F255238
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 169 | 131 | 168 | 392 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0072851|Ga0451577_0072851_57_1496 |
| Length | 457 |
| Sequence | MRADFFALMQNSRFAMPGGNAAGRLDPWFQIQPRTSMRRFLPLLCLLPLPVFAAGNLPTVGGIPVDFVLFALTLLGVALFHNYTLYVALTGLVTISLYKILFAGFKTGVGVAGFVGHLGHEWVTVANLFCLLTGFALLARHFEKSHLPNILPKFLPDDWKGGFLLLVMVFVISSFLDNIAAALIGGAMAHQLFKAKVHVGYLAAWIDGISPAVVVDAYVAAGLALVITGYFAAKQQHAYSPIIKNGKAHTHVDWGRIFIVVTMLVFAVATNITINVNFPEMAEHFPFIGVAVWAAILLTIPVRRHDWELLPDAVKGSVFLLSLVLCASMMPVEELPPASWQSALTLGFVSAVFDNIPLTALSLRQGGYDWGFLAYAVGFGGSMLWFGSSAGVALSNMFPEAKSAAQWLKHGWHVTVAYVVGFFFMLMVLGWHPDEGHKKVVAPAVAETPAAAPAAGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 15 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 20 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 21 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 22 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 23 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 24 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 25 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 28 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 29 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 30 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 31 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 33 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 34 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 68 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 69 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 70 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 71 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 72 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 73 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 74 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 75 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 76 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 77 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 78 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 79 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 80 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 81 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 82 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 83 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 84 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 85 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 86 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 87 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 88 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 89 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 90 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 91 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 92 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 93 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 94 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 106 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 107 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 108 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 129 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 131 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.41 |
| Metatranscriptomes | 0 |
| Isolates | 0.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.37 |
