga0070670_100029904 3300005331 Bacteria 4691
5 Ga0070682_100350214 3300005337 Bacteria 1101
6 Ga0068868_100266537 3300005338 Bacteria 1446
7 Ga0070689_100390562 3300005340 Bacteria 1174
8 Ga0070689_101463944 3300005340 Bacteria 618
9 Ga0070692_10400661 3300005345 Bacteria 866
10 Ga0070675_102124019 3300005354 Bacteria 518
11 Ga0070674_100104011 3300005356 Bacteria 2074
12 Ga0070667_100521677 3300005367 Bacteria 1090
13 Ga0070710_10021164 3300005437 Bacteria 3385
14 Ga0070705_100424000 3300005440 Bacteria 991
15 Ga0070700_100000193 3300005441 Bacteria 34477
16 Ga0070700_100639519 3300005441 Bacteria 839
17 Ga0070708_100000237 3300005445 Bacteria 40825
18 Ga0070663_100502284 3300005455 Bacteria 1007
19 Ga0070678_100773012 3300005456 Bacteria 870
20 Ga0070662_100021765 3300005457 Bacteria 4381
21 Ga0068867_100009576 3300005459 Bacteria 6830
22 Ga0068867_102049096 3300005459 Unclassified 541
23 Ga0070706_100004834 3300005467 Bacteria 12903
24 Ga0070698_100001354 3300005471 Bacteria 27238
25 Ga0070699_100537152 3300005518 Bacteria 1064
26 Ga0070684_100100996 3300005535 Bacteria 2577
27 Ga0070684_100530767 3300005535 Bacteria 1091
28 Ga0070672_100854625 3300005543 Viruses 802
29 Ga0070672_101206360 3300005543 Bacteria 674
30 Ga0070686_100000080 3300005544 Bacteria 70371
31 Ga0070686_100084679 3300005544 Bacteria 2107
32 Ga0070696_100557262 3300005546 Unclassified 919
33 Ga0070693_100358456 3300005547 Bacteria 1000
34 Ga0068857_100060298 3300005577 Bacteria 3370
35 Ga0068856_100047909 3300005614 Bacteria 4210
36 Ga0068864_100001094 3300005618 Bacteria 22718
37 Ga0068864_101686245 3300005618 Bacteria 638
38 Ga0068870_10001396 3300005840 Bacteria 9746
39 Ga0068870_10016048 3300005840 Bacteria 3570
40 Ga0068858_101394920 3300005842 Bacteria 690
41 Ga0068860_102317840 3300005843 Bacteria 557
42 Ga0070712_100539164 3300006175 Unclassified 982
43 Ga0075428_100009802 3300006844 Bacteria 10647
44 Ga0075428_100509590 3300006844 Bacteria 1287
45 Ga0075431_100453276 3300006847 Bacteria 1278
46 Ga0075431_100945912 3300006847 Bacteria 830
47 Ga0075436_100064655 3300006914 Unclassified 2529
48 Ga0097620_101671219 3300006931 Bacteria 703
49 Ga0075435_100554663 3300007076 Bacteria 995
50 Ga0111539_10254068 3300009094 Bacteria 2047
51 Ga0111539_10445793 3300009094 Bacteria 1507
52 Ga0114129_10039842 3300009147 Bacteria 6627
53 Ga0114129_10264214 3300009147 Bacteria 2305
54 Ga0105243_10731961 3300009148 Bacteria 968
55 Ga0105241_10505947 3300009174 Bacteria 1078
56 Ga0105242_11849508 3300009176 Bacteria 643
57 Ga0105237_10925110 3300009545 Bacteria 879
58 Ga0105249_10197638 3300009553 Bacteria 1966
59 Ga0105249_10668789 3300009553 Bacteria 1097
60 Ga0105249_11310196 3300009553 Bacteria 796
61 Ga0105239_10648948 3300010375 Bacteria 1205
62 Ga0105246_10007619 3300011119 Bacteria 6640
63 Ga0105246_10406897 3300011119 Bacteria 1131
64 Ga0157371_10361900 3300013102 Bacteria 1057
65 Ga0157372_11770155 3300013307 Bacteria 711
