F266729

General Info

Members Datasets Scaffolds Average Seq Length
175 135 350 135

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0324678|Ga0395905_0324678_452_916
Length 154
Sequence MRWWIAGRTTRKDEEKTVGHPHFTIAYWCVFIVCMLPFGCAYIAKSAGLGKSRKLGGFDNADPRAWLAKQTDWQARANSAQANTFEALPFFIGAVIIAHQLGAAQGVVDILAIVFVTLRIIYVAMYVAGLPTVRSGIWVLALAVNIGILFAGYR

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
15 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
25 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
26 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
40 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
42 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
43 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
44 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
45 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
49 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
50 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
62 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
63 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
64 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
65 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
66 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
67 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
68 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
69 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
70 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
71 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
72 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
73 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
74 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
75 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
76 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
77 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
78 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
79 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
80 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
97 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
98 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
99 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
100 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
101 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
102 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
103 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
104 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
105 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
113 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
121 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
122 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
123 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
124 2643221570 Acidovorax sp. Root568 Isolate Unclassified
125 2643221596 Acidovorax sp. Root70 Isolate Unclassified
126 2643221609 Acidovorax sp. Root217 Isolate Unclassified
127 2643221611 Acidovorax sp. Root219 Isolate Unclassified
128 2643221652 Acidovorax sp. Root402 Isolate Unclassified
129 2738543012 Acidovorax sp. CF301 Isolate Unclassified
130 2816332133 Acidovorax radicis 2721A Isolate Unclassified
131 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
132 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
133 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
134 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
135 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.14
Metatranscriptomes 0
Isolates 6.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.86
Nodule 0.57
Rhizoplane 1.14
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0324678 3300037471 Bacteria 1429
2 LJQas_1014526 3300000549 Bacteria 924
3 Ga0055540_1005714 3300003792 Bacteria 5137
4 Ga0055531_10001100 3300003794 Bacteria 21101
5 Ga0065707_10375822 3300005295 Bacteria 882
