F255238

General Info

Members Datasets Scaffolds Average Seq Length
169 131 168 392

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0072851|Ga0451577_0072851_57_1496
Length 457
Sequence MRADFFALMQNSRFAMPGGNAAGRLDPWFQIQPRTSMRRFLPLLCLLPLPVFAAGNLPTVGGIPVDFVLFALTLLGVALFHNYTLYVALTGLVTISLYKILFAGFKTGVGVAGFVGHLGHEWVTVANLFCLLTGFALLARHFEKSHLPNILPKFLPDDWKGGFLLLVMVFVISSFLDNIAAALIGGAMAHQLFKAKVHVGYLAAWIDGISPAVVVDAYVAAGLALVITGYFAAKQQHAYSPIIKNGKAHTHVDWGRIFIVVTMLVFAVATNITINVNFPEMAEHFPFIGVAVWAAILLTIPVRRHDWELLPDAVKGSVFLLSLVLCASMMPVEELPPASWQSALTLGFVSAVFDNIPLTALSLRQGGYDWGFLAYAVGFGGSMLWFGSSAGVALSNMFPEAKSAAQWLKHGWHVTVAYVVGFFFMLMVLGWHPDEGHKKVVAPAVAETPAAAPAAGQ

Samples

Sample ID Description Type Environment
1 2547132512 Azospira oryzae 6a3 Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
86 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
87 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
88 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
89 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
90 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.37
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000325 3300003203 Bacteria 21471
2 JGI25405J52794_10001135 3300003911 Bacteria 4276
3 Ga0065707_10081829 3300005295 Bacteria 35507
4 Ga0070670_100016071 3300005331 Bacteria 6424
5 Ga0070670_100036144 3300005331 Bacteria 4251
6 Ga0070677_10002795 3300005333 Bacteria 5591
7 Ga0068869_100009006 3300005334 Bacteria 6466
8 Ga0070666_10026721 3300005335 Bacteria 3774
9 Ga0070675_100005916 3300005354 Bacteria 9369
10 Ga0070675_100013498 3300005354 Bacteria 6420
11 Ga0070674_100026378 3300005356 Bacteria 3794
12 Ga0070673_100056954 3300005364 Bacteria 3086
13 Ga0070673_100059052 3300005364 Bacteria 3035
14 Ga0070673_100187098 3300005364 Unclassified 1776
15 Ga0070667_100000069 3300005367 Bacteria 126807
16 Ga0070678_100053226 3300005456 Bacteria 2943
17 Ga0070678_100158946 3300005456 Bacteria 1829
18 Ga0068867_100038790 3300005459 Bacteria 3469
19 Ga0070685_10006508 3300005466 Bacteria 5956
20 Ga0070707_100038952 3300005468 Bacteria 4541
21 Ga0070672_100012393 3300005543 Bacteria 5984
22 Ga0070665_100295433 3300005548 Bacteria 1623
23 Ga0068859_100014932 3300005617 Bacteria 7796
24 Ga0068861_100067143 3300005719 Bacteria 2767
25 Ga0068863_100028854 3300005841 Bacteria 5299
26 Ga0068863_100055620 3300005841 Unclassified 3747
27 Ga0068858_100076832 3300005842 Bacteria 3102
28 Ga0068860_100063753 3300005843 Bacteria 3500
29 Ga0081455_10000256 3300005937 Bacteria 69912
30 Ga0081455_10006964 3300005937 Bacteria 12016
31 Ga0081539_10000313 3300005985 Bacteria 108469
32 Ga0097621_100228560 3300006237 Bacteria 1624
33 Ga0068871_100060449 3300006358 Bacteria 3091
34 Ga0068871_100129705 3300006358 Bacteria 2137
35 Ga0075433_10000413 3300006852 Bacteria 27217
36 Ga0075434_100007326 3300006871 Bacteria 10210
37 Ga0075429_100199057 3300006880 Bacteria 1755
38 Ga0097620_100014933 3300006931 Bacteria 7796
39 Ga0099794_10010824 3300007265 Bacteria 3885
