F265316

General Info

Members Datasets Scaffolds Average Seq Length
174 132 348 422

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0088386|Ga0501042_0088386_841_2175
Length 444
Sequence MSSARHNGNGSTDDSAPIRTVNGWGRMRKARYLPRGGLVAGLDVGTSKMCCFIARVGDEGHPQVVGIGHQISHGVKGGVIVDMEAAERAILTTVHAAEQMAGETIREVVVNVSGGHPASQTIGVEVDIAGHEVGDGDLRRALDHGNAVNGSDDRRLIHSIPVGYTIDGSRGIRDPRGMYGERLGVDMHLVTAAAGPLRNLQTCIERCHLDIRALAMAPYASGLATLVEDEMDLGVTVIDMGGGTTSIAVFFDGHVIYTDSVAIGGGHVTNDIARGLSTPLAHAERMKTLYGNCIPSPADEREVISVPQVGEDDPTNATTIPKSILVGIIQPRLEETFELVRARLEQGGLDRVAGRRVVLAGGASQLSGARELAALVLDKQVRMGRPIRIGGLAEATGGPAFATAVGLLAYGASADAEMPRPGRPGHAPPNGLIGRIGHWFRENF

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
22 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
23 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
26 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
28 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
44 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
48 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
53 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
54 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
55 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
56 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
57 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
58 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
59 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
73 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
74 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
77 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
78 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
79 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
80 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
81 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
82 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
83 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
84 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
100 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
103 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
109 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
110 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
111 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
112 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
113 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
114 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
115 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
116 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
117 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
118 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
119 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
120 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
122 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
123 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
124 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
125 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
126 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
127 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
128 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
129 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
130 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
131 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
132 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.68
Metatranscriptomes 0
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.34
Nodule 0
Rhizoplane 0
Rhizosphere 74.71
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0088386 3300049578 Bacteria 2223
2 JGI25153J46596_10000039 3300003215 Bacteria 165779
3 Ga0055536_1012056 3300003781 Bacteria 3245
4 Ga0055531_10015509 3300003794 Bacteria 3350
5 Ga0070674_100005240 3300005356 Bacteria 7462
6 Ga0070714_100044199 3300005435 Bacteria 3770