66 Ga0157375_11839807 3300013308 Bacteria 718
67 Ga0163163_10123336 3300014325 Bacteria 2626
68 Ga0163163_10802447 3300014325 Bacteria 1005
69 Ga0163163_10909056 3300014325 Unclassified 944
70 Ga0157380_10006759 3300014326 Bacteria 8106
71 Ga0157380_10254093 3300014326 Bacteria 1593
72 Ga0157377_10464352 3300014745 Bacteria 877
73 Ga0157376_10213822 3300014969 Bacteria 1782
74 Ga0163161_10250490 3300017792 Bacteria 1380
75 Ga0163161_11028052 3300017792 Bacteria 705
76 Ga0213876_10000053 3300021384 Bacteria 142404
77 Ga0213875_10019570 3300021388 Bacteria 3257
78 Ga0207643_10005051 3300025908 Bacteria 7065
79 Ga0207643_10015698 3300025908 Bacteria 4124
80 Ga0207684_10039886 3300025910 Bacteria 3981
81 Ga0207693_10171851 3300025915 Bacteria 1706
82 Ga0207650_10021490 3300025925 Bacteria 4560
83 Ga0207687_10141374 3300025927 Bacteria 1826
84 Ga0207706_10013511 3300025933 Bacteria 7421
85 Ga0207709_10473642 3300025935 Bacteria 972
86 Ga0207670_10242208 3300025936 Bacteria 1390
87 Ga0207669_10117732 3300025937 Bacteria 1796
88 Ga0207661_10126725 3300025944 Bacteria 2181
89 Ga0207661_11296915 3300025944 Bacteria 669
90 Ga0207679_10251423 3300025945 Bacteria 1503
91 Ga0207712_10220830 3300025961 Bacteria 1515
92 Ga0207712_10444288 3300025961 Bacteria 1098
93 Ga0207708_10001354 3300026075 Bacteria 18401
94 Ga0207702_10476544 3300026078 Bacteria 1214
95 Ga0207641_10424947 3300026088 Bacteria 1280
96 Ga0207648_10013672 3300026089 Bacteria 7536
97 Ga0207676_10003048 3300026095 Bacteria 11958
98 Ga0207676_10186684 3300026095 Bacteria 1820
99 Ga0207674_10239240 3300026116 Bacteria 1762
100 Ga0207674_10880881 3300026116 Bacteria 863
101 Ga0207683_10919358 3300026121 Bacteria 812
102 Ga0207683_11013836 3300026121 Bacteria 770
103 Ga0268266_11595408 3300028379 Bacteria 628
104 Ga0307408_100006007 3300031548 Bacteria 8080
105 Ga0316579_10067759 3300031691 Bacteria 1687
106 Ga0316576_10001638 3300031727 Bacteria 12252
107 Ga0316578_10008647 3300031728 Bacteria 5193
108 Ga0316577_10133951 3300031733 Bacteria 1394
109 Ga0307413_10130957 3300031824 Bacteria 1717
110 Ga0307410_10540682 3300031852 Unclassified 964
111 Ga0307410_10950008 3300031852 Unclassified 739
112 Ga0307406_10207272 3300031901 Bacteria 1448
113 Ga0307407_10205445 3300031903 Unclassified 1323
114 Ga0307409_100342293 3300031995 Unclassified 1408
115 Ga0307409_100382845 3300031995 Bacteria 1338
116 Ga0307416_100149446 3300032002 Bacteria 2140
117 Ga0307416_101629296 3300032002 Bacteria 750
118 Ga0307416_102127546 3300032002 Unclassified 663
119 Ga0307416_103487851 3300032002 Unclassified 526
120 Ga0307414_10272754 3300032004 Unclassified 1418
121 Ga0307411_10154556 3300032005 Bacteria 1710
122 Ga0307411_10250761 3300032005 Bacteria 1392
123 Ga0307415_100147912 3300032126 Bacteria 1804
124 Ga0307415_100727757 3300032126 Bacteria 898
125 Ga0316583_10156095 3300032133 Bacteria 794
126 Ga0373940_0163737 3300035088 Bacteria 715
