F266068

General Info

Members Datasets Scaffolds Average Seq Length
175 123 350 140

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10359542|Ga0081455_103595421
Length 157
Sequence MCAIAAPQPVPSCVFCGILRGEVPASFVLGGPGHGDDDLPVAAFLDARPLFKGHTLLVPRDHHETLADLPADLVGPLFAQAQRIAAAMEAGVGAAGSFVAVNNRVSQSVPHLHVHIVPRNRKDGLRGFFWPRTRYADDDEMATWAARLRDALAASAS

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
32 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
41 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
43 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
44 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
45 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
46 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
47 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
48 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
49 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
50 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
53 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
60 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
61 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
62 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
63 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
67 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
68 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
69 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
70 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
71 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
72 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
73 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
74 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
75 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
76 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
77 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
78 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
79 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
80 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
81 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
82 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
85 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
86 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
89 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
90 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
91 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
92 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
93 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
94 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
95 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
98 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
99 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
100 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
103 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
107 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
108 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
109 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
110 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
111 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
112 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
113 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
114 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
115 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
116 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
117 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
118 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
119 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
120 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
121 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
122 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
123 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.43
Metatranscriptomes 1.14
Isolates 7.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0.57
Rhizoplane 16
Rhizosphere 76.57
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10359542 3300005937 Bacteria 1024
2 JGI25407J50210_10001749 3300003373 Bacteria 4989
3 Ga0070682_100068103 3300005337 Bacteria 2269
4 Ga0068868_100357027 3300005338 Bacteria 1253
5 Ga0070700_100001084 3300005441 Bacteria 13520
6 Ga0070708_100033196 3300005445 Bacteria 4484
7 Ga0070678_101604334 3300005456 Bacteria 611
8 Ga0070706_101265011 3300005467 Bacteria 677
9 Ga0070707_100489617 3300005468 Bacteria 1191
10 Ga0070699_100129805 3300005518 Bacteria 2221
11 Ga0070697_100546760 3300005536 Bacteria 1015
12 Ga0070702_100510332 3300005615 Bacteria 885
13 Ga0068852_100557271 3300005616 Bacteria 1147
14 Ga0068860_101588381 3300005843 Bacteria 676
15 Ga0081455_10000427 3300005937 Bacteria 55256
16 Ga0081455_10013516 3300005937 Bacteria 8052
17 Ga0081455_10904568 3300005937 Bacteria 549
18 Ga0081538_10000005 3300005981 Bacteria 187304
19 Ga0075364_10147245 3300006051 Bacteria 1586
20 Ga0075428_100036521 3300006844 Bacteria 5411
21 Ga0075428_100419739 3300006844 Bacteria 1433
22 Ga0075428_100488936 3300006844 Bacteria 1317
23 Ga0075428_101505071 3300006844 Bacteria 705
24 Ga0075430_100010072 3300006846 Bacteria 7997
25 Ga0075431_100009143 3300006847 Bacteria 9937
26 Ga0075431_100144422 3300006847 Bacteria 2452
27 Ga0075433_10545980 3300006852 Bacteria 1019
28 Ga0075429_100007402 3300006880 Bacteria 9528
29 Ga0075429_100292389 3300006880 Bacteria 1426
30 Ga0111539_10008202 3300009094 Bacteria 13291
31 Ga0111539_10044721 3300009094 Bacteria 5302
32 Ga0111539_10822689 3300009094 Bacteria 1081
33 Ga0111539_11003517 3300009094 Bacteria 970
34 Ga0105245_10040653 3300009098 Bacteria 4143
35 Ga0114129_10038326 3300009147 Bacteria 6762
36 Ga0114129_10302691 3300009147 Bacteria 2130
37 Ga0114129_10476825 3300009147 Bacteria 1633
38 Ga0114129_11388964 3300009147 Bacteria 867
39 Ga0114129_11412238 3300009147 Unclassified 858
40 Ga0105238_11708763 3300009551 Bacteria 660
41 Ga0105239_11006296 3300010375 Bacteria 958
42 Ga0157369_10636817 3300013105 Bacteria 1100
43 Ga0157378_10375234 3300013297 Bacteria 1395
44 Ga0163162_11185276 3300013306 Bacteria 866
45 Ga0157372_10290384 3300013307 Bacteria 1902
46 Ga0157372_10836231 3300013307 Bacteria 1069
47 Ga0157377_10373469 3300014745 Bacteria 963
48 Ga0206356_10050959 3300020070 Bacteria 776
49 Ga0207693_10339103 3300025915 Bacteria 1176
50 Ga0207709_10042220 3300025935 Bacteria 2742
51 Ga0207677_10340007 3300026023 Bacteria 1254
52 Ga0207678_10150474 3300026067 Bacteria 1987
53 Ga0207678_10512136 3300026067 Bacteria 1047
54 Ga0207708_10001408 3300026075 Bacteria 18038
55 Ga0207702_10267612 3300026078 Bacteria 1611
56 Ga0207683_12050116 3300026121 Bacteria 520
57 Ga0207428_10045089 3300027907 Bacteria 3554
58 Ga0207428_10480558 3300027907 Bacteria 904
59 Ga0265762_1040290 3300030760 Bacteria 913
60 Ga0307410_10651571 3300031852 Bacteria 883
61 Ga0326468_10008315 3300031889 Bacteria 1003
62 Ga0307409_101696884 3300031995 Bacteria 660
63 Ga0373952_0212494 3300035092 Bacteria 571
64 Ga0373945_0132143 3300035116 Bacteria 1001