| Rhizosphere | 95.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000325 | 3300003203 | Bacteria | 21471 |
| 2 | JGI25405J52794_10001135 | 3300003911 | Bacteria | 4276 |
| 3 | Ga0065707_10081829 | 3300005295 | Bacteria | 35507 |
| 4 | Ga0070670_100016071 | 3300005331 | Bacteria | 6424 |
| 5 | Ga0070670_100036144 | 3300005331 | Bacteria | 4251 |
| 6 | Ga0070677_10002795 | 3300005333 | Bacteria | 5591 |
| 7 | Ga0068869_100009006 | 3300005334 | Bacteria | 6466 |
| 8 | Ga0070666_10026721 | 3300005335 | Bacteria | 3774 |
| 9 | Ga0070675_100005916 | 3300005354 | Bacteria | 9369 |
| 10 | Ga0070675_100013498 | 3300005354 | Bacteria | 6420 |
| 11 | Ga0070674_100026378 | 3300005356 | Bacteria | 3794 |
| 12 | Ga0070673_100056954 | 3300005364 | Bacteria | 3086 |
| 13 | Ga0070673_100059052 | 3300005364 | Bacteria | 3035 |
| 14 | Ga0070673_100187098 | 3300005364 | Unclassified | 1776 |
| 15 | Ga0070667_100000069 | 3300005367 | Bacteria | 126807 |
| 16 | Ga0070678_100053226 | 3300005456 | Bacteria | 2943 |
| 17 | Ga0070678_100158946 | 3300005456 | Bacteria | 1829 |
| 18 | Ga0068867_100038790 | 3300005459 | Bacteria | 3469 |
| 19 | Ga0070685_10006508 | 3300005466 | Bacteria | 5956 |
| 20 | Ga0070707_100038952 | 3300005468 | Bacteria | 4541 |
| 21 | Ga0070672_100012393 | 3300005543 | Bacteria | 5984 |
| 22 | Ga0070665_100295433 | 3300005548 | Bacteria | 1623 |
| 23 | Ga0068859_100014932 | 3300005617 | Bacteria | 7796 |
| 24 | Ga0068861_100067143 | 3300005719 | Bacteria | 2767 |
| 25 | Ga0068863_100028854 | 3300005841 | Bacteria | 5299 |
| 26 | Ga0068863_100055620 | 3300005841 | Unclassified | 3747 |
| 27 | Ga0068858_100076832 | 3300005842 | Bacteria | 3102 |
| 28 | Ga0068860_100063753 | 3300005843 | Bacteria | 3500 |
| 29 | Ga0081455_10000256 | 3300005937 | Bacteria | 69912 |
| 30 | Ga0081455_10006964 | 3300005937 | Bacteria | 12016 |
| 31 | Ga0081539_10000313 | 3300005985 | Bacteria | 108469 |
| 32 | Ga0097621_100228560 | 3300006237 | Bacteria | 1624 |
| 33 | Ga0068871_100060449 | 3300006358 | Bacteria | 3091 |
| 34 | Ga0068871_100129705 | 3300006358 | Bacteria | 2137 |
| 35 | Ga0075433_10000413 | 3300006852 | Bacteria | 27217 |
| 36 | Ga0075434_100007326 | 3300006871 | Bacteria | 10210 |
| 37 | Ga0075429_100199057 | 3300006880 | Bacteria | 1755 |
| 38 | Ga0097620_100014933 | 3300006931 | Bacteria | 7796 |
| 39 | Ga0099794_10010824 | 3300007265 | Bacteria | 3885 |
| 40 | Ga0099795_10054069 | 3300007788 | Bacteria | 1471 |
| 41 | Ga0111539_10029405 | 3300009094 | Bacteria | 6692 |
| 42 | Ga0105245_10057073 | 3300009098 | Bacteria | 3511 |
| 43 | Ga0105242_10030967 | 3300009176 | Bacteria | 4272 |
| 44 | Ga0105248_10016527 | 3300009177 | Bacteria | 8125 |
| 45 | Ga0105249_10262448 | 3300009553 | Bacteria | 1717 |
| 46 | Ga0105239_10109139 | 3300010375 | Unclassified | 3066 |
| 47 | Ga0157378_10004282 | 3300013297 | Bacteria | 12566 |
| 48 | Ga0157378_10198806 | 3300013297 | Bacteria | 1895 |
| 49 | Ga0163162_10016539 | 3300013306 | Bacteria | 7209 |
| 50 | Ga0163162_10089764 | 3300013306 | Bacteria | 3154 |
| 51 | Ga0157375_10034204 | 3300013308 | Bacteria | 4839 |
| 52 | Ga0163163_10009619 | 3300014325 | Bacteria | 8642 |
| 53 | Ga0157380_10000018 | 3300014326 | Bacteria | 116537 |
| 54 | Ga0157380_10049937 | 3300014326 | Bacteria | 3302 |
| 55 | Ga0157376_10250156 | 3300014969 | Bacteria | 1655 |
| 56 | Ga0207682_10002023 | 3300025893 | Bacteria | 9177 |
| 57 | Ga0207682_10013394 | 3300025893 | Bacteria | 3195 |