127 Ga0373941_0029730 3300035115 Bacteria 1614
128 Ga0316574_0744751 3300035398 Unclassified 599
129 Ga0316574_0920075 3300035398 Bacteria 529
130 Ga0316582_0008965 3300036647 Bacteria 5404
131 Ga0316584_0273720 3300036712 Bacteria 1228
132 Ga0395899_0111453 3300037312 Bacteria 1967
133 Ga0395898_0020341 3300037466 Bacteria 6740
134 Ga0395898_0084064 3300037466 Unclassified 3068
135 Ga0395898_1814948 3300037466 Bacteria 531
136 Ga0395905_0128408 3300037471 Bacteria 2384
137 Ga0316581_0056290 3300037588 Bacteria 1205
138 Ga0436364_1106918 3300037853 Bacteria 16271
139 Ga0395901_0006372 3300038443 Bacteria 11959
140 Ga0395901_0135852 3300038443 Bacteria 2585
141 Ga0436365_0873465 3300039437 Bacteria 246686
142 Ga0436360_0264450 3300039438 Bacteria 565
143 Ga0436361_0931955 3300039447 Unclassified 607
144 Ga0451577_0004967 3300042876 Bacteria 13809
145 Ga0453684_0000055 3300044712 Bacteria 532014
146 Ga0466959_0174447 3300045049 Bacteria 1507
147 Ga0496113_0656435 3300048916 Bacteria 839
148 Ga0501305_102772 3300049161 Bacteria 534
149 Ga0501037_0293279 3300049573 Bacteria 1131
150 Ga0501038_0222488 3300049574 Bacteria 1505
151 Ga0501041_0291544 3300049577 Bacteria 1028
152 Ga0501042_0292224 3300049578 Bacteria 1177
153 Ga0501043_0139950 3300049579 Bacteria 1895
154 Ga0501048_0146529 3300049582 Bacteria 1670
155 Ga0501075_0134962 3300049591 Bacteria 1880
156 Ga0501207_045067 3300049654 Bacteria 776
157 Ga0501224_055228 3300049664 Bacteria 613
158 Ga0501235_147886 3300049669 Unclassified 606
159 Ga0501234_094085 3300049707 Bacteria 540
160 Ga0501079_0332411 3300049741 Bacteria 1190
161 Ga0501081_1230296 3300049743 Bacteria 567
162 Ga0501268_173819 3300049765 Viruses 509
163 Ga0501035_0021700 3300049822 Bacteria 5904
164 nmdc:mga05p37_807063_c1 3300050507 Unclassified 1026
165 nmdc:mga05p37_823684_c1 3300050507 Bacteria 1012
166 nmdc:mga06r32_1144756_c1 3300050510 Bacteria 726
167 nmdc:mga06r32_1999083_c1 3300050510 Bacteria 513
168 nmdc:mga0a205_660684_c1 3300050515 Unclassified 896
169 Ga0500568_0024107 3300053139 Bacteria 2579
170 Ga0590071_000640 3300059421 Bacteria 9939
171 Ga0590074_000359 3300059423 Bacteria 6382
172 Ga0590075_000087 3300059424 Bacteria 23864
173 Ga0590077_000216 3300059426 Bacteria 16594
174 Ga0501082_0454070 3300060353 Bacteria 1120
175 Ga0530510_0249823 3300061734 Bacteria 1322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005456 Ga0070678_100773012 Ga0070678_1007730122 107
2 3300026121 Ga0207683_10919358 Ga0207683_109193582 107
3 3300028379 Ga0268266_11595408 Ga0268266_115954082 107
4 3300049664 Ga0501224_055228 Ga0501224_055228_194_529 109
5 3300005356 Ga0070674_100104011 Ga0070674_1001040112 116
6 3300005367 Ga0070667_100521677 Ga0070667_1005216772 116
7 3300005440 Ga0070705_100424000 Ga0070705_1004240003 116
8 3300005455 Ga0070663_100502284 Ga0070663_1005022842 116
9 3300005457 Ga0070662_100021765 Ga0070662_1000217655 116
10 3300005459 Ga0068867_100009576 Ga0068867_1000095769 116