65 Ga0373924_0060570 3300035410 Unclassified 1583
66 Ga0395900_0286281 3300037418 Bacteria 1638
67 Ga0395900_0862874 3300037418 Bacteria 830
68 Ga0395898_0083548 3300037466 Bacteria 3078
69 Ga0395898_0320548 3300037466 Bacteria 1478
70 Ga0395905_1820705 3300037471 Bacteria 515
71 Ga0395901_0080970 3300038443 Bacteria 3391
72 Ga0395901_0082009 3300038443 Bacteria 3369
73 Ga0242420_020731 3300038996 Bacteria 1172
74 Ga0451802_0876092 3300041460 Bacteria 544
75 Ga0466969_0086919 3300044656 Bacteria 1485
76 Ga0466972_0004242 3300044658 Bacteria 7165
77 Ga0466966_0096362 3300044684 Bacteria 1832
78 Ga0466961_0002487 3300044693 Bacteria 11431
79 Ga0466961_0245704 3300044693 Bacteria 1099
80 Ga0466963_0222455 3300044694 Bacteria 1322
81 Ga0466964_0043873 3300044706 Bacteria 1815
82 Ga0466964_0047777 3300044706 Bacteria 1748
83 Ga0466971_0023125 3300044719 Bacteria 2770
84 Ga0466971_0066133 3300044719 Bacteria 1637
85 Ga0466968_0738187 3300044735 Bacteria 505
86 Ga0466957_0670390 3300044842 Bacteria 730
87 Ga0466960_0000095 3300044901 Bacteria 28923
88 Ga0466960_0031307 3300044901 Bacteria 2454
89 Ga0466959_0069963 3300045049 Bacteria 2542
90 Ga0466959_0460342 3300045049 Bacteria 862
91 Ga0466967_1851277 3300045976 Bacteria 600
92 Ga0495628_0130432 3300046516 Bacteria 1923
93 Ga0495640_0536012 3300046533 Bacteria 710
94 Ga0495635_0359426 3300046663 Bacteria 971
95 Ga0495588_0471780 3300046674 Bacteria 658
96 Ga0495599_0339069 3300046678 Bacteria 903
97 Ga0495624_0414838 3300046690 Bacteria 808
98 Ga0496100_0078927 3300048903 Bacteria 2217
99 Ga0496100_0268092 3300048903 Bacteria 1268
100 Ga0496100_0364843 3300048903 Bacteria 1094
101 Ga0496101_0137845 3300048904 Bacteria 1858
102 Ga0496101_0467055 3300048904 Bacteria 996
103 Ga0496102_0948459 3300048905 Bacteria 781
104 Ga0496104_0097276 3300048907 Bacteria 2817
105 Ga0496104_0736033 3300048907 Bacteria 893
106 Ga0496104_0873668 3300048907 Bacteria 804
107 Ga0496105_0044371 3300048908 Bacteria 3667
108 Ga0496105_0109817 3300048908 Bacteria 2277
109 Ga0496106_0148039 3300048909 Bacteria 1851
110 Ga0496107_0815322 3300048910 Bacteria 683
111 Ga0496108_0218526 3300048911 Bacteria 1655
112 Ga0496108_0404076 3300048911 Bacteria 1193
113 Ga0496109_0128986 3300048912 Bacteria 2359
114 Ga0496109_0886786 3300048912 Bacteria 830
115 Ga0496110_0110398 3300048913 Bacteria 2471
116 Ga0496110_0292184 3300048913 Bacteria 1484
117 Ga0496110_0764225 3300048913 Bacteria 870
118 Ga0496111_0057704 3300048914 Bacteria 2810
119 Ga0496111_0250792 3300048914 Bacteria 1314
120 Ga0496112_0007964 3300048915 Bacteria 9449
121 Ga0496112_0171016 3300048915 Bacteria 2138
122 Ga0496113_0017508 3300048916 Bacteria 4975
123 Ga0496115_0071653 3300048918 Bacteria 2811
124 Ga0496115_0555764 3300048918 Bacteria 917
125 Ga0501041_0234318 3300049577 Bacteria 1153
126 Ga0501042_0145030 3300049578 Bacteria 1712
127 Ga0501067_0006990 3300049583 Bacteria 6263
128 Ga0501067_0015263 3300049583 Bacteria 4252
129 Ga0501068_0037921 3300049584 Bacteria 2886
130 Ga0501068_0145606 3300049584 Bacteria 1487
131 Ga0501069_0104531 3300049585 Bacteria 1609
132 Ga0501069_0276914 3300049585 Bacteria 981
133 Ga0501071_0023417 3300049587 Bacteria 4313
134 Ga0501072_0828828 3300049588 Bacteria 724
135 Ga0501077_0133065 3300049593 Bacteria 1577
136 Ga0501079_0413673 3300049741 Bacteria 1058
137 Ga0501081_0553285 3300049743 Bacteria 860
138 Ga0501035_0717876 3300049822 Bacteria 805
139 nmdc:mga03n38_315155_c1 3300050490 Bacteria 843
140 nmdc:mga00v17_738134_c1 3300050491 Bacteria 630
