F253408

General Info

Members Datasets Scaffolds Average Seq Length
168 128 155 260

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0232557|Ga0496113_0232557_382_1266
Length 294
Sequence MQSAEANRRQSIVMRCCQHRGSPPDESHLMEFSVAPKEYSAAPSLYGKRGLVVGIANEASIAAGCARAFAAAGASLAATYLNEKAEPHVRAVTDPLGCNLLLACDVRVPGQLEAAFERIRAEWGRMDFLLHAIAFAPKDDLHGRVVDCSSEGFALAMDVSCHSFMRMARLAEPLMTAGGCLLTVTFYGSERVVAHYNLMGPVKAALESAVRYTAAELAPKGIRVHAISPGPIRTRAASGIDRFDELIAAAAATAPSHHLVDVDDVGALAAFLVSDGARHITGTIIPVDGGQHLS

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
3 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
4 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
5 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
6 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
7 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
8 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
9 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
10 2857564685 Duganella sp. R-74599 Isolate Unclassified
11 2858950400 Achromobacter sp. K91 Isolate Unclassified
12 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
13 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
14 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
34 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
47 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
48 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
51 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
58 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
65 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
66 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
75 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
76 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
80 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
81 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
84 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
85 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
86 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
87 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
96 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
97 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
98 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
99 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
100 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
103 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
117 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
118 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
119 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
120 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
121 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
122 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
123 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
124 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
125 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
126 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.26
Metatranscriptomes 0
Isolates 7.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.88
Nodule 0.6
Rhizoplane 4.76
Rhizosphere 60.12
Stem 0
Stem Tuber 0
Unclassified 19.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000278 3300002738 Bacteria 31200
2 rootL2_10005965 3300003322 Bacteria 7480
3 rootL2_10113266 3300003322 Bacteria 1454
4 Ga0055526_1000001 3300003771 Bacteria 669703
5 Ga0055526_1000040 3300003771 Bacteria 129879
6 Ga0070666_10062105 3300005335 Bacteria 2530
7 Ga0070668_100003465 3300005347 Bacteria 11647
8 Ga0070671_100000226 3300005355 Bacteria 37590
9 Ga0070671_100420790 3300005355 Bacteria 1144
10 Ga0070665_100170448 3300005548 Bacteria 2178
11 Ga0068863_100581912 3300005841 Bacteria 1107
12 Ga0068858_100006083 3300005842 Bacteria 11773
13 Ga0075368_10000807 3300006042 Bacteria 9645
14 Ga0075367_10001162 3300006178 Bacteria 11003
15 Ga0075370_10001312 3300006353 Bacteria 10641
16 Ga0105244_10010549 3300009036 Bacteria 5596
17 Ga0105248_10029506 3300009177 Bacteria 6119
18 Ga0105248_10131561 3300009177 Bacteria 2823
19 Ga0105148_100976 3300009978 Bacteria 2052
20 Ga0105239_10006274 3300010375 Bacteria 13832
21 Ga0163162_10309694 3300013306 Bacteria 1711
22 Ga0183369_1014 3300015685 Bacteria 194173
23 Ga0163161_10004089 3300017792 Bacteria 10208
24 Ga0213872_10003255 3300021361 Bacteria 9063
25 Ga0209147_100943 3300025229 Bacteria 12826
26 Ga0209676_1004546 3300025292 Bacteria 7689
27 Ga0209564_1000002 3300025295 Bacteria 1636803
28 Ga0209564_1000096 3300025295 Bacteria 232165
29 Ga0209050_1004497 3300025298 Bacteria 9380
30 Ga0207655_1015457 3300025728 Bacteria 4239
31 Ga0207644_10000228 3300025931 Bacteria 38713
32 Ga0207644_10480353 3300025931 Bacteria 1023
33 Ga0207711_10000161 3300025941 Bacteria 71905
34 Ga0207668_10002490 3300025972 Bacteria 10750
35 Ga0207658_10038683 3300025986 Bacteria 3438
36 Ga0207677_10178375 3300026023 Bacteria 1669
37 Ga0207703_10021536 3300026035 Bacteria 5048
38 Ga0207675_100551124 3300026118 Bacteria 1152
39 Ga0209813_10000187 3300027866 Bacteria 19692
40 Ga0265328_10000608 3300031239 Bacteria 16653
41 Ga0265331_10000125 3300031250 Bacteria 101037
42 Ga0265316_10000005 3300031344 Bacteria 304442
43 Ga0265316_10041856 3300031344 Bacteria 3663
44 Ga0265316_10167531 3300031344 Bacteria 1640
45 Ga0307509_10000072 3300031507 Bacteria 140566
46 Ga0307508_10303895 3300031616 Bacteria 1188
47 Ga0307405_10187278 3300031731 Bacteria 1491
48 Ga0307413_10074272 3300031824 Bacteria 2153
49 Ga0307412_10126084 3300031911 Bacteria 1852
50 Ga0307416_100025655 3300032002 Bacteria 4326
51 Ga0307416_100055190 3300032002 Bacteria 3198
52 Ga0307415_100152191 3300032126 Bacteria 1782
53 Ga0307415_100189625 3300032126 Bacteria 1621
54 Ga0307510_10302776 3300033180 Bacteria 1060
55 Ga0373932_0035899 3300035112 Bacteria 1404
56 Ga0395900_0011116 3300037418 Bacteria 9200
57 Ga0395900_0045198 3300037418 Bacteria 4536
58 Ga0395898_0031665 3300037466 Bacteria 5283
59 Ga0395898_0074617 3300037466 Bacteria 3276
60 Ga0395905_0046658 3300037471 Bacteria 4063
61 Ga0395901_0483890 3300038443 Bacteria 1262
62 Ga0436365_0602290 3300039437 Bacteria 1576
63 Ga0436361_0254519 3300039447 Bacteria 16014
64 Ga0451577_0031443 3300042876 Bacteria 4789
65 Ga0451577_0138475 3300042876 Bacteria 2186
66 Ga0451577_0300930 3300042876 Bacteria 1453
67 Ga0453683_0068659 3300044673 Bacteria 2216
68 Ga0466963_0185282 3300044694 Bacteria 1454
69 Ga0453684_0003300 3300044712 Bacteria 36795
70 Ga0453684_0011958 3300044712 Bacteria 14440
71 Ga0453684_0087866 3300044712 Bacteria 3851
72 Ga0451576_0000955 3300045051 Bacteria 54206
73 Ga0451576_0011501 3300045051 Bacteria 10049
74 Ga0451576_0013848 3300045051 Bacteria 9011
75 Ga0451576_0032402 3300045051 Bacteria 5565
76 Ga0451576_0110461 3300045051 Bacteria 2861
77 Ga0451576_0267064 3300045051 Bacteria 1789
78 Ga0451576_0274851 3300045051 Bacteria 1761
79 Ga0466967_0708912 3300045976 Bacteria 997
80 Ga0495638_0000016 3300046460 Bacteria 396505
81 Ga0495650_0000279 3300046471 Bacteria 97669
82 Ga0495605_0000073 3300046474 Bacteria 131765
83 Ga0495583_0000290 3300046506 Bacteria 79731
84 Ga0495606_0000049 3300046507 Bacteria 204038
85 Ga0495610_0001410 3300046512 Bacteria 21297
86 Ga0495628_0351901 3300046516 Bacteria 1083
87 Ga0495643_0000073 3300046522 Bacteria 168344
88 Ga0495648_0000013 3300046524 Bacteria 289090
89 Ga0495633_0000417 3300046558 Bacteria 44120
90 Ga0495633_0002897 3300046558 Bacteria 11763
91 Ga0495633_0063303 3300046558 Bacteria 1731
92 Ga0495668_0000077 3300046616 Bacteria 159120
93 Ga0495668_0001465 3300046616 Bacteria 22689
94 Ga0495625_0000631 3300046660 Bacteria 50911
95 Ga0495671_0000018 3300046692 Bacteria 291470
96 Ga0495675_0250174 3300047444 Bacteria 1065
97 Ga0495673_0000130 3300047469 Bacteria 138192
98 Ga0495681_0001922 3300047470 Bacteria 15240
99 Ga0495686_0023037 3300047472 Bacteria 4114
100 Ga0496101_0099327 3300048904 Bacteria 2176
101 Ga0496102_0092765 3300048905 Bacteria 2797
102 Ga0496103_0078949 3300048906 Bacteria 2067
103 Ga0496104_0041978 3300048907 Bacteria 4290
104 Ga0496107_0041953 3300048910 Bacteria 3287
105 Ga0496107_0090537 3300048910 Bacteria 2235
106 Ga0496113_0232557 3300048916 Bacteria 1470
107 Ga0496115_0119303 3300048918 Bacteria 2170
108 Ga0496116_0010302 3300048919 Bacteria 7853
109 Ga0496116_0036439 3300048919 Bacteria 3442
110 Ga0496117_0007873 3300048920 Bacteria 10248
111 Ga0496118_0002009 3300048921 Bacteria 28807
112 Ga0496119_0028366 3300048922 Bacteria 3821
113 Ga0496120_0019525 3300048923 Bacteria 4333
114 Ga0496121