11 3300005459 Ga0068867_102049096 Ga0068867_1020490962 116
12 3300005577 Ga0068857_100060298 Ga0068857_1000602986 116
13 3300005840 Ga0068870_10016048 Ga0068870_100160482 116
14 3300005842 Ga0068858_101394920 Ga0068858_1013949202 116
15 3300009094 Ga0111539_10445793 Ga0111539_104457932 116
16 3300009174 Ga0105241_10505947 Ga0105241_105059471 116
17 3300009553 Ga0105249_10197638 Ga0105249_101976382 116
18 3300009553 Ga0105249_11310196 Ga0105249_113101962 116
19 3300010375 Ga0105239_10648948 Ga0105239_106489483 116
20 3300011119 Ga0105246_10007619 Ga0105246_100076193 116
21 3300013308 Ga0157375_11839807 Ga0157375_118398071 116
22 3300014325 Ga0163163_10802447 Ga0163163_108024472 116
23 3300014326 Ga0157380_10006759 Ga0157380_100067592 116
24 3300017792 Ga0163161_10250490 Ga0163161_102504902 116
25 3300017792 Ga0163161_11028052 Ga0163161_110280522 116
26 3300025908 Ga0207643_10005051 Ga0207643_100050514 116
27 3300025933 Ga0207706_10013511 Ga0207706_100135119 116
28 3300025937 Ga0207669_10117732 Ga0207669_101177322 116
29 3300025961 Ga0207712_10220830 Ga0207712_102208302 116
30 3300026089 Ga0207648_10013672 Ga0207648_100136729 116
31 3300026095 Ga0207676_10186684 Ga0207676_101866842 116
32 3300026116 Ga0207674_10239240 Ga0207674_102392402 116
33 3300026121 Ga0207683_11013836 Ga0207683_110138361 116
34 3300035398 Ga0316574_0744751 Ga0316574_0744751_192_557 116
35 3300039447 Ga0436361_0931955 Ga0436361_0931955_130_483 117
36 3300005289 Ga0065704_10518492 Ga0065704_105184922 118
37 3300005295 Ga0065707_10669655 Ga0065707_106696552 118
38 3300005329 Ga0070683_101621547 Ga0070683_1016215472 118
39 3300005331 Ga0070670_100029904 Ga0070670_1000299046 118
40 3300005337 Ga0070682_100350214 Ga0070682_1003502142 118
41 3300005338 Ga0068868_100266537 Ga0068868_1002665372 118
42 3300005340 Ga0070689_100390562 Ga0070689_1003905622 118
43 3300005340 Ga0070689_101463944 Ga0070689_1014639441 118
44 3300005345 Ga0070692_10400661 Ga0070692_104006612 118
45 3300005354 Ga0070675_102124019 Ga0070675_1021240191 118
46 3300005437 Ga0070710_10021164 Ga0070710_100211646 118
47 3300005441 Ga0070700_100000193 Ga0070700_10000019331 118
48 3300005441 Ga0070700_100639519 Ga0070700_1006395192 118
49 3300005445 Ga0070708_100000237 Ga0070708_10000023714 118
50 3300005467 Ga0070706_100004834 Ga0070706_1000048346 118
51 3300005471 Ga0070698_100001354 Ga0070698_10000135410 118
52 3300005518 Ga0070699_100537152 Ga0070699_1005371522 118
53 3300005535 Ga0070684_100100996 Ga0070684_1001009962 118
54 3300005535 Ga0070684_100530767 Ga0070684_1005307672 118
55 3300005543 Ga0070672_100854625 Ga0070672_1008546252 118
56 3300005543 Ga0070672_101206360 Ga0070672_1012063602 118
57 3300005544 Ga0070686_100000080 Ga0070686_1000000809 118
58 3300005544 Ga0070686_100084679 Ga0070686_1000846794 118
59 3300005546 Ga0070696_100557262 Ga0070696_1005572622 118
60 3300005547 Ga0070693_100358456 Ga0070693_1003584561 118