40 Ga0099795_10054069 3300007788 Bacteria 1471
41 Ga0111539_10029405 3300009094 Bacteria 6692
42 Ga0105245_10057073 3300009098 Bacteria 3511
43 Ga0105242_10030967 3300009176 Bacteria 4272
44 Ga0105248_10016527 3300009177 Bacteria 8125
45 Ga0105249_10262448 3300009553 Bacteria 1717
46 Ga0105239_10109139 3300010375 Unclassified 3066
47 Ga0157378_10004282 3300013297 Bacteria 12566
48 Ga0157378_10198806 3300013297 Bacteria 1895
49 Ga0163162_10016539 3300013306 Bacteria 7209
50 Ga0163162_10089764 3300013306 Bacteria 3154
51 Ga0157375_10034204 3300013308 Bacteria 4839
52 Ga0163163_10009619 3300014325 Bacteria 8642
53 Ga0157380_10000018 3300014326 Bacteria 116537
54 Ga0157380_10049937 3300014326 Bacteria 3302
55 Ga0157376_10250156 3300014969 Bacteria 1655
56 Ga0207682_10002023 3300025893 Bacteria 9177
57 Ga0207682_10013394 3300025893 Bacteria 3195
58 Ga0207680_10022718 3300025903 Bacteria 3415
59 Ga0207643_10002533 3300025908 Bacteria 9891
60 Ga0207649_10082101 3300025920 Bacteria 2089
61 Ga0207652_10229377 3300025921 Bacteria 1673
62 Ga0207650_10030431 3300025925 Bacteria 3888
63 Ga0207669_10055251 3300025937 Bacteria 2403
64 Ga0207665_10020640 3300025939 Bacteria 4330
65 Ga0207691_10025184 3300025940 Bacteria 5588
66 Ga0207691_10027012 3300025940 Bacteria 5386
67 Ga0207691_10074519 3300025940 Bacteria 3061
68 Ga0207711_10109105 3300025941 Bacteria 2459
69 Ga0207689_10014057 3300025942 Bacteria 6812
70 Ga0207651_10173892 3300025960 Bacteria 1701
71 Ga0207712_10165266 3300025961 Bacteria 1724
72 Ga0207658_10000038 3300025986 Bacteria 145669
73 Ga0207703_10009153 3300026035 Bacteria 7796
74 Ga0207703_10072852 3300026035 Bacteria 2840
75 Ga0207648_10048751 3300026089 Bacteria 3708
76 Ga0207675_100072445 3300026118 Bacteria 3222
77 Ga0207675_100142328 3300026118 Bacteria 2279
78 Ga0207683_10053266 3300026121 Bacteria 3547
79 Ga0209588_1004864 3300027671 Bacteria 3819
80 Ga0268266_10184105 3300028379 Bacteria 1904
81 Ga0268264_10190201 3300028381 Bacteria 1870
82 Ga0265338_10205614 3300028800 Bacteria 1482
83 Ga0265332_10000004 3300031238 Bacteria 426592
84 Ga0265320_10004417 3300031240 Bacteria 9224
85 Ga0265327_10013601 3300031251 Bacteria 5394
86 Ga0307513_10013851 3300031456 Bacteria 9884
87 Ga0307513_10032095 3300031456 Bacteria 5929
88 Ga0307405_10137096 3300031731 Bacteria 1700
89 Ga0307413_10050078 3300031824 Bacteria 2507
90 Ga0307410_10028038 3300031852 Bacteria 3566
91 Ga0307406_10019387 3300031901 Bacteria 3991
92 Ga0307406_10048525 3300031901 Bacteria 2682
93 Ga0307407_10072044 3300031903 Bacteria 2059
94 Ga0307412_10019779 3300031911 Bacteria 4085
95 Ga0307409_100016206 3300031995 Bacteria 4923
96 Ga0307409_100024045 3300031995 Bacteria 4239
97 Ga0307416_100010658 3300032002 Bacteria 6086
98 Ga0307411_10018760 3300032005 Bacteria 3978
99 Ga0307411_10025497 3300032005 Bacteria 3544
100 Ga0307415_100000521 3300032126 Bacteria 16746
101 Ga0307415_100175589 3300032126 Bacteria 1675
102 Ga0373950_0000017 3300034818 Bacteria 271422