6 Ga0068869_101314836 3300005334 Bacteria 638
7 Ga0068868_100020836 3300005338 Bacteria 4934
8 Ga0068868_100121417 3300005338 Bacteria 2132
9 Ga0068868_101942922 3300005338 Bacteria 558
10 Ga0070659_101801459 3300005366 Bacteria 548
11 Ga0068855_101033583 3300005563 Bacteria 862
12 Ga0068855_101924291 3300005563 Bacteria 599
13 Ga0068856_100212129 3300005614 Bacteria 1952
14 Ga0068864_100774932 3300005618 Bacteria 941
15 Ga0068858_101663082 3300005842 Bacteria 630
16 Ga0075364_10011971 3300006051 Bacteria 5288
17 Ga0075432_10065967 3300006058 Bacteria 1295
18 Ga0075362_10303500 3300006177 Bacteria 792
19 Ga0075370_10148781 3300006353 Bacteria 1372
20 Ga0105240_11573879 3300009093 Bacteria 688
21 Ga0105245_10571237 3300009098 Bacteria 1154
22 Ga0105245_11093826 3300009098 Bacteria 843
23 Ga0105241_10133645 3300009174 Bacteria 2011
24 Ga0105242_10000374 3300009176 Bacteria 35478
25 Ga0105249_10295020 3300009553 Bacteria 1624
26 Ga0105239_10116457 3300010375 Bacteria 2965
27 Ga0182008_10344335 3300014497 Bacteria 789
28 Ga0157376_10010210 3300014969 Bacteria 6857
29 Ga0163161_10024535 3300017792 Bacteria 4261
30 Ga0163161_10776034 3300017792 Bacteria 804
31 Ga0209051_1000140 3300025303 Bacteria 135919
32 Ga0209257_1000012 3300025304 Bacteria 1111138
33 Ga0209257_1000045 3300025304 Bacteria 484429
34 Ga0207654_10075751 3300025911 Bacteria 2011
35 Ga0207695_10229914 3300025913 Bacteria 1759
36 Ga0207687_10373784 3300025927 Bacteria 1166
37 Ga0207687_11460498 3300025927 Bacteria 587
38 Ga0207690_11575770 3300025932 Bacteria 549
39 Ga0207686_10001391 3300025934 Bacteria 13750
40 Ga0207689_10070393 3300025942 Bacteria 2874
41 Ga0207661_11466602 3300025944 Bacteria 626
42 Ga0207667_10716804 3300025949 Bacteria 1002
43 Ga0207677_10288148 3300026023 Bacteria 1351
44 Ga0207674_10280884 3300026116 Bacteria 1613
45 Ga0209974_10018369 3300027876 Bacteria 2320
46 Ga0209974_10141105 3300027876 Bacteria 864
47 Ga0207428_10247147 3300027907 Bacteria 1331
48 Ga0268265_10680529 3300028380 Bacteria 992
49 Ga0265330_10000108 3300031235 Bacteria 69468
50 Ga0265330_10047446 3300031235 Bacteria 1890
51 Ga0265332_10000072 3300031238 Bacteria 86029
52 Ga0265332_10048245 3300031238 Bacteria 1832
53 Ga0265320_10092503 3300031240 Bacteria 1400
54 Ga0265325_10006200 3300031241 Bacteria 7290
55 Ga0265340_10114862 3300031247 Bacteria 1242
56 Ga0265316_10352816 3300031344 Bacteria 1065
57 Ga0307408_100170923 3300031548 Bacteria 1735
58 Ga0265314_10000874 3300031711 Bacteria 35850
59 Ga0265314_10004517 3300031711 Bacteria 12876
60 Ga0265314_10038784 3300031711 Bacteria 3439
61 Ga0265342_10173323 3300031712 Bacteria 1185
62 Ga0307413_10247902 3300031824 Bacteria 1319
63 Ga0307410_10368255 3300031852 Bacteria 1153
64 Ga0307406_11032293 3300031901 Bacteria 707
65 Ga0307412_10525593 3300031911 Bacteria 989
66 Ga0307416_100765052 3300032002 Bacteria 1059
67 Ga0307416_101090346 3300032002 Bacteria 903
68 Ga0307416_101575315 3300032002 Bacteria 762
69 Ga0307414_11223890 3300032004 Bacteria 695
70 Ga0307411_11287624 3300032005 Bacteria 665
71 Ga0307411_11380565 3300032005 Bacteria 644
72 Ga0307411_11719217 3300032005 Bacteria 581
73 Ga0307411_11788393 3300032005 Bacteria 570
74 Ga0395899_0047362 3300037312 Bacteria 3201
75 Ga0395899_0109122 3300037312 Bacteria 1991
76 Ga0395900_0028766 3300037418 Bacteria 5697
77 Ga0395900_0081609 3300037418 Bacteria 3322
78 Ga0395900_0206800 3300037418 Bacteria 1984
79 Ga0395900_0327536 3300037418 Bacteria 1510
80 Ga0395898_0006527 3300037466 Bacteria 12459
81 Ga0395898_0576109 3300037466 Bacteria 1068
82 Ga0395905_0000766 3300037471 Bacteria 42342
83 Ga0395905_0016311 3300037471 Bacteria 7059
84 Ga0395905_0049363 3300037471 Bacteria 3943
85 Ga0395905_0059307 3300037471 Bacteria 3577
86 Ga0395905_0063315 3300037471 Bacteria 3460
87 Ga0395905_0070092 3300037471 Bacteria 3284
88 Ga0395905_0305212 3300037471 Bacteria 1479
89 Ga0395905_0923179 3300037471 Bacteria 776