61 3300005614 Ga0068856_100047909 Ga0068856_1000479097 118
62 3300005618 Ga0068864_100001094 Ga0068864_1000010948 118
63 3300005618 Ga0068864_101686245 Ga0068864_1016862451 118
64 3300005840 Ga0068870_10001396 Ga0068870_100013965 118
65 3300005843 Ga0068860_102317840 Ga0068860_1023178402 118
66 3300006175 Ga0070712_100539164 Ga0070712_1005391642 118
67 3300006844 Ga0075428_100009802 Ga0075428_1000098025 118
68 3300006844 Ga0075428_100509590 Ga0075428_1005095902 118
69 3300006847 Ga0075431_100453276 Ga0075431_1004532762 118
70 3300006847 Ga0075431_100945912 Ga0075431_1009459122 118
71 3300006914 Ga0075436_100064655 Ga0075436_1000646552 118
72 3300006931 Ga0097620_101671219 Ga0097620_1016712192 118
73 3300007076 Ga0075435_100554663 Ga0075435_1005546632 118
74 3300009094 Ga0111539_10254068 Ga0111539_102540682 118
75 3300009147 Ga0114129_10039842 Ga0114129_100398424 118
76 3300009147 Ga0114129_10264214 Ga0114129_102642142 118
77 3300009148 Ga0105243_10731961 Ga0105243_107319612 118
78 3300009176 Ga0105242_11849508 Ga0105242_118495081 118
79 3300009545 Ga0105237_10925110 Ga0105237_109251102 118
80 3300009553 Ga0105249_10668789 Ga0105249_106687893 118
81 3300011119 Ga0105246_10406897 Ga0105246_104068973 118
82 3300013102 Ga0157371_10361900 Ga0157371_103619002 118
83 3300013307 Ga0157372_11770155 Ga0157372_117701552 118
84 3300014325 Ga0163163_10123336 Ga0163163_101233364 118
85 3300014325 Ga0163163_10909056 Ga0163163_109090562 118
86 3300014326 Ga0157380_10254093 Ga0157380_102540932 118
87 3300014745 Ga0157377_10464352 Ga0157377_104643521 118
88 3300014969 Ga0157376_10213822 Ga0157376_102138222 118
89 3300021384 Ga0213876_10000053 Ga0213876_1000005319 118
90 3300021388 Ga0213875_10019570 Ga0213875_100195705 118
91 3300025908 Ga0207643_10015698 Ga0207643_100156983 118
92 3300025910 Ga0207684_10039886 Ga0207684_100398864 118
93 3300025915 Ga0207693_10171851 Ga0207693_101718512 118
94 3300025925 Ga0207650_10021490 Ga0207650_100214902 118
95 3300025927 Ga0207687_10141374 Ga0207687_101413744 118
96 3300025935 Ga0207709_10473642 Ga0207709_104736422 118
97 3300025936 Ga0207670_10242208 Ga0207670_102422082 118
98 3300025944 Ga0207661_10126725 Ga0207661_101267252 118
99 3300025944 Ga0207661_11296915 Ga0207661_112969152 118
100 3300025945 Ga0207679_10251423 Ga0207679_102514232 118
101 3300025961 Ga0207712_10444288 Ga0207712_104442882 118
102 3300026075 Ga0207708_10001354 Ga0207708_1000135415 118
103 3300026078 Ga0207702_10476544 Ga0207702_104765442 118
104 3300026088 Ga0207641_10424947 Ga0207641_104249472 118
105 3300026095 Ga0207676_10003048 Ga0207676_100030485 118
106 3300026116 Ga0207674_10880881 Ga0207674_108808812 118
107 3300031548 Ga0307408_100006007 Ga0307408_1000060077 118
108 3300031691 Ga0316579_10067759 Ga0316579_100677592 118
109 3300031727 Ga0316576_10001638 Ga0316576_1000163812 118
110 3300031728 Ga0316578_10008647 Ga0316578_100086473 118
111 3300031733 Ga0316577_10133951 Ga0316577_101339512 118