| 58 | Ga0207680_10022718 | 3300025903 | Bacteria | 3415 |
| 59 | Ga0207643_10002533 | 3300025908 | Bacteria | 9891 |
| 60 | Ga0207649_10082101 | 3300025920 | Bacteria | 2089 |
| 61 | Ga0207652_10229377 | 3300025921 | Bacteria | 1673 |
| 62 | Ga0207650_10030431 | 3300025925 | Bacteria | 3888 |
| 63 | Ga0207669_10055251 | 3300025937 | Bacteria | 2403 |
| 64 | Ga0207665_10020640 | 3300025939 | Bacteria | 4330 |
| 65 | Ga0207691_10025184 | 3300025940 | Bacteria | 5588 |
| 66 | Ga0207691_10027012 | 3300025940 | Bacteria | 5386 |
| 67 | Ga0207691_10074519 | 3300025940 | Bacteria | 3061 |
| 68 | Ga0207711_10109105 | 3300025941 | Bacteria | 2459 |
| 69 | Ga0207689_10014057 | 3300025942 | Bacteria | 6812 |
| 70 | Ga0207651_10173892 | 3300025960 | Bacteria | 1701 |
| 71 | Ga0207712_10165266 | 3300025961 | Bacteria | 1724 |
| 72 | Ga0207658_10000038 | 3300025986 | Bacteria | 145669 |
| 73 | Ga0207703_10009153 | 3300026035 | Bacteria | 7796 |
| 74 | Ga0207703_10072852 | 3300026035 | Bacteria | 2840 |
| 75 | Ga0207648_10048751 | 3300026089 | Bacteria | 3708 |
| 76 | Ga0207675_100072445 | 3300026118 | Bacteria | 3222 |
| 77 | Ga0207675_100142328 | 3300026118 | Bacteria | 2279 |
| 78 | Ga0207683_10053266 | 3300026121 | Bacteria | 3547 |
| 79 | Ga0209588_1004864 | 3300027671 | Bacteria | 3819 |
| 80 | Ga0268266_10184105 | 3300028379 | Bacteria | 1904 |
| 81 | Ga0268264_10190201 | 3300028381 | Bacteria | 1870 |
| 82 | Ga0265338_10205614 | 3300028800 | Bacteria | 1482 |
| 83 | Ga0265332_10000004 | 3300031238 | Bacteria | 426592 |
| 84 | Ga0265320_10004417 | 3300031240 | Bacteria | 9224 |
| 85 | Ga0265327_10013601 | 3300031251 | Bacteria | 5394 |
| 86 | Ga0307513_10013851 | 3300031456 | Bacteria | 9884 |
| 87 | Ga0307513_10032095 | 3300031456 | Bacteria | 5929 |
| 88 | Ga0307405_10137096 | 3300031731 | Bacteria | 1700 |
| 89 | Ga0307413_10050078 | 3300031824 | Bacteria | 2507 |
| 90 | Ga0307410_10028038 | 3300031852 | Bacteria | 3566 |
| 91 | Ga0307406_10019387 | 3300031901 | Bacteria | 3991 |
| 92 | Ga0307406_10048525 | 3300031901 | Bacteria | 2682 |
| 93 | Ga0307407_10072044 | 3300031903 | Bacteria | 2059 |
| 94 | Ga0307412_10019779 | 3300031911 | Bacteria | 4085 |
| 95 | Ga0307409_100016206 | 3300031995 | Bacteria | 4923 |
| 96 | Ga0307409_100024045 | 3300031995 | Bacteria | 4239 |
| 97 | Ga0307416_100010658 | 3300032002 | Bacteria | 6086 |
| 98 | Ga0307411_10018760 | 3300032005 | Bacteria | 3978 |
| 99 | Ga0307411_10025497 | 3300032005 | Bacteria | 3544 |
| 100 | Ga0307415_100000521 | 3300032126 | Bacteria | 16746 |
| 101 | Ga0307415_100175589 | 3300032126 | Bacteria | 1675 |
| 102 | Ga0373950_0000017 | 3300034818 | Bacteria | 271422 |
| 103 | Ga0373955_0066562 | 3300035172 | Bacteria | 2003 |
| 104 | Ga0373937_0014191 | 3300036401 | Bacteria | 7029 |
| 105 | Ga0373937_0127206 | 3300036401 | Bacteria | 2378 |
| 106 | Ga0451800_0351291 | 3300041459 | Bacteria | 5716 |
| 107 | Ga0450892_002455 | 3300042130 | Bacteria | 1581 |
| 108 | Ga0450896_000658 | 3300042133 | Bacteria | 3785 |
| 109 | Ga0439446_0002730 | 3300042156 | Bacteria | 4273 |
| 110 | Ga0439444_0001040 | 3300042437 | Bacteria | 3439 |
| 111 | Ga0450918_004095 | 3300042531 | Bacteria | 2673 |
| 112 | Ga0451577_0017880 | 3300042876 | Bacteria | 6541 |
| 113 | Ga0451577_0072851 | 3300042876 | Bacteria | 3065 |
| 114 | Ga0451577_0086151 | 3300042876 | Unclassified | 2803 |
| 115 | Ga0453684_0000046 | 3300044712 | Bacteria | 575242 |