7 Ga0070713_100005889 3300005436 Bacteria 8427
8 Ga0070711_100005806 3300005439 Bacteria 7410
9 Ga0070698_100217206 3300005471 Bacteria 1846
10 Ga0070679_100045387 3300005530 Bacteria 4379
11 Ga0070679_100068516 3300005530 Bacteria 3539
12 Ga0070665_100022670 3300005548 Bacteria 6322
13 Ga0068856_100188739 3300005614 Bacteria 2075
14 Ga0068866_10024529 3300005718 Bacteria 2822
15 Ga0068863_100123208 3300005841 Bacteria 2473
16 Ga0068862_100006950 3300005844 Bacteria 9389
17 Ga0081455_10089227 3300005937 Bacteria 2502
18 Ga0081538_10003364 3300005981 Bacteria 15140
19 Ga0105240_10355196 3300009093 Bacteria 1662
20 Ga0111539_10000751 3300009094 Bacteria 42132
21 Ga0105248_10108253 3300009177 Bacteria 3134
22 Ga0213875_10000877 3300021388 Bacteria 22066
23 Ga0213875_10006195 3300021388 Bacteria 6307
24 Ga0213875_10054677 3300021388 Bacteria 1869
25 Ga0213875_10082127 3300021388 Bacteria 1504
26 Ga0213871_10000202 3300021441 Bacteria 6877
27 Ga0209148_1001047 3300025254 Bacteria 17118
28 Ga0209455_1000278 3300025272 Bacteria 56010
29 Ga0209675_1002252 3300025291 Bacteria 10067
30 Ga0209676_1000089 3300025292 Bacteria 260196
31 Ga0209758_1000118 3300025297 Bacteria 195889
32 Ga0209257_1001036 3300025304 Bacteria 37117
33 Ga0207684_10016690 3300025910 Bacteria 6305
34 Ga0207707_10121502 3300025912 Bacteria 2284
35 Ga0207663_10013135 3300025916 Bacteria 4495
36 Ga0207700_10112507 3300025928 Bacteria 2193
37 Ga0207664_10010343 3300025929 Bacteria 6590
38 Ga0207711_10040161 3300025941 Bacteria 3981
39 Ga0207702_10156827 3300026078 Bacteria 2076
40 Ga0207641_10099953 3300026088 Bacteria 2554
41 Ga0207675_100029024 3300026118 Bacteria 5154
42 Ga0207428_10000016 3300027907 Bacteria 327690
43 Ga0268266_10059877 3300028379 Bacteria 3281
44 Ga0268265_10004660 3300028380 Bacteria 9470
45 Ga0307517_10070686 3300028786 Bacteria 3140
46 Ga0265338_10022947 3300028800 Bacteria 6436
47 Ga0265328_10051186 3300031239 Bacteria 1516
48 Ga0265331_10002507 3300031250 Bacteria 12388
49 Ga0265331_10002890 3300031250 Bacteria 11353
50 Ga0307513_10095567 3300031456 Bacteria 3012
51 Ga0307408_100150248 3300031548 Bacteria 1838
52 Ga0265313_10000913 3300031595 Bacteria 29513
53 Ga0265314_10010315 3300031711 Bacteria 7803
54 Ga0307410_10016921 3300031852 Bacteria 4362
55 Ga0307407_10016520 3300031903 Bacteria 3677
56 Ga0307415_100103407 3300032126 Bacteria 2096
57 Ga0373926_0014772 3300035083 Bacteria 2658
58 Ga0373953_0016400 3300035117 Bacteria 2703
59 Ga0373956_0035158 3300035119 Bacteria 2209
60 Ga0373943_0052917 3300035170 Bacteria 2003
61 Ga0373924_0016726 3300035410 Bacteria 2804
62 Ga0373927_0092033 3300035695 Bacteria 1970
63 Ga0373933_0009844 3300035724 Bacteria 5231
64 Ga0373933_0163861 3300035724 Bacteria 1413
65 Ga0373947_0071485 3300035725 Bacteria 2128
66 Ga0373937_0016180 3300036401 Bacteria 6618
67 Ga0373937_0029496 3300036401 Bacteria 4968
68 Ga0395899_0001583 3300037312 Bacteria 19135
69 Ga0395900_0002234 3300037418 Bacteria 21588
70 Ga0395898_0015232 3300037466 Bacteria 7893
71 Ga0436364_0086678 3300037853 Bacteria 3751
72 Ga0436364_0129096 3300037853 Bacteria 8202
73 Ga0436364_0371350 3300037853 Bacteria 19494
74 Ga0436364_0496600 3300037853 Bacteria 5691
75 Ga0436364_0664945 3300037853 Bacteria 22286
76 Ga0436364_1174066 3300037853 Bacteria 2213
77 Ga0436364_1423568 3300037853 Bacteria 6802
78 Ga0436364_1536299 3300037853 Bacteria 3824
79 Ga0395901_0003367 3300038443 Bacteria 16105
80 Ga0436365_0304255 3300039437 Bacteria 6887
81 Ga0436365_0349624 3300039437 Bacteria 2227
82 Ga0436365_1406504 3300039437 Bacteria 4844
83 Ga0436360_0328207 3300039438 Bacteria 1226
84 Ga0436360_0381961 3300039438 Bacteria 4230
85 Ga0436360_0854855 3300039438 Bacteria 3119
86 Ga0436360_1065563 3300039438 Bacteria 3145
87 Ga0436360_1240080 3300039438 Bacteria 1763
88 Ga0436361_0739365 3300039447 Bacteria 2126
89 Ga0436363_0148131 3300039450 Bacteria 3352
90 Ga0436362_1116381 3300039453 Bacteria 5553
91 Ga0451576_0000402 3300045051 Bacteria 100964
92 Ga0451576_0309716 3300045051 Bacteria 1652
93 Ga0495651_0032825 3300046462 Bacteria 4049
94 Ga0495651_0048653 3300046462 Bacteria 3274
95 Ga0495653_0140945 3300046463 Unclassified 1696
96 Ga0495664_0006989 3300046477 Bacteria 6253
97 Ga0495628_0141213 3300046516 Bacteria 1838
98 Ga0495652_0189465 3300046529 Unclassified 1571
99 Ga0495645_0002626 3300046543 Bacteria 12221
100 Ga0495635_0069749 3300046663 Bacteria 2410
101 Ga0495599_0002389 3300046678 Bacteria 10922
102 Ga0495646_0022458 3300046680 Bacteria 3981
103 Ga0495674_0017777 3300047319 Bacteria 6621
104 Ga0495684_0070688 3300047471 Bacteria 2653
105 Ga0495686_0043164 3300047472 Bacteria 2861
106 Ga0496119_0031189 3300048922 Bacteria 3580
107 Ga0501032_0024919 3300049569 Bacteria 4127
108 Ga0501033_0005046 3300049570 Bacteria 10513
109 Ga0501034_0004799 3300049571 Bacteria 14950
110 Ga0501034_0067341 3300049571 Bacteria 3594
111 Ga0501034_0171456 3300049571 Bacteria 2137
112 Ga0501034_0175084 3300049571 Bacteria 2112
113 Ga0501034_0205100 3300049571 Bacteria 1928
114 Ga0501036_0069953 3300049572 Bacteria 2967
115 Ga0501036_0075475 3300049572 Bacteria 2851
116 Ga0501037_0110892 3300049573 Bacteria 1977
117 Ga0501038_0012934 3300049574 Bacteria 7613
118 Ga0501038_0313994 3300049574 Bacteria 1227
119 Ga0501039_0006991 3300049575 Bacteria 8595
120 Ga0501043_0001441 3300049579 Bacteria 20804
121 Ga0501046_0017899 3300049580 Bacteria 5907
122 Ga0501046_0095846 3300049580 Bacteria 2279
123 Ga0501047_0008640 3300049581 Bacteria 9621
124 Ga0501047_0009282 3300049581 Bacteria 9291
125 Ga0501047_0174497 3300049581 Bacteria 2018
126 Ga0501067_0023834 3300049583 Bacteria 3393
127 Ga0501069_0000145 3300049585 Bacteria 31605
128 Ga0501070_0000540 3300049586 Bacteria 34697
129 Ga0501070_0018124 3300049586 Bacteria 5906
130 Ga0501071_0066716 3300049587 Bacteria 2616
131 Ga0501073_0004920 3300049589 Bacteria 10029
132 Ga0501073_0109640 3300049589 Bacteria 1915
133 Ga0501074_0029666 3300049590 Bacteria 3962
134 Ga0501080_0002055 3300049742 Bacteria 17434
135 Ga0501080_0061014 3300049742 Bacteria 3511
136 Ga0501080_0118342 3300049742 Bacteria 2456
137 Ga0501081_0079367 3300049743 Bacteria 2295
138 Ga0501083_0014230 3300049744 Bacteria 5565
139 Ga0501083_0038001 3300049744 Bacteria 3274
140 Ga0501083_0080326 3300049744 Bacteria 2162
141 Ga0501035_0005242 3300049822 Bacteria 12269
142 Ga0501044_0008565 3300049823 Bacteria 11207
143 Ga0501044_0018102 3300049823 Bacteria 7554
144 Ga0501044_0018406 3300049823 Bacteria 7483
145 Ga0501044_0136060 3300049823 Bacteria 2448
146 nmdc:mga05p37_110569_c1 3300050507 Bacteria 3380
147 nmdc:mga08y16_26_c1 3300050511 Bacteria 223965
148 Ga0495601_0001172 3300053077 Bacteria 14349
149 Ga0495612_0002501 3300053078 Bacteria 7583
150 Ga0495619_0018213 3300053085 Bacteria 4454
151 Ga0495619_0259597 3300053085 Bacteria 1204
152 Ga0500578_0028162 3300053086 Bacteria 3610
153 Ga0500641_0004847 3300053096 Bacteria 4764
154 Ga0500595_002992 3300053119 Bacteria 8034
155 Ga0500642_0011846 3300053130 Bacteria 3137
156 Ga0500652_000477 3300053131 Bacteria 14193
157 Ga0500559_0025782 3300053136 Bacteria 2503
158 Ga0500568_0027230 3300053139 Bacteria 2392
159 Ga0500616_0000548 3300053153 Bacteria 46717
160 Ga0500609_000100 3300053731 Bacteria 11160
161 Ga0590071_006407 3300059421 Bacteria 2803
162 Ga0501082_0008160 3300060353 Bacteria 9034
163 Ga0501082_0122551 3300060353 Bacteria 2254
164 2512033920 2511231221 Bacteria 6846400
165 2523106889 2522572158 Bacteria 6514390
166 2524610448 2524023250 Bacteria 5457705
167 2599103492 2597490356 Bacteria 7030811
168 2846953379 2846952575 Bacteria 6587527
169 2848858853 2848858292 Bacteria 7391279
170 2883293009 2883291878 Bacteria 5894118
171 2883356002 2883354860 Bacteria 5865246
172 2894773678 2894772417 Bacteria 5305674
173 2897803642 2897803580 Bacteria 7000062
174 8054004594 8054002106 Bacteria 7987183
175 Ga0501042_0088386
176 JGI25153J46596_10000039
177 Ga0055536_1012056
178 Ga0055531_10015509
179 Ga0070674_100005240
180 Ga0070714_100044199
181 Ga0070713_100005889
182 Ga0070711_100005806
183 Ga0070698_100217206
184 Ga0070679_100045387
185 Ga0070679_100068516
186 Ga0070665_100022670
187 Ga0068856_100188739
188 Ga0068866_10024529
189 Ga0068863_100123208
190 Ga0068862_100006950
191 Ga0081455_10089227
192 Ga0081538_10003364
193 Ga0105240_10355196
194 Ga0111539_10000751
195 Ga0105248_10108253
196 Ga0213875_10000877
197 Ga0213875_10006195
198 Ga0213875_10054677
199 Ga0213875_10082127
200 Ga0213871_10000202
201 Ga0209148_1001047
202 Ga0209455_1000278
203 Ga0209675_1002252
204 Ga0209676_1000089
205 Ga0209758_1000118
206 Ga0209257_1001036
207 Ga0207684_10016690
208 Ga0207707_10121502
209 Ga0207663_10013135
210 Ga0207700_10112507
211 Ga0207664_10010343
212 Ga0207711_10040161
213 Ga0207702_10156827
214 Ga0207641_10099953
215 Ga0207675_100029024
216 Ga0207428_10000016
217 Ga0268266_10059877
218 Ga0268265_10004660
219 Ga0307517_10070686
220 Ga0265338_10022947
221 Ga0265328_10051186
222 Ga0265331_10002507
223 Ga0265331_10002890
224 Ga0307513_10095567
225 Ga0307408_100150248
226 Ga0265313_10000913
227 Ga0265314_10010315
228 Ga0307410_10016921
229 Ga0307407_10016520
230 Ga0307415_100103407
231 Ga0373926_0014772
232 Ga0373953_0016400
233 Ga0373956_0035158
234 Ga0373943_0052917
235 Ga0373924_0016726
236 Ga0373927_0092033
237 Ga0373933_0009844
238 Ga0373933_0163861
239 Ga0373947_0071485
240 Ga0373937_0016180
241 Ga0373937_0029496
242 Ga0395899_0001583
243 Ga0395900_0002234
244 Ga0395898_0015232
245 Ga0436364_0086678
246 Ga0436364_0129096
247 Ga0436364_0371350
248 Ga0436364_0496600
249 Ga0436364_0664945
250 Ga0436364_1174066
251 Ga0436364_1423568
252 Ga0436364_1536299
253 Ga0395901_0003367
254 Ga0436365_0304255
255 Ga0436365_0349624
256 Ga0436365_1406504
257 Ga0436360_0328207
258 Ga0436360_0381961
259 Ga0436360_0854855
260 Ga0436360_1065563
261 Ga0436360_1240080
262 Ga0436361_0739365
263 Ga0436363_0148131
264 Ga0436362_1116381
265 Ga0451576_0000402
266 Ga0451576_0309716
267 Ga0495651_0032825
268 Ga0495651_0048653
269 Ga0495653_0140945
270 Ga0495664_0006989
271 Ga0495628_0141213
272 Ga0495652_0189465
273 Ga0495645_0002626
274 Ga0495635_0069749
275 Ga0495599_0002389
276 Ga0495646_0022458
277 Ga0495674_0017777
278 Ga0495684_0070688
279 Ga0495686_0043164
280 Ga0496119_0031189
281 Ga0501032_0024919
282 Ga0501033_0005046
283 Ga0501034_0004799
284 Ga0501034_0067341
285 Ga0501034_0171456
286 Ga0501034_0175084
287 Ga0501034_0205100
288 Ga0501036_0069953
289 Ga0501036_0075475
290 Ga0501037_0110892
291 Ga0501038_0012934
292 Ga0501038_0313994
293 Ga0501039_0006991
294 Ga0501043_0001441
295 Ga0501046_0017899
296 Ga0501046_0095846
297 Ga0501047_0008640
298 Ga0501047_0009282
299 Ga0501047_0174497
300 Ga0501067_0023834
301 Ga0501069_0000145
302 Ga0501070_0000540
303 Ga0501070_0018124
304 Ga0501071_0066716
305 Ga0501073_0004920
306 Ga0501073_0109640
307 Ga0501074_0029666
308 Ga0501080_0002055
309 Ga0501080_0061014
310 Ga0501080_0118342
311 Ga0501081_0079367
312 Ga0501083_0014230
313 Ga0501083_0038001
314 Ga0501083_0080326
315 Ga0501035_0005242
316 Ga0501044_0008565
317 Ga0501044_0018102
318 Ga0501044_0018406
319 Ga0501044_0136060
320 nmdc:mga05p37_110569_c1
321 nmdc:mga08y16_26_c1
322 Ga0495601_0001172
323 Ga0495612_0002501
324 Ga0495619_0018213
325 Ga0495619_0259597
326 Ga0500578_0028162
327 Ga0500641_0004847
328 Ga0500595_002992
329 Ga0500642_0011846
330 Ga0500652_000477
331 Ga0500559_0025782
332 Ga0500568_0027230
333 Ga0500616_0000548
334 Ga0500609_000100
335 Ga0590071_006407
336 Ga0501082_0008160
337 Ga0501082_0122551
338 2512033920
339 2523106889
340 2524610448
341 2599103492
342 2846953379
343 2848858853
344 2883293009
345 2883356002
346 2894773678
347 2897803642
348 8054004594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02491

SHS2_FTSA

SHS2 domain inserted in FTSA

114

191

0.99

PF14450

FtsA

Cell division protein FtsA

236

406

0.94

PF06723

MreB_Mbl

MreB/Mbl protein

217

387

0.87

PF14450

FtsA

Cell division protein FtsA

40

224

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7q6i-assembly2.cif.gz_B vibrio maritimus ftsa 1-396 atp and ftsn 1-29, bent tetramers in double filament arrangement 0.9455 12 385
7q6i-assembly4.cif.gz_D vibrio maritimus ftsa 1-396 atp and ftsn 1-29, bent tetramers in double filament arrangement 0.9338 12 385
7q6i-assembly2.cif.gz_B vibrio maritimus ftsa 1-396 atp and ftsn 1-29, bent tetramers in double filament arrangement 0.9216 12 385
7q6i-assembly4.cif.gz_D vibrio maritimus ftsa 1-396 atp and ftsn 1-29, bent tetramers in double filament arrangement 0.9213 12 385
7q6d-assembly1.cif.gz_A e. coli ftsa 1-405 atp 3 ni 0.9144 9 384
ID Description Score Start End Superfamily
3wqtB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9253 200 361 3.30.420.40
af_P0ABH0_1_81_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9237 6 82 3.30.420.40
3wqtB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9189 200 361 3.30.420.40
af_O07325_1_80_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9161 8 86 3.30.420.40
2ychA03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9129 206 355 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A356T2T3-F1-model_v4 Cell division protein FtsA 0.9644 8 384 GO:0009898
GO:0032153
GO:0051301
AF-A0A524JIP4-F1-model_v4 Cell division protein FtsA 0.9616 9 269 GO:0009898
GO:0032153
GO:0051301
AF-A0A3D2A6E6-F1-model_v4 Cell division protein FtsA 0.9595 8 385 GO:0009898
GO:0032153
GO:0043093
AF-A0A177QDY7-F1-model_v4 Cell division protein FtsA 0.959 9 395 GO:0009898
GO:0032153
GO:0043093
AF-A0A2D5JNA7-F1-model_v4 Cell division protein FtsA 0.9588 9 270 GO:0009898
GO:0032153
GO:0051301

Map