112 3300031824 Ga0307413_10130957 Ga0307413_101309573 118
113 3300031852 Ga0307410_10540682 Ga0307410_105406822 118
114 3300031852 Ga0307410_10950008 Ga0307410_109500081 118
115 3300031901 Ga0307406_10207272 Ga0307406_102072723 118
116 3300031903 Ga0307407_10205445 Ga0307407_102054452 118
117 3300031995 Ga0307409_100342293 Ga0307409_1003422932 118
118 3300031995 Ga0307409_100382845 Ga0307409_1003828452 118
119 3300032002 Ga0307416_100149446 Ga0307416_1001494462 118
120 3300032002 Ga0307416_101629296 Ga0307416_1016292962 118
121 3300032002 Ga0307416_102127546 Ga0307416_1021275461 118
122 3300032002 Ga0307416_103487851 Ga0307416_1034878511 118
123 3300032004 Ga0307414_10272754 Ga0307414_102727542 118
124 3300032005 Ga0307411_10154556 Ga0307411_101545562 118
125 3300032005 Ga0307411_10250761 Ga0307411_102507612 118
126 3300032126 Ga0307415_100147912 Ga0307415_1001479123 118
127 3300032126 Ga0307415_100727757 Ga0307415_1007277572 118
128 3300032133 Ga0316583_10156095 Ga0316583_101560952 118
129 3300035088 Ga0373940_0163737 Ga0373940_0163737_45_407 118
130 3300035115 Ga0373941_0029730 Ga0373941_0029730_503_865 118
131 3300035398 Ga0316574_0920075 Ga0316574_0920075_85_441 118
132 3300036647 Ga0316582_0008965 Ga0316582_0008965_4383_4739 118
133 3300036712 Ga0316584_0273720 Ga0316584_0273720_593_949 118
134 3300037312 Ga0395899_0111453 Ga0395899_0111453_113_475 118
135 3300037466 Ga0395898_0020341 Ga0395898_0020341_657_1019 118
136 3300037466 Ga0395898_0084064 Ga0395898_0084064_2199_2564 118
137 3300037466 Ga0395898_1814948 Ga0395898_1814948_108_467 118
138 3300037471 Ga0395905_0128408 Ga0395905_0128408_1653_2015 118
139 3300037588 Ga0316581_0056290 Ga0316581_0056290_152_508 118
140 3300037853 Ga0436364_1106918 Ga0436364_1106918_9755_10114 118
141 3300038443 Ga0395901_0006372 Ga0395901_0006372_4725_5087 118
142 3300038443 Ga0395901_0135852 Ga0395901_0135852_897_1253 118
143 3300039437 Ga0436365_0873465 Ga0436365_0873465_89334_89696 118
144 3300039438 Ga0436360_0264450 Ga0436360_0264450_148_513 118
145 3300042876 Ga0451577_0004967 Ga0451577_0004967_12762_13118 118
146 3300044712 Ga0453684_0000055 Ga0453684_0000055_231194_231550 118
147 3300045049 Ga0466959_0174447 Ga0466959_0174447_504_884 118
148 3300048916 Ga0496113_0656435 Ga0496113_0656435_328_690 118
149 3300049161 Ga0501305_102772 Ga0501305_102772_19_381 118
150 3300049573 Ga0501037_0293279 Ga0501037_0293279_668_1024 118
151 3300049574 Ga0501038_0222488 Ga0501038_0222488_181_537 118
152 3300049577 Ga0501041_0291544 Ga0501041_0291544_615_986 118
153 3300049578 Ga0501042_0292224 Ga0501042_0292224_523_894 118
154 3300049579 Ga0501043_0139950 Ga0501043_0139950_401_757 118
155 3300049582 Ga0501048_0146529 Ga0501048_0146529_481_852 118
156 3300049591 Ga0501075_0134962 Ga0501075_0134962_1301_1672 118
157 3300049654 Ga0501207_045067 Ga0501207_045067_116_478 118
158 3300049669 Ga0501235_147886 Ga0501235_147886_154_516 118
159 3300049707 Ga0501234_094085 Ga0501234_094085_72_434 118