103 Ga0373955_0066562 3300035172 Bacteria 2003
104 Ga0373937_0014191 3300036401 Bacteria 7029
105 Ga0373937_0127206 3300036401 Bacteria 2378
106 Ga0451800_0351291 3300041459 Bacteria 5716
107 Ga0450892_002455 3300042130 Bacteria 1581
108 Ga0450896_000658 3300042133 Bacteria 3785
109 Ga0439446_0002730 3300042156 Bacteria 4273
110 Ga0439444_0001040 3300042437 Bacteria 3439
111 Ga0450918_004095 3300042531 Bacteria 2673
112 Ga0451577_0017880 3300042876 Bacteria 6541
113 Ga0451577_0072851 3300042876 Bacteria 3065
114 Ga0451577_0086151 3300042876 Unclassified 2803
115 Ga0453684_0000046 3300044712 Bacteria 575242
116 Ga0453684_0000692 3300044712 Bacteria 120085
117 Ga0453684_0239527 3300044712 Bacteria 2089
118 Ga0451576_0000168 3300045051 Bacteria 165624
119 Ga0451576_0001378 3300045051 Bacteria 41772
120 Ga0495638_0089087 3300046460 Bacteria 1862
121 Ga0495664_0028233 3300046477 Bacteria 3277
122 Ga0495616_0039346 3300046513 Bacteria 2422
123 Ga0495628_0014918 3300046516 Bacteria 6499
124 Ga0495632_0036863 3300046519 Bacteria 2485
125 Ga0495652_0167105 3300046529 Bacteria 1702
126 Ga0495667_0015988 3300046559 Bacteria 5071
127 Ga0495634_0002690 3300046642 Bacteria 14611
128 Ga0495625_0003602 3300046660 Bacteria 15224
129 Ga0495625_0009239 3300046660 Bacteria 8276
130 Ga0495625_0066679 3300046660 Bacteria 2535
131 Ga0495674_0014100 3300047319 Bacteria 7488
132 Ga0495615_0006263 3300048090 Bacteria 2193
133 Ga0496110_0141812 3300048913 Bacteria 2172
134 Ga0496111_0013641 3300048914 Bacteria 5536
135 Ga0496114_0019124 3300048917 Bacteria 5550
136 Ga0501034_0000019 3300049571 Bacteria 282405
137 Ga0501039_0065792 3300049575 Bacteria 2813
138 Ga0501043_0000381 3300049579 Bacteria 40297
139 Ga0501046_0003165 3300049580 Bacteria 15199
140 Ga0501047_0000007 3300049581 Bacteria 443240
141 Ga0501048_0001261 3300049582 Bacteria 19137
142 Ga0501067_0010826 3300049583 Bacteria 5046
143 Ga0501068_0000244 3300049584 Bacteria 26692
144 Ga0501068_0001212 3300049584 Bacteria 13710
145 Ga0501069_0049982 3300049585 Bacteria 2325
146 Ga0501070_0001112 3300049586 Bacteria 24145
147 Ga0501071_0006706 3300049587 Bacteria 7484
148 Ga0501072_0000084 3300049588 Bacteria 69297
149 Ga0501072_0179473 3300049588 Bacteria 1689
150 Ga0501073_0001640 3300049589 Bacteria 16596
151 Ga0501073_0002895 3300049589 Bacteria 12869
152 Ga0501073_0154321 3300049589 Bacteria 1591
153 Ga0501074_0000069 3300049590 Bacteria 49518
154 Ga0501074_0000542 3300049590 Bacteria 23258
155 Ga0501074_0045274 3300049590 Bacteria 3184
156 Ga0501076_0036673 3300049592 Bacteria 3842
157 Ga0501079_0002320 3300049741 Bacteria 13783
158 Ga0501079_0003059 3300049741 Bacteria 12240
159 Ga0501080_0001174 3300049742 Bacteria 21694
160 Ga0501080_0014512 3300049742 Bacteria 7257
161 Ga0501083_0003635 3300049744 Bacteria 10827
162 nmdc:mga09592_35929_c1 3300050508 Bacteria 4149
163 nmdc:mga08y16_110487_c1 3300050511 Bacteria 2863
164 nmdc:mga0a205_73_c1 3300050515 Bacteria 55159
165 Ga0495619_0000136 3300053085 Bacteria 54722