| 116 | Ga0453684_0000692 | 3300044712 | Bacteria | 120085 |
| 117 | Ga0453684_0239527 | 3300044712 | Bacteria | 2089 |
| 118 | Ga0451576_0000168 | 3300045051 | Bacteria | 165624 |
| 119 | Ga0451576_0001378 | 3300045051 | Bacteria | 41772 |
| 120 | Ga0495638_0089087 | 3300046460 | Bacteria | 1862 |
| 121 | Ga0495664_0028233 | 3300046477 | Bacteria | 3277 |
| 122 | Ga0495616_0039346 | 3300046513 | Bacteria | 2422 |
| 123 | Ga0495628_0014918 | 3300046516 | Bacteria | 6499 |
| 124 | Ga0495632_0036863 | 3300046519 | Bacteria | 2485 |
| 125 | Ga0495652_0167105 | 3300046529 | Bacteria | 1702 |
| 126 | Ga0495667_0015988 | 3300046559 | Bacteria | 5071 |
| 127 | Ga0495634_0002690 | 3300046642 | Bacteria | 14611 |
| 128 | Ga0495625_0003602 | 3300046660 | Bacteria | 15224 |
| 129 | Ga0495625_0009239 | 3300046660 | Bacteria | 8276 |
| 130 | Ga0495625_0066679 | 3300046660 | Bacteria | 2535 |
| 131 | Ga0495674_0014100 | 3300047319 | Bacteria | 7488 |
| 132 | Ga0495615_0006263 | 3300048090 | Bacteria | 2193 |
| 133 | Ga0496110_0141812 | 3300048913 | Bacteria | 2172 |
| 134 | Ga0496111_0013641 | 3300048914 | Bacteria | 5536 |
| 135 | Ga0496114_0019124 | 3300048917 | Bacteria | 5550 |
| 136 | Ga0501034_0000019 | 3300049571 | Bacteria | 282405 |
| 137 | Ga0501039_0065792 | 3300049575 | Bacteria | 2813 |
| 138 | Ga0501043_0000381 | 3300049579 | Bacteria | 40297 |
| 139 | Ga0501046_0003165 | 3300049580 | Bacteria | 15199 |
| 140 | Ga0501047_0000007 | 3300049581 | Bacteria | 443240 |
| 141 | Ga0501048_0001261 | 3300049582 | Bacteria | 19137 |
| 142 | Ga0501067_0010826 | 3300049583 | Bacteria | 5046 |
| 143 | Ga0501068_0000244 | 3300049584 | Bacteria | 26692 |
| 144 | Ga0501068_0001212 | 3300049584 | Bacteria | 13710 |
| 145 | Ga0501069_0049982 | 3300049585 | Bacteria | 2325 |
| 146 | Ga0501070_0001112 | 3300049586 | Bacteria | 24145 |
| 147 | Ga0501071_0006706 | 3300049587 | Bacteria | 7484 |
| 148 | Ga0501072_0000084 | 3300049588 | Bacteria | 69297 |
| 149 | Ga0501072_0179473 | 3300049588 | Bacteria | 1689 |
| 150 | Ga0501073_0001640 | 3300049589 | Bacteria | 16596 |
| 151 | Ga0501073_0002895 | 3300049589 | Bacteria | 12869 |
| 152 | Ga0501073_0154321 | 3300049589 | Bacteria | 1591 |
| 153 | Ga0501074_0000069 | 3300049590 | Bacteria | 49518 |
| 154 | Ga0501074_0000542 | 3300049590 | Bacteria | 23258 |
| 155 | Ga0501074_0045274 | 3300049590 | Bacteria | 3184 |
| 156 | Ga0501076_0036673 | 3300049592 | Bacteria | 3842 |
| 157 | Ga0501079_0002320 | 3300049741 | Bacteria | 13783 |
| 158 | Ga0501079_0003059 | 3300049741 | Bacteria | 12240 |
| 159 | Ga0501080_0001174 | 3300049742 | Bacteria | 21694 |
| 160 | Ga0501080_0014512 | 3300049742 | Bacteria | 7257 |
| 161 | Ga0501083_0003635 | 3300049744 | Bacteria | 10827 |
| 162 | nmdc:mga09592_35929_c1 | 3300050508 | Bacteria | 4149 |
| 163 | nmdc:mga08y16_110487_c1 | 3300050511 | Bacteria | 2863 |
| 164 | nmdc:mga0a205_73_c1 | 3300050515 | Bacteria | 55159 |
| 165 | Ga0495619_0000136 | 3300053085 | Bacteria | 54722 |
| 166 | Ga0501084_0000043 | 3300054114 | Bacteria | 98202 |
| 167 | Ga0501084_0002850 | 3300054114 | Bacteria | 13972 |
| 168 | Ga0501082_0003958 | 3300060353 | Bacteria | 12931 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025921 | Ga0207652_10229377 | Ga0207652_102293771 | 338 |
| 2 | 3300048917 | Ga0496114_0019124 | Ga0496114_0019124_436_1656 | 340 |
| 3 | 3300026035 | Ga0207703_10009153 | Ga0207703_100091537 | 350 |