160 3300049741 Ga0501079_0332411 Ga0501079_0332411_627_983 118
161 3300049743 Ga0501081_1230296 Ga0501081_1230296_151_522 118
162 3300049765 Ga0501268_173819 Ga0501268_173819_76_438 118
163 3300049822 Ga0501035_0021700 Ga0501035_0021700_2662_3018 118
164 3300050507 nmdc:mga05p37_807063_c1 nmdc:mga05p37_807063_c1_614_970 118
165 3300050507 nmdc:mga05p37_823684_c1 nmdc:mga05p37_823684_c1_392_751 118
166 3300050510 nmdc:mga06r32_1144756_c1 nmdc:mga06r32_1144756_c1_280_639 118
167 3300050510 nmdc:mga06r32_1999083_c1 nmdc:mga06r32_1999083_c1_125_490 118
168 3300050515 nmdc:mga0a205_660684_c1 nmdc:mga0a205_660684_c1_439_804 118
169 3300053139 Ga0500568_0024107 Ga0500568_0024107_603_959 118
170 3300059421 Ga0590071_000640 Ga0590071_000640_6494_6859 118
171 3300059423 Ga0590074_000359 Ga0590074_000359_764_1129 118
172 3300059424 Ga0590075_000087 Ga0590075_000087_22745_23110 118
173 3300059426 Ga0590077_000216 Ga0590077_000216_2998_3363 118
174 3300060353 Ga0501082_0454070 Ga0501082_0454070_530_886 118
175 3300061734 Ga0530510_0249823 Ga0530510_0249823_235_591 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04965

GPW_gp25

Baseplate wedge protein gp25

18

108

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j7m-assembly2.cif.gz_N complex structure of the pseudomonas aeruginosa rhamnosyltransferase earp with the acceptor elongation factor ef-p 0.8605 83 118
2ia7-assembly1.cif.gz_A crystal structure of putative tail lysozyme (np_952040.1) from geobacter sulfurreducens at 1.44 a resolution 0.8536 15 118
6j7m-assembly1.cif.gz_M complex structure of the pseudomonas aeruginosa rhamnosyltransferase earp with the acceptor elongation factor ef-p 0.8507 83 118
6rji-assembly1.cif.gz_A x-ray structure of the elongation factor p of s. aureus 0.8415 81 115
6kzq-assembly1.cif.gz_A structure of ptp-meg2 and nsf-py83 peptide complex 0.8394 85 117
ID Description Score Start End Superfamily
af_A0A0P0V197_32_95_3.10.450.700 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9259 80 117 3.10.450.700
af_I1JVU1_64_124_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9 81 114 2.30.30.30
af_Q8R4E6_55_250_3.30.2450.30 Alpha Beta;2-Layer Sandwich;Secreted effector protein pipB2 fold; 0.8972 81 118 3.30.2450.30
af_P06864_732_1002_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8867 81 103 2.70.98.10
af_A0A1D6L8D5_102_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8724 81 115 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A4R7ZWG3-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9689 2 118
AF-A0A1P8YPY5-F1-model_v4 Lysozyme family protein 0.9686 21 116
AF-A4YW46-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9673 2 118
AF-A0A7C3GT18-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9669 1 118
AF-A0A844ZL85-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9642 2 117

Feature Viewer

pLDDT pTM Quality
90.06 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map