166 Ga0501084_0000043 3300054114 Bacteria 98202
167 Ga0501084_0002850 3300054114 Bacteria 13972
168 Ga0501082_0003958 3300060353 Bacteria 12931

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025921 Ga0207652_10229377 Ga0207652_102293771 338
2 3300048917 Ga0496114_0019124 Ga0496114_0019124_436_1656 340
3 3300026035 Ga0207703_10009153 Ga0207703_100091537 350
4 3300044712 Ga0453684_0239527 Ga0453684_0239527_99_1385 353
5 3300014326 Ga0157380_10000018 Ga0157380_1000001827 354
6 3300032005 Ga0307411_10025497 Ga0307411_100254972 354
7 3300031911 Ga0307412_10019779 Ga0307412_100197792 356
8 3300031995 Ga0307409_100016206 Ga0307409_1000162062 356
9 3300031995 Ga0307409_100024045 Ga0307409_1000240453 356
10 3300032002 Ga0307416_100010658 Ga0307416_1000106585 356
11 3300032126 Ga0307415_100000521 Ga0307415_10000052113 356
12 3300042876 Ga0451577_0086151 Ga0451577_0086151_288_1574 361
13 3300005295 Ga0065707_10081829 Ga0065707_1008182917 362
14 3300006852 Ga0075433_10000413 Ga0075433_1000041318 363
15 3300006871 Ga0075434_100007326 Ga0075434_1000073262 363
16 3300007788 Ga0099795_10054069 Ga0099795_100540691 363
17 3300050515 nmdc:mga0a205_73_c1 nmdc:mga0a205_73_c1_6227_7414 363
18 3300005331 Ga0070670_100036144 Ga0070670_1000361443 364
19 3300025920 Ga0207649_10082101 Ga0207649_100821013 364
20 3300025940 Ga0207691_10074519 Ga0207691_100745193 364
21 3300005937 Ga0081455_10006964 Ga0081455_100069647 365
22 3300014325 Ga0163163_10009619 Ga0163163_100096196 366
23 3300031852 Ga0307410_10028038 Ga0307410_100280383 366
24 3300031901 Ga0307406_10048525 Ga0307406_100485252 366
25 3300031903 Ga0307407_10072044 Ga0307407_100720442 366
26 3300042156 Ga0439446_0002730 Ga0439446_0002730_692_1879 366
27 3300042437 Ga0439444_0001040 Ga0439444_0001040_678_1865 366
28 3300049571 Ga0501034_0000019 Ga0501034_0000019_62087_63307 366
29 3300049579 Ga0501043_0000381 Ga0501043_0000381_874_2094 366
30 3300049580 Ga0501046_0003165 Ga0501046_0003165_5395_6615 366
31 3300049581 Ga0501047_0000007 Ga0501047_0000007_379676_380896 366
32 3300049582 Ga0501048_0001261 Ga0501048_0001261_12172_13392 366
33 3300049584 Ga0501068_0001212 Ga0501068_0001212_6209_7429 366
34 3300049585 Ga0501069_0049982 Ga0501069_0049982_283_1503 366
35 3300049586 Ga0501070_0001112 Ga0501070_0001112_16557_17777 366
36 3300049588 Ga0501072_0000084 Ga0501072_0000084_44362_45582 366
37 3300049589 Ga0501073_0002895 Ga0501073_0002895_9102_10322 366
38 3300049590 Ga0501074_0000069 Ga0501074_0000069_18742_19962 366
39 3300049741 Ga0501079_0002320 Ga0501079_0002320_3851_5071 366
40 3300049742 Ga0501080_0001174 Ga0501080_0001174_9283_10503 366
41 3300049744 Ga0501083_0003635 Ga0501083_0003635_5395_6615 366
42 3300054114 Ga0501084_0000043 Ga0501084_0000043_62334_63554 366
43 3300060353 Ga0501082_0003958 Ga0501082_0003958_5523_6743 366
44 3300034818 Ga0373950_0000017 Ga0373950_0000017_71640_72848 369
45 3300006880 Ga0075429_100199057 Ga0075429_1001990572 370
46 3300035172 Ga0373955_0066562 Ga0373955_0066562_569_1774 370