| 4 | 3300044712 | Ga0453684_0239527 | Ga0453684_0239527_99_1385 | 353 |
| 5 | 3300014326 | Ga0157380_10000018 | Ga0157380_1000001827 | 354 |
| 6 | 3300032005 | Ga0307411_10025497 | Ga0307411_100254972 | 354 |
| 7 | 3300031911 | Ga0307412_10019779 | Ga0307412_100197792 | 356 |
| 8 | 3300031995 | Ga0307409_100016206 | Ga0307409_1000162062 | 356 |
| 9 | 3300031995 | Ga0307409_100024045 | Ga0307409_1000240453 | 356 |
| 10 | 3300032002 | Ga0307416_100010658 | Ga0307416_1000106585 | 356 |
| 11 | 3300032126 | Ga0307415_100000521 | Ga0307415_10000052113 | 356 |
| 12 | 3300042876 | Ga0451577_0086151 | Ga0451577_0086151_288_1574 | 361 |
| 13 | 3300005295 | Ga0065707_10081829 | Ga0065707_1008182917 | 362 |
| 14 | 3300006852 | Ga0075433_10000413 | Ga0075433_1000041318 | 363 |
| 15 | 3300006871 | Ga0075434_100007326 | Ga0075434_1000073262 | 363 |
| 16 | 3300007788 | Ga0099795_10054069 | Ga0099795_100540691 | 363 |
| 17 | 3300050515 | nmdc:mga0a205_73_c1 | nmdc:mga0a205_73_c1_6227_7414 | 363 |
| 18 | 3300005331 | Ga0070670_100036144 | Ga0070670_1000361443 | 364 |
| 19 | 3300025920 | Ga0207649_10082101 | Ga0207649_100821013 | 364 |
| 20 | 3300025940 | Ga0207691_10074519 | Ga0207691_100745193 | 364 |
| 21 | 3300005937 | Ga0081455_10006964 | Ga0081455_100069647 | 365 |
| 22 | 3300014325 | Ga0163163_10009619 | Ga0163163_100096196 | 366 |
| 23 | 3300031852 | Ga0307410_10028038 | Ga0307410_100280383 | 366 |
| 24 | 3300031901 | Ga0307406_10048525 | Ga0307406_100485252 | 366 |
| 25 | 3300031903 | Ga0307407_10072044 | Ga0307407_100720442 | 366 |
| 26 | 3300042156 | Ga0439446_0002730 | Ga0439446_0002730_692_1879 | 366 |
| 27 | 3300042437 | Ga0439444_0001040 | Ga0439444_0001040_678_1865 | 366 |
| 28 | 3300049571 | Ga0501034_0000019 | Ga0501034_0000019_62087_63307 | 366 |
| 29 | 3300049579 | Ga0501043_0000381 | Ga0501043_0000381_874_2094 | 366 |
| 30 | 3300049580 | Ga0501046_0003165 | Ga0501046_0003165_5395_6615 | 366 |
| 31 | 3300049581 | Ga0501047_0000007 | Ga0501047_0000007_379676_380896 | 366 |
| 32 | 3300049582 | Ga0501048_0001261 | Ga0501048_0001261_12172_13392 | 366 |
| 33 | 3300049584 | Ga0501068_0001212 | Ga0501068_0001212_6209_7429 | 366 |
| 34 | 3300049585 | Ga0501069_0049982 | Ga0501069_0049982_283_1503 | 366 |
| 35 | 3300049586 | Ga0501070_0001112 | Ga0501070_0001112_16557_17777 | 366 |
| 36 | 3300049588 | Ga0501072_0000084 | Ga0501072_0000084_44362_45582 | 366 |
| 37 | 3300049589 | Ga0501073_0002895 | Ga0501073_0002895_9102_10322 | 366 |
| 38 | 3300049590 | Ga0501074_0000069 | Ga0501074_0000069_18742_19962 | 366 |
| 39 | 3300049741 | Ga0501079_0002320 | Ga0501079_0002320_3851_5071 | 366 |
| 40 | 3300049742 | Ga0501080_0001174 | Ga0501080_0001174_9283_10503 | 366 |
| 41 | 3300049744 | Ga0501083_0003635 | Ga0501083_0003635_5395_6615 | 366 |
| 42 | 3300054114 | Ga0501084_0000043 | Ga0501084_0000043_62334_63554 | 366 |
| 43 | 3300060353 | Ga0501082_0003958 | Ga0501082_0003958_5523_6743 | 366 |
| 44 | 3300034818 | Ga0373950_0000017 | Ga0373950_0000017_71640_72848 | 369 |
| 45 | 3300006880 | Ga0075429_100199057 | Ga0075429_1001990572 | 370 |
| 46 | 3300035172 | Ga0373955_0066562 | Ga0373955_0066562_569_1774 | 370 |
| 47 | 3300046477 | Ga0495664_0028233 | Ga0495664_0028233_899_2104 | 370 |
| 48 | 3300046516 | Ga0495628_0014918 | Ga0495628_0014918_552_1757 | 370 |
| 49 | 3300046642 | Ga0495634_0002690 | Ga0495634_0002690_12348_13553 | 370 |
| 50 | 3300047319 | Ga0495674_0014100 | Ga0495674_0014100_1514_2719 | 370 |