141 nmdc:mga0yw44_415715_c1 3300050492 Bacteria 614
142 nmdc:mga07m45_802560_c1 3300050496 Bacteria 539
143 nmdc:mga05p37_119114_c1 3300050507 Bacteria 3244
144 nmdc:mga05p37_399_c1 3300050507 Bacteria 47170
145 nmdc:mga05p37_552560_c1 3300050507 Bacteria 1310
146 nmdc:mga09592_200393_c1 3300050508 Bacteria 1729
147 nmdc:mga09592_590_c1 3300050508 Bacteria 27521
148 nmdc:mga0qj67_191302_c1 3300050509 Bacteria 1663
149 nmdc:mga0qj67_309216_c1 3300050509 Bacteria 1280
150 nmdc:mga0qj67_51575_c1 3300050509 Bacteria 3254
151 nmdc:mga06r32_1193_c1 3300050510 Bacteria 23383
152 nmdc:mga06r32_123734_c1 3300050510 Bacteria 2553
153 nmdc:mga06r32_350_c1 3300050510 Bacteria 38442
154 nmdc:mga08y16_127622_c1 3300050511 Bacteria 2646
155 nmdc:mga08y16_1510038_c1 3300050511 Bacteria 632
156 nmdc:mga08y16_845_c1 3300050511 Bacteria 29413
157 Ga0500593_155714 3300053117 Bacteria 880
158 Ga0500616_0047875 3300053153 Bacteria 2268
159 Ga0501082_0554860 3300060353 Bacteria 1005
160 Ga0466962_0104689 3300061719 Bacteria 1360
161 Ga0466962_0125534 3300061719 Bacteria 1239
162 Ga0530510_0175572 3300061734 Bacteria 1588
163 2515493717 2515154088 Bacteria 5526283
164 2515755106 2515154137 Bacteria 5711575
165 2516087751 2515154203 Bacteria 5458536
166 2739235539 2738543011 Bacteria 5731169
167 2831938790 2831935698 Bacteria 5963223
168 2858907614 2858902515 Bacteria 7086037
169 2867348309 2867346516 Bacteria 7608576
170 2867509541 2867507094 Bacteria 6506033
171 2887479439 2887478801 Bacteria 8972725
172 2889301463 2889300758 Bacteria 5690814
173 2939747810 2939743619 Bacteria 5762299
174 8003862373 8003856774 Bacteria 7675274
175 8055415899 8055412473 Bacteria 6257500
176 Ga0081455_10359542
177 JGI25407J50210_10001749
178 Ga0070682_100068103
179 Ga0068868_100357027
180 Ga0070700_100001084
181 Ga0070708_100033196
182 Ga0070678_101604334
183 Ga0070706_101265011
184 Ga0070707_100489617
185 Ga0070699_100129805
186 Ga0070697_100546760
187 Ga0070702_100510332
188 Ga0068852_100557271
189 Ga0068860_101588381
190 Ga0081455_10000427
191 Ga0081455_10013516
192 Ga0081455_10904568
193 Ga0081538_10000005
194 Ga0075364_10147245
195 Ga0075428_100036521
196 Ga0075428_100419739
197 Ga0075428_100488936
198 Ga0075428_101505071
199 Ga0075430_100010072
200 Ga0075431_100009143
201 Ga0075431_100144422
202 Ga0075433_10545980
203 Ga0075429_100007402
204 Ga0075429_100292389
205 Ga0111539_10008202
206 Ga0111539_10044721
207 Ga0111539_10822689
208 Ga0111539_11003517
209 Ga0105245_10040653
210 Ga0114129_10038326
211 Ga0114129_10302691
212 Ga0114129_10476825
213 Ga0114129_11388964
214 Ga0114129_11412238
215 Ga0105238_11708763
216 Ga0105239_11006296
217 Ga0157369_10636817
218 Ga0157378_10375234
219 Ga0163162_11185276
220 Ga0157372_10290384
221 Ga0157372_10836231
222 Ga0157377_10373469
223 Ga0206356_10050959
224 Ga0207693_10339103
225 Ga0207709_10042220
226 Ga0207677_10340007
227 Ga0207678_10150474
228 Ga0207678_10512136
229 Ga0207708_10001408
230 Ga0207702_10267612
231 Ga0207683_12050116
232 Ga0207428_10045089
233 Ga0207428_10480558
234 Ga0265762_1040290
235 Ga0307410_10651571
236 Ga0326468_10008315
237 Ga0307409_101696884
238 Ga0373952_0212494
239 Ga0373945_0132143
240 Ga0373924_0060570
241 Ga0395900_0286281
242 Ga0395900_0862874
243 Ga0395898_0083548
244 Ga0395898_0320548
245 Ga0395905_1820705
246 Ga0395901_0080970
247 Ga0395901_0082009
248 Ga0242420_020731
249 Ga0451802_0876092
250 Ga0466969_0086919
251 Ga0466972_0004242
252 Ga0466966_0096362
253 Ga0466961_0002487
254 Ga0466961_0245704
255 Ga0466963_0222455
256 Ga0466964_0043873
257 Ga0466964_0047777
258 Ga0466971_0023125
259 Ga0466971_0066133
260 Ga0466968_0738187
261 Ga0466957_0670390
262 Ga0466960_0000095
263 Ga0466960_0031307
264 Ga0466959_0069963
265 Ga0466959_0460342
266 Ga0466967_1851277
267 Ga0495628_0130432
268 Ga0495640_0536012
269 Ga0495635_0359426
270 Ga0495588_0471780
271 Ga0495599_0339069
272 Ga0495624_0414838
273 Ga0496100_0078927
274 Ga0496100_0268092
275 Ga0496100_0364843
276 Ga0496101_0137845
277 Ga0496101_0467055
278 Ga0496102_0948459
279 Ga0496104_0097276
280 Ga0496104_0736033
281 Ga0496104_0873668
282 Ga0496105_0044371
283 Ga0496105_0109817
284 Ga0496106_0148039
285 Ga0496107_0815322
286 Ga0496108_0218526
287 Ga0496108_0404076
288 Ga0496109_0128986
289 Ga0496109_0886786
290 Ga0496110_0110398
291 Ga0496110_0292184
292 Ga0496110_0764225
293 Ga0496111_0057704
294 Ga0496111_0250792
295 Ga0496112_0007964
296 Ga0496112_0171016
297 Ga0496113_0017508
298 Ga0496115_0071653
299 Ga0496115_0555764
300 Ga0501041_0234318
301 Ga0501042_0145030
302 Ga0501067_0006990
303 Ga0501067_0015263
304 Ga0501068_0037921
305 Ga0501068_0145606
306 Ga0501069_0104531
307 Ga0501069_0276914
308 Ga0501071_0023417
309 Ga0501072_0828828
310 Ga0501077_0133065
311 Ga0501079_0413673
312 Ga0501081_0553285
313 Ga0501035_0717876
314 nmdc:mga03n38_315155_c1
315 nmdc:mga00v17_738134_c1
316 nmdc:mga0yw44_415715_c1
317 nmdc:mga07m45_802560_c1
318 nmdc:mga05p37_119114_c1
319 nmdc:mga05p37_399_c1
320 nmdc:mga05p37_552560_c1
321 nmdc:mga09592_200393_c1
322 nmdc:mga09592_590_c1
323 nmdc:mga0qj67_191302_c1
324 nmdc:mga0qj67_309216_c1
325 nmdc:mga0qj67_51575_c1
326 nmdc:mga06r32_1193_c1
327 nmdc:mga06r32_123734_c1
328 nmdc:mga06r32_350_c1
329 nmdc:mga08y16_127622_c1
330 nmdc:mga08y16_1510038_c1
331 nmdc:mga08y16_845_c1
332 Ga0500593_155714
333 Ga0500616_0047875
334 Ga0501082_0554860
335 Ga0466962_0104689
336 Ga0466962_0125534
337 Ga0530510_0175572
338 2515493717
339 2515755106
340 2516087751
341 2739235539
342 2831938790
343 2858907614
344 2867348309
345 2867509541
346 2887479439
347 2889301463
348 2939747810
349 8003862373
350 8055415899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

35

122

0.9

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

12

126

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9377 2 134
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9284 2 134
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.92 2 134
3o0m-assembly1.cif.gz_A crystal structure of a zn-bound histidine triad family protein from mycobacterium smegmatis 0.9163 2 136
3p0t-assembly1.cif.gz_B crystal structure of an hit-like protein from mycobacterium paratuberculosis 0.9078 4 136
ID Description Score Start End Superfamily
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9644 37 106 3.30.428.10
af_P49776_4_176_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9613 16 106 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9566 16 102 3.30.428.10
af_A0A1D8PKG2_1_175_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9555 16 107 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9511 16 105 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A7J9YY17-F1-model_v4 HIT domain-containing protein 0.9874 2 106 GO:0003824
GO:0009117
AF-A0A1F2X1A4-F1-model_v4 HIT family hydrolase 0.9858 2 98 GO:0009117
GO:0016787
AF-A0A3D1R8P0-F1-model_v4 HIT family protein 0.9848 2 100 GO:0003824
GO:0009117
AF-A0A3N5E9W3-F1-model_v4 HIT family protein 0.9797 2 102 GO:0003824
GO:0009117
AF-A0A7C2AV71-F1-model_v4 HIT family protein 0.973 2 107 GO:0003824
GO:0009117

Map