47 3300046477 Ga0495664_0028233 Ga0495664_0028233_899_2104 370
48 3300046516 Ga0495628_0014918 Ga0495628_0014918_552_1757 370
49 3300046642 Ga0495634_0002690 Ga0495634_0002690_12348_13553 370
50 3300047319 Ga0495674_0014100 Ga0495674_0014100_1514_2719 370
51 3300005331 Ga0070670_100016071 Ga0070670_1000160715 371
52 3300005842 Ga0068858_100076832 Ga0068858_1000768323 371
53 3300025925 Ga0207650_10030431 Ga0207650_100304314 371
54 3300026035 Ga0207703_10072852 Ga0207703_100728523 371
55 3300031731 Ga0307405_10137096 Ga0307405_101370962 371
56 3300031824 Ga0307413_10050078 Ga0307413_100500782 371
57 3300031901 Ga0307406_10019387 Ga0307406_100193873 371
58 3300032005 Ga0307411_10018760 Ga0307411_100187603 371
59 3300036401 Ga0373937_0127206 Ga0373937_0127206_723_1922 371
60 3300041459 Ga0451800_0351291 Ga0451800_0351291_302_1507 371
61 3300042130 Ga0450892_002455 Ga0450892_002455_242_1426 371
62 3300046519 Ga0495632_0036863 Ga0495632_0036863_461_1663 371
63 3300049588 Ga0501072_0179473 Ga0501072_0179473_248_1435 371
64 3300005333 Ga0070677_10002795 Ga0070677_100027955 372
65 3300005334 Ga0068869_100009006 Ga0068869_1000090063 372
66 3300005354 Ga0070675_100005916 Ga0070675_1000059162 372
67 3300005354 Ga0070675_100013498 Ga0070675_1000134986 372
68 3300005356 Ga0070674_100026378 Ga0070674_1000263782 372
69 3300005364 Ga0070673_100056954 Ga0070673_1000569542 372
70 3300005364 Ga0070673_100059052 Ga0070673_1000590524 372
71 3300005364 Ga0070673_100187098 Ga0070673_1001870982 372
72 3300005456 Ga0070678_100053226 Ga0070678_1000532264 372
73 3300005456 Ga0070678_100158946 Ga0070678_1001589461 372
74 3300005459 Ga0068867_100038790 Ga0068867_1000387902 372
75 3300005466 Ga0070685_10006508 Ga0070685_100065083 372
76 3300005543 Ga0070672_100012393 Ga0070672_1000123938 372
77 3300005548 Ga0070665_100295433 Ga0070665_1002954331 372
78 3300005617 Ga0068859_100014932 Ga0068859_1000149324 372
79 3300005719 Ga0068861_100067143 Ga0068861_1000671432 372
80 3300005841 Ga0068863_100055620 Ga0068863_1000556205 372
81 3300005843 Ga0068860_100063753 Ga0068860_1000637532 372
82 3300006358 Ga0068871_100060449 Ga0068871_1000604492 372
83 3300006931 Ga0097620_100014933 Ga0097620_1000149337 372
84 3300009176 Ga0105242_10030967 Ga0105242_100309672 372
85 3300009177 Ga0105248_10016527 Ga0105248_1001652710 372
86 3300010375 Ga0105239_10109139 Ga0105239_101091394 372
87 3300013306 Ga0163162_10089764 Ga0163162_100897643 372
88 3300013308 Ga0157375_10034204 Ga0157375_100342044 372
89 3300014969 Ga0157376_10250156 Ga0157376_102501561 372
90 3300025893 Ga0207682_10002023 Ga0207682_100020234 372
91 3300025893 Ga0207682_10013394 Ga0207682_100133943 372
92 3300025908 Ga0207643_10002533 Ga0207643_100025334 372
93 3300025937 Ga0207669_10055251 Ga0207669_100552513 372
94 3300025940 Ga0207691_10025184 Ga0207691_100251843 372
95 3300025940 Ga0207691_10027012 Ga0207691_100270123 372
96 3300025941 Ga0207711_10109105 Ga0207711_101091052 372
97 3300025942 Ga0207689_10014057 Ga0207689_100140571 372
98 3300025960 Ga0207651_10173892 Ga0207651_101738922 372
99 3300026089 Ga0207648_10048751 Ga0207648_100487513 372
100 3300026118 Ga0207675_100072445 Ga0207675_1000724452 372
101 3300026121 Ga0207683_10053266 Ga0207683_100532663 372
102 3300028379 Ga0268266_10184105 Ga0268266_101841051 372
103 3300028381 Ga0268264_10190201 Ga0268264_101902011 372
104 3300031251 Ga0265327_10013601 Ga0265327_100136013 372
105 3300046460 Ga0495638_0089087 Ga0495638_0089087_637_1836 372
106 3300046513 Ga0495616_0039346 Ga0495616_0039346_1109_2308 372
107 3300046660 Ga0495625_0066679 Ga0495625_0066679_757_1956 372
108 3300007265 Ga0099794_10010824 Ga0099794_100108241 373
109 3300009094 Ga0111539_10029405 Ga0111539_1002940510 373
110 3300014326 Ga0157380_10049937 Ga0157380_100499373 373
111 3300025939 Ga0207665_10020640 Ga0207665_100206402 373
112 3300027671 Ga0209588_1004864 Ga0209588_10048642 373
113 3300031456 Ga0307513_10013851 Ga0307513_1001385111 373
114 3300032126 Ga0307415_100175589 Ga0307415_1001755891 373
115 3300036401 Ga0373937_0014191 Ga0373937_0014191_2253_3548 373
116 3300042876 Ga0451577_0072851 Ga0451577_0072851_57_1496 373
117 3300045051 Ga0451576_0000168 Ga0451576_0000168_23611_25014 373
118 3300046529 Ga0495652_0167105 Ga0495652_0167105_240_1535 373
119 3300046559 Ga0495667_0015988 Ga0495667_0015988_635_1930 373
120 3300048090 Ga0495615_0006263 Ga0495615_0006263_311_1561 373
121 3300050508 nmdc:mga09592_35929_c1 nmdc:mga09592_35929_c1_2269_3579 373
122 3300050511 nmdc:mga08y16_110487_c1 nmdc:mga08y16_110487_c1_1235_2422 373
123 3300053085 Ga0495619_0000136 Ga0495619_0000136_44832_46127 373
124 3300042133 Ga0450896_000658 Ga0450896_000658_261_1454 374
125 3300042531 Ga0450918_004095 Ga0450918_004095_946_2139 374
126 3300046660 Ga0495625_0003602 Ga0495625_0003602_10638_11843 374
127 3300049583 Ga0501067_0010826 Ga0501067_0010826_383_1588 374
128 3300049584 Ga0501068_0000244 Ga0501068_0000244_12338_13543 374
129 3300049587 Ga0501071_0006706 Ga0501071_0006706_3246_4451 374
130 3300049589 Ga0501073_0001640 Ga0501073_0001640_1160_2365 374
131 3300049590 Ga0501074_0000542 Ga0501074_0000542_6406_7611 374
132 3300049592 Ga0501076_0036673 Ga0501076_0036673_430_1635 374
133 3300049741 Ga0501079_0003059 Ga0501079_0003059_4872_6077 374
134 3300049742 Ga0501080_0014512 Ga0501080_0014512_4260_5465 374
135 3300054114 Ga0501084_0002850 Ga0501084_0002850_5316_6521 374
136 3300005335 Ga0070666_10026721 Ga0070666_100267212 375
137 3300005367 Ga0070667_100000069 Ga0070667_10000006948 375
138 3300005841 Ga0068863_100028854 Ga0068863_1000288542 375
139 3300009553 Ga0105249_10262448 Ga0105249_102624482 375
140 3300025903 Ga0207680_10022718 Ga0207680_100227183 375
141 3300025961 Ga0207712_10165266 Ga0207712_101652662 375
142 3300025986 Ga0207658_10000038 Ga0207658_1000003866 375
143 3300044712 Ga0453684_0000692 Ga0453684_0000692_64382_65692 375
144 3300046660 Ga0495625_0009239 Ga0495625_0009239_5683_6888 375
145 3300048913 Ga0496110_0141812 Ga0496110_0141812_313_1701 375
146 3300048914 Ga0496111_0013641 Ga0496111_0013641_3895_5283 375
147 3300049575 Ga0501039_0065792 Ga0501039_0065792_1154_2347 375
148 3300028800 Ga0265338_10205614 Ga0265338_102056141 376
149 3300031240 Ga0265320_10004417 Ga0265320_100044173 376
150 3300049589 Ga0501073_0154321 Ga0501073_0154321_270_1487 376
151 3300049590 Ga0501074_0045274 Ga0501074_0045274_1807_3024 376
152 3300006237 Ga0097621_100228560 Ga0097621_1002285602 377
153 3300006358 Ga0068871_100129705 Ga0068871_1001297052 377
154 3300031238 Ga0265332_10000004 Ga0265332_10000004115 377
155 3300044712 Ga0453684_0000046 Ga0453684_0000046_440448_441794 377
156 3300042876 Ga0451577_0017880 Ga0451577_0017880_149_1333 380
157 3300031456 Ga0307513_10032095 Ga0307513_100320953 381
158 3300045051 Ga0451576_0001378 Ga0451576_0001378_35225_36484 382
159 3300003203 JGI25406J46586_10000325 JGI25406J46586_100003255 383
160 3300003911 JGI25405J52794_10001135 JGI25405J52794_100011352 383
161 3300005468 Ga0070707_100038952 Ga0070707_1000389525 383
162 3300005937 Ga0081455_10000256 Ga0081455_1000025628 383
163 3300005985 Ga0081539_10000313 Ga0081539_1000031316 383
164 3300009098 Ga0105245_10057073 Ga0105245_100570731 383
165 3300013297 Ga0157378_10004282 Ga0157378_100042828 383
166 3300013297 Ga0157378_10198806 Ga0157378_101988062 383
167 3300013306 Ga0163162_10016539 Ga0163162_100165393 383
168 3300026118 Ga0207675_100142328 Ga0207675_1001423282 383
169 iso_pu_bacteria 2547132512 2548848229 383

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wu1-assembly1.cif.gz_A structure of apo laindy 0.5479 28 379
6wu1-assembly1.cif.gz_A structure of apo laindy 0.5144 28 379
6ol1-assembly1.cif.gz_B structure of vcindy in complex with succinate 0.5097 7 378
5uld-assembly2.cif.gz_C structure and function of the divalent anion/na+ symporter from vibrio cholerae and a humanized variant 0.5087 7 378
6ol1-assembly1.cif.gz_B structure of vcindy in complex with succinate 0.4991 7 378
ID Description Score Start End Superfamily
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6888 7 376 1.20.1530.20
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6696 7 376 1.20.1530.20
af_Q9P6J7_45_305_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2572 63 254 1.20.1250.20
af_A0A1D8PDF5_68_305_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2307 138 329 1.20.1070.10
af_P36554_12_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2227 73 377 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2K8U223-F1-model_v4 Citrate transporter 0.9777 4 381 GO:0006814
GO:0015297
GO:0016020
AF-Q6N733-F1-model_v4 Citrate transporter 0.9769 1 381 GO:0006814
GO:0015297
GO:0016020
AF-C0INR8-F1-model_v4 Citrate transporter 0.9759 1 382 GO:0006814
GO:0015297
GO:0016020
AF-C0INR8-F1-model_v4 Citrate transporter 0.9734 1 382 GO:0006814
GO:0015297
GO:0016020
AF-A0A351BNE3-F1-model_v4 Citrate transporter 0.9723 279 381 GO:0016020

Feature Viewer

pLDDT pTM Quality
91.25 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map