| 51 | 3300005331 | Ga0070670_100016071 | Ga0070670_1000160715 | 371 |
| 52 | 3300005842 | Ga0068858_100076832 | Ga0068858_1000768323 | 371 |
| 53 | 3300025925 | Ga0207650_10030431 | Ga0207650_100304314 | 371 |
| 54 | 3300026035 | Ga0207703_10072852 | Ga0207703_100728523 | 371 |
| 55 | 3300031731 | Ga0307405_10137096 | Ga0307405_101370962 | 371 |
| 56 | 3300031824 | Ga0307413_10050078 | Ga0307413_100500782 | 371 |
| 57 | 3300031901 | Ga0307406_10019387 | Ga0307406_100193873 | 371 |
| 58 | 3300032005 | Ga0307411_10018760 | Ga0307411_100187603 | 371 |
| 59 | 3300036401 | Ga0373937_0127206 | Ga0373937_0127206_723_1922 | 371 |
| 60 | 3300041459 | Ga0451800_0351291 | Ga0451800_0351291_302_1507 | 371 |
| 61 | 3300042130 | Ga0450892_002455 | Ga0450892_002455_242_1426 | 371 |
| 62 | 3300046519 | Ga0495632_0036863 | Ga0495632_0036863_461_1663 | 371 |
| 63 | 3300049588 | Ga0501072_0179473 | Ga0501072_0179473_248_1435 | 371 |
| 64 | 3300005333 | Ga0070677_10002795 | Ga0070677_100027955 | 372 |
| 65 | 3300005334 | Ga0068869_100009006 | Ga0068869_1000090063 | 372 |
| 66 | 3300005354 | Ga0070675_100005916 | Ga0070675_1000059162 | 372 |
| 67 | 3300005354 | Ga0070675_100013498 | Ga0070675_1000134986 | 372 |
| 68 | 3300005356 | Ga0070674_100026378 | Ga0070674_1000263782 | 372 |
| 69 | 3300005364 | Ga0070673_100056954 | Ga0070673_1000569542 | 372 |
| 70 | 3300005364 | Ga0070673_100059052 | Ga0070673_1000590524 | 372 |
| 71 | 3300005364 | Ga0070673_100187098 | Ga0070673_1001870982 | 372 |
| 72 | 3300005456 | Ga0070678_100053226 | Ga0070678_1000532264 | 372 |
| 73 | 3300005456 | Ga0070678_100158946 | Ga0070678_1001589461 | 372 |
| 74 | 3300005459 | Ga0068867_100038790 | Ga0068867_1000387902 | 372 |
| 75 | 3300005466 | Ga0070685_10006508 | Ga0070685_100065083 | 372 |
| 76 | 3300005543 | Ga0070672_100012393 | Ga0070672_1000123938 | 372 |
| 77 | 3300005548 | Ga0070665_100295433 | Ga0070665_1002954331 | 372 |
| 78 | 3300005617 | Ga0068859_100014932 | Ga0068859_1000149324 | 372 |
| 79 | 3300005719 | Ga0068861_100067143 | Ga0068861_1000671432 | 372 |
| 80 | 3300005841 | Ga0068863_100055620 | Ga0068863_1000556205 | 372 |
| 81 | 3300005843 | Ga0068860_100063753 | Ga0068860_1000637532 | 372 |
| 82 | 3300006358 | Ga0068871_100060449 | Ga0068871_1000604492 | 372 |
| 83 | 3300006931 | Ga0097620_100014933 | Ga0097620_1000149337 | 372 |
| 84 | 3300009176 | Ga0105242_10030967 | Ga0105242_100309672 | 372 |
| 85 | 3300009177 | Ga0105248_10016527 | Ga0105248_1001652710 | 372 |
| 86 | 3300010375 | Ga0105239_10109139 | Ga0105239_101091394 | 372 |
| 87 | 3300013306 | Ga0163162_10089764 | Ga0163162_100897643 | 372 |
| 88 | 3300013308 | Ga0157375_10034204 | Ga0157375_100342044 | 372 |
| 89 | 3300014969 | Ga0157376_10250156 | Ga0157376_102501561 | 372 |
| 90 | 3300025893 | Ga0207682_10002023 | Ga0207682_100020234 | 372 |
| 91 | 3300025893 | Ga0207682_10013394 | Ga0207682_100133943 | 372 |
| 92 | 3300025908 | Ga0207643_10002533 | Ga0207643_100025334 | 372 |
| 93 | 3300025937 | Ga0207669_10055251 | Ga0207669_100552513 | 372 |
| 94 | 3300025940 | Ga0207691_10025184 | Ga0207691_100251843 | 372 |
| 95 | 3300025940 | Ga0207691_10027012 | Ga0207691_100270123 | 372 |
| 96 | 3300025941 | Ga0207711_10109105 | Ga0207711_101091052 | 372 |
| 97 | 3300025942 | Ga0207689_10014057 | Ga0207689_100140571 | 372 |
| 98 | 3300025960 | Ga0207651_10173892 | Ga0207651_101738922 | 372 |
| 99 | 3300026089 | Ga0207648_10048751 | Ga0207648_100487513 | 372 |