90 Ga0395901_0030760 3300038443 Bacteria 5532
91 Ga0395901_0090508 3300038443 Bacteria 3202
92 Ga0395901_0102577 3300038443 Bacteria 3002
93 Ga0395901_0124753 3300038443 Bacteria 2705
94 Ga0395901_0684986 3300038443 Bacteria 1024
95 Ga0439439_0078883 3300041406 Bacteria 888
96 Ga0451797_0169565 3300041453 Bacteria 924
97 Ga0451843_0454728 3300041509 Bacteria 809
98 Ga0439431_0065518 3300041997 Bacteria 962
99 Ga0439433_0016870 3300041999 Bacteria 1619
100 Ga0439457_114363 3300042014 Bacteria 635
101 Ga0450912_001315 3300042116 Bacteria 1488
102 Ga0450915_005818 3300042119 Bacteria 770
103 Ga0450921_002869 3300042123 Bacteria 1179
104 Ga0450922_040785 3300042124 Bacteria 525
105 Ga0450923_160618 3300042125 Bacteria 547
106 Ga0450890_032315 3300042127 Bacteria 749
107 Ga0450891_026583 3300042129 Bacteria 587
108 Ga0450898_006886 3300042134 Bacteria 1757
109 Ga0439446_0009370 3300042156 Bacteria 2621
110 Ga0450908_024202 3300042184 Bacteria 1062
111 Ga0439434_0005859 3300042435 Bacteria 3592
112 Ga0439435_0332432 3300042436 Bacteria 525
113 Ga0439460_0014558 3300042461 Bacteria 2068
114 Ga0450916_056319 3300042530 Bacteria 630
115 Ga0451577_0000142 3300042876 Bacteria 160598
116 Ga0466969_0003266 3300044656 Bacteria 8619
117 Ga0466972_0089375 3300044658 Bacteria 1461
118 Ga0453683_0004759 3300044673 Bacteria 9566
119 Ga0466965_0194634 3300044683 Bacteria 1073
120 Ga0466966_0003451 3300044684 Bacteria 10419
121 Ga0466961_0034403 3300044693 Bacteria 3253
122 Ga0453684_0000126 3300044712 Bacteria 336395
123 Ga0453684_0176582 3300044712 Bacteria 2511
124 Ga0466971_0206506 3300044719 Bacteria 928
125 Ga0466970_0888795 3300044765 Bacteria 524
126 Ga0466957_0224614 3300044842 Bacteria 1241
127 Ga0466960_0162620 3300044901 Bacteria 1199
128 Ga0466959_0030003 3300045049 Bacteria 4028
129 Ga0466959_0391572 3300045049 Bacteria 945
130 Ga0451576_0003200 3300045051 Bacteria 22845
131 Ga0451576_0005135 3300045051 Bacteria 16590
132 Ga0451576_0144753 3300045051 Bacteria 2478
133 Ga0466967_0419572 3300045976 Bacteria 1304
134 Ga0495663_0036184 3300046525 Bacteria 1485
135 Ga0495621_0024030 3300046539 Bacteria 2032
136 Ga0495621_0220631 3300046539 Bacteria 767
137 Ga0495597_0001092 3300046542 Bacteria 20579
138 Ga0495656_0084672 3300046615 Bacteria 1438
139 Ga0495656_0184927 3300046615 Bacteria 1026
140 Ga0495588_0037942 3300046674 Bacteria 2450
141 Ga0495669_0038580 3300046684 Bacteria 2116
142 Ga0495636_0139508 3300047318 Bacteria 1082
143 Ga0495677_0073183 3300047445 Bacteria 1278
144 Ga0495685_036525 3300047447 Bacteria 1687
145 Ga0495615_0027624 3300048090 Bacteria 1333
146 Ga0496114_0240030 3300048917 Bacteria 1593
147 Ga0501032_0081177 3300049569 Bacteria 2158
148 Ga0501036_0236944 3300049572 Bacteria 1531
149 Ga0501043_0070521 3300049579 Bacteria 2745
150 Ga0501046_0133633 3300049580 Bacteria 1880
151 Ga0501047_0043844 3300049581 Bacteria 4320
152 Ga0501249_104279 3300049679 Bacteria 681
153 Ga0501229_028872 3300049706 Bacteria 755
154 Ga0501083_0516152 3300049744 Bacteria 778
155 Ga0501280_044409 3300049776 Bacteria 729
156 Ga0501035_0138134 3300049822 Bacteria 2120
157 Ga0501044_0926122 3300049823 Bacteria 745
158 nmdc:mga00v17_18255_c1 3300050491 Bacteria 3981
159 nmdc:mga0yw44_457430_c1 3300050492 Bacteria 865
160 nmdc:mga0k408_60246_c1 3300050493 Bacteria 2205
161 nmdc:mga07m45_151297_c1 3300050496 Bacteria 1346
162 Ga0590071_094624 3300059421 Bacteria 750
163 Ga0466962_0080554 3300061719 Bacteria 1557
164 2643864928 2643221570 Bacteria 5103772
165 2643990409 2643221596 Bacteria 5006805
166 2644062534 2643221609 Bacteria 6756331
167 2644076435 2643221611 Bacteria 6820941
168 2644296051 2643221652 Bacteria 5140275
169 2739245359 2738543012 Bacteria 7115078
170 2816474724 2816332133 Bacteria 7249298
171 2842720014 2842718218 Bacteria 4560148
172 2894025152 2894023352 Bacteria 5167372
173 2928115998 2928115317 Bacteria 6477646
174 2974323033 2974320154 Bacteria 4571377