| 100 | 3300026118 | Ga0207675_100072445 | Ga0207675_1000724452 | 372 |
| 101 | 3300026121 | Ga0207683_10053266 | Ga0207683_100532663 | 372 |
| 102 | 3300028379 | Ga0268266_10184105 | Ga0268266_101841051 | 372 |
| 103 | 3300028381 | Ga0268264_10190201 | Ga0268264_101902011 | 372 |
| 104 | 3300031251 | Ga0265327_10013601 | Ga0265327_100136013 | 372 |
| 105 | 3300046460 | Ga0495638_0089087 | Ga0495638_0089087_637_1836 | 372 |
| 106 | 3300046513 | Ga0495616_0039346 | Ga0495616_0039346_1109_2308 | 372 |
| 107 | 3300046660 | Ga0495625_0066679 | Ga0495625_0066679_757_1956 | 372 |
| 108 | 3300007265 | Ga0099794_10010824 | Ga0099794_100108241 | 373 |
| 109 | 3300009094 | Ga0111539_10029405 | Ga0111539_1002940510 | 373 |
| 110 | 3300014326 | Ga0157380_10049937 | Ga0157380_100499373 | 373 |
| 111 | 3300025939 | Ga0207665_10020640 | Ga0207665_100206402 | 373 |
| 112 | 3300027671 | Ga0209588_1004864 | Ga0209588_10048642 | 373 |
| 113 | 3300031456 | Ga0307513_10013851 | Ga0307513_1001385111 | 373 |
| 114 | 3300032126 | Ga0307415_100175589 | Ga0307415_1001755891 | 373 |
| 115 | 3300036401 | Ga0373937_0014191 | Ga0373937_0014191_2253_3548 | 373 |
| 116 | 3300042876 | Ga0451577_0072851 | Ga0451577_0072851_57_1496 | 373 |
| 117 | 3300045051 | Ga0451576_0000168 | Ga0451576_0000168_23611_25014 | 373 |
| 118 | 3300046529 | Ga0495652_0167105 | Ga0495652_0167105_240_1535 | 373 |
| 119 | 3300046559 | Ga0495667_0015988 | Ga0495667_0015988_635_1930 | 373 |
| 120 | 3300048090 | Ga0495615_0006263 | Ga0495615_0006263_311_1561 | 373 |
| 121 | 3300050508 | nmdc:mga09592_35929_c1 | nmdc:mga09592_35929_c1_2269_3579 | 373 |
| 122 | 3300050511 | nmdc:mga08y16_110487_c1 | nmdc:mga08y16_110487_c1_1235_2422 | 373 |
| 123 | 3300053085 | Ga0495619_0000136 | Ga0495619_0000136_44832_46127 | 373 |
| 124 | 3300042133 | Ga0450896_000658 | Ga0450896_000658_261_1454 | 374 |
| 125 | 3300042531 | Ga0450918_004095 | Ga0450918_004095_946_2139 | 374 |
| 126 | 3300046660 | Ga0495625_0003602 | Ga0495625_0003602_10638_11843 | 374 |
| 127 | 3300049583 | Ga0501067_0010826 | Ga0501067_0010826_383_1588 | 374 |
| 128 | 3300049584 | Ga0501068_0000244 | Ga0501068_0000244_12338_13543 | 374 |
| 129 | 3300049587 | Ga0501071_0006706 | Ga0501071_0006706_3246_4451 | 374 |
| 130 | 3300049589 | Ga0501073_0001640 | Ga0501073_0001640_1160_2365 | 374 |
| 131 | 3300049590 | Ga0501074_0000542 | Ga0501074_0000542_6406_7611 | 374 |
| 132 | 3300049592 | Ga0501076_0036673 | Ga0501076_0036673_430_1635 | 374 |
| 133 | 3300049741 | Ga0501079_0003059 | Ga0501079_0003059_4872_6077 | 374 |
| 134 | 3300049742 | Ga0501080_0014512 | Ga0501080_0014512_4260_5465 | 374 |
| 135 | 3300054114 | Ga0501084_0002850 | Ga0501084_0002850_5316_6521 | 374 |
| 136 | 3300005335 | Ga0070666_10026721 | Ga0070666_100267212 | 375 |
| 137 | 3300005367 | Ga0070667_100000069 | Ga0070667_10000006948 | 375 |
| 138 | 3300005841 | Ga0068863_100028854 | Ga0068863_1000288542 | 375 |
| 139 | 3300009553 | Ga0105249_10262448 | Ga0105249_102624482 | 375 |
| 140 | 3300025903 | Ga0207680_10022718 | Ga0207680_100227183 | 375 |
| 141 | 3300025961 | Ga0207712_10165266 | Ga0207712_101652662 | 375 |
| 142 | 3300025986 | Ga0207658_10000038 | Ga0207658_1000003866 | 375 |
| 143 | 3300044712 | Ga0453684_0000692 | Ga0453684_0000692_64382_65692 | 375 |
| 144 | 3300046660 | Ga0495625_0009239 | Ga0495625_0009239_5683_6888 | 375 |
| 145 | 3300048913 | Ga0496110_0141812 | Ga0496110_0141812_313_1701 | 375 |