175 2990711931 2990710928 Bacteria 5002431
176 Ga0395905_0324678
177 LJQas_1014526
178 Ga0055540_1005714
179 Ga0055531_10001100
180 Ga0065707_10375822
181 Ga0068869_101314836
182 Ga0068868_100020836
183 Ga0068868_100121417
184 Ga0068868_101942922
185 Ga0070659_101801459
186 Ga0068855_101033583
187 Ga0068855_101924291
188 Ga0068856_100212129
189 Ga0068864_100774932
190 Ga0068858_101663082
191 Ga0075364_10011971
192 Ga0075432_10065967
193 Ga0075362_10303500
194 Ga0075370_10148781
195 Ga0105240_11573879
196 Ga0105245_10571237
197 Ga0105245_11093826
198 Ga0105241_10133645
199 Ga0105242_10000374
200 Ga0105249_10295020
201 Ga0105239_10116457
202 Ga0182008_10344335
203 Ga0157376_10010210
204 Ga0163161_10024535
205 Ga0163161_10776034
206 Ga0209051_1000140
207 Ga0209257_1000012
208 Ga0209257_1000045
209 Ga0207654_10075751
210 Ga0207695_10229914
211 Ga0207687_10373784
212 Ga0207687_11460498
213 Ga0207690_11575770
214 Ga0207686_10001391
215 Ga0207689_10070393
216 Ga0207661_11466602
217 Ga0207667_10716804
218 Ga0207677_10288148
219 Ga0207674_10280884
220 Ga0209974_10018369
221 Ga0209974_10141105
222 Ga0207428_10247147
223 Ga0268265_10680529
224 Ga0265330_10000108
225 Ga0265330_10047446
226 Ga0265332_10000072
227 Ga0265332_10048245
228 Ga0265320_10092503
229 Ga0265325_10006200
230 Ga0265340_10114862
231 Ga0265316_10352816
232 Ga0307408_100170923
233 Ga0265314_10000874
234 Ga0265314_10004517
235 Ga0265314_10038784
236 Ga0265342_10173323
237 Ga0307413_10247902
238 Ga0307410_10368255
239 Ga0307406_11032293
240 Ga0307412_10525593
241 Ga0307416_100765052
242 Ga0307416_101090346
243 Ga0307416_101575315
244 Ga0307414_11223890
245 Ga0307411_11287624
246 Ga0307411_11380565
247 Ga0307411_11719217
248 Ga0307411_11788393
249 Ga0395899_0047362
250 Ga0395899_0109122
251 Ga0395900_0028766
252 Ga0395900_0081609
253 Ga0395900_0206800
254 Ga0395900_0327536
255 Ga0395898_0006527
256 Ga0395898_0576109
257 Ga0395905_0000766
258 Ga0395905_0016311
259 Ga0395905_0049363
260 Ga0395905_0059307
261 Ga0395905_0063315
262 Ga0395905_0070092
263 Ga0395905_0305212
264 Ga0395905_0923179
265 Ga0395901_0030760
266 Ga0395901_0090508
267 Ga0395901_0102577
268 Ga0395901_0124753
269 Ga0395901_0684986
270 Ga0439439_0078883
271 Ga0451797_0169565
272 Ga0451843_0454728
273 Ga0439431_0065518
274 Ga0439433_0016870
275 Ga0439457_114363
276 Ga0450912_001315
277 Ga0450915_005818
278 Ga0450921_002869
279 Ga0450922_040785
280 Ga0450923_160618
281 Ga0450890_032315
282 Ga0450891_026583
283 Ga0450898_006886
284 Ga0439446_0009370
285 Ga0450908_024202
286 Ga0439434_0005859
287 Ga0439435_0332432
288 Ga0439460_0014558
289 Ga0450916_056319
290 Ga0451577_0000142
291 Ga0466969_0003266
292 Ga0466972_0089375
293 Ga0453683_0004759
294 Ga0466965_0194634
295 Ga0466966_0003451
296 Ga0466961_0034403
297 Ga0453684_0000126
298 Ga0453684_0176582
299 Ga0466971_0206506
300 Ga0466970_0888795
301 Ga0466957_0224614
302 Ga0466960_0162620
303 Ga0466959_0030003
304 Ga0466959_0391572
305 Ga0451576_0003200
306 Ga0451576_0005135
307 Ga0451576_0144753
308 Ga0466967_0419572
309 Ga0495663_0036184
310 Ga0495621_0024030
311 Ga0495621_0220631
312 Ga0495597_0001092
313 Ga0495656_0084672
314 Ga0495656_0184927
315 Ga0495588_0037942
316 Ga0495669_0038580
317 Ga0495636_0139508
318 Ga0495677_0073183
319 Ga0495685_036525
320 Ga0495615_0027624
321 Ga0496114_0240030
322 Ga0501032_0081177
323 Ga0501036_0236944
324 Ga0501043_0070521
325 Ga0501046_0133633
326 Ga0501047_0043844
327 Ga0501249_104279
328 Ga0501229_028872
329 Ga0501083_0516152
330 Ga0501280_044409
331 Ga0501035_0138134
332 Ga0501044_0926122
333 nmdc:mga00v17_18255_c1
334 nmdc:mga0yw44_457430_c1
335 nmdc:mga0k408_60246_c1
336 nmdc:mga07m45_151297_c1
337 Ga0590071_094624
338 Ga0466962_0080554
339 2643864928
340 2643990409
341 2644062534
342 2644076435
343 2644296051
344 2739245359
345 2816474724
346 2842720014
347 2894025152
348 2928115998
349 2974323033
350 2990711931

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

25

153

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jrz-assembly1.cif.gz_A human ltc4 synthase in complex with product analogs - implications for enzyme catalysis 0.8205 8 135
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.8001 8 133
3leo-assembly1.cif.gz_A structure of human leukotriene c4 synthase mutant r31q in complex with glutathione 0.7986 8 135
5bqg-assembly1.cif.gz_A crystal structure of mpges-1 bound to an inhibitor 0.7877 8 133
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.7363 8 133
ID Description Score Start End Superfamily
2pnoB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8003 8 135 1.20.120.550
3leoA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7986 8 135 1.20.120.550
4yl1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7938 8 133 1.20.120.550
af_Q9JHF3_7_153_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.79 8 133 1.20.120.550
4wabA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7775 8 133 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A7S9C9E1-F1-model_v4 Glutathione metabolism protein 0.9678 6 133 GO:0016020
AF-A0A855HX79-F1-model_v4 deleted 0.9657 51 135
AF-A0A257DCV8-F1-model_v4 Glutathione metabolism protein 0.9649 5 135 GO:0016020
AF-A0A1H7GSP8-F1-model_v4 Uncharacterized conserved protein, MAPEG superfamily 0.9633 6 133 GO:0016020
AF-A0A4Z0BMK2-F1-model_v4 Glutathione metabolism protein 0.961 1 137 GO:0016020

Map