| 146 | 3300048914 | Ga0496111_0013641 | Ga0496111_0013641_3895_5283 | 375 |
| 147 | 3300049575 | Ga0501039_0065792 | Ga0501039_0065792_1154_2347 | 375 |
| 148 | 3300028800 | Ga0265338_10205614 | Ga0265338_102056141 | 376 |
| 149 | 3300031240 | Ga0265320_10004417 | Ga0265320_100044173 | 376 |
| 150 | 3300049589 | Ga0501073_0154321 | Ga0501073_0154321_270_1487 | 376 |
| 151 | 3300049590 | Ga0501074_0045274 | Ga0501074_0045274_1807_3024 | 376 |
| 152 | 3300006237 | Ga0097621_100228560 | Ga0097621_1002285602 | 377 |
| 153 | 3300006358 | Ga0068871_100129705 | Ga0068871_1001297052 | 377 |
| 154 | 3300031238 | Ga0265332_10000004 | Ga0265332_10000004115 | 377 |
| 155 | 3300044712 | Ga0453684_0000046 | Ga0453684_0000046_440448_441794 | 377 |
| 156 | 3300042876 | Ga0451577_0017880 | Ga0451577_0017880_149_1333 | 380 |
| 157 | 3300031456 | Ga0307513_10032095 | Ga0307513_100320953 | 381 |
| 158 | 3300045051 | Ga0451576_0001378 | Ga0451576_0001378_35225_36484 | 382 |
| 159 | 3300003203 | JGI25406J46586_10000325 | JGI25406J46586_100003255 | 383 |
| 160 | 3300003911 | JGI25405J52794_10001135 | JGI25405J52794_100011352 | 383 |
| 161 | 3300005468 | Ga0070707_100038952 | Ga0070707_1000389525 | 383 |
| 162 | 3300005937 | Ga0081455_10000256 | Ga0081455_1000025628 | 383 |
| 163 | 3300005985 | Ga0081539_10000313 | Ga0081539_1000031316 | 383 |
| 164 | 3300009098 | Ga0105245_10057073 | Ga0105245_100570731 | 383 |
| 165 | 3300013297 | Ga0157378_10004282 | Ga0157378_100042828 | 383 |
| 166 | 3300013297 | Ga0157378_10198806 | Ga0157378_101988062 | 383 |
| 167 | 3300013306 | Ga0163162_10016539 | Ga0163162_100165393 | 383 |
| 168 | 3300026118 | Ga0207675_100142328 | Ga0207675_1001423282 | 383 |
| 169 | iso_pu_bacteria | 2547132512 | 2548848229 | 383 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wu1-assembly1.cif.gz_A | structure of apo laindy | 0.5479 | 28 | 379 |
| 6wu1-assembly1.cif.gz_A | structure of apo laindy | 0.5144 | 28 | 379 |
| 6ol1-assembly1.cif.gz_B | structure of vcindy in complex with succinate | 0.5097 | 7 | 378 |
| 5uld-assembly2.cif.gz_C | structure and function of the divalent anion/na+ symporter from vibrio cholerae and a humanized variant | 0.5087 | 7 | 378 |
| 6ol1-assembly1.cif.gz_B | structure of vcindy in complex with succinate | 0.4991 | 7 | 378 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6YCG9_3_406_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.6888 | 7 | 376 | 1.20.1530.20 |
| af_I6YCG9_3_406_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.6696 | 7 | 376 | 1.20.1530.20 |
| af_Q9P6J7_45_305_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2572 | 63 | 254 | 1.20.1250.20 |
| af_A0A1D8PDF5_68_305_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.2307 | 138 | 329 | 1.20.1070.10 |
| af_P36554_12_217_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2227 | 73 | 377 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2K8U223-F1-model_v4 | Citrate transporter | 0.9777 | 4 | 381 |
GO:0006814
GO:0015297 GO:0016020 |
| AF-Q6N733-F1-model_v4 | Citrate transporter | 0.9769 | 1 | 381 |
GO:0006814
GO:0015297 GO:0016020 |
| AF-C0INR8-F1-model_v4 | Citrate transporter | 0.9759 | 1 | 382 |
GO:0006814
GO:0015297 GO:0016020 |
| AF-C0INR8-F1-model_v4 | Citrate transporter | 0.9734 | 1 | 382 |
GO:0006814
GO:0015297 GO:0016020 |
| AF-A0A351BNE3-F1-model_v4 | Citrate transporter | 0.9723 | 279 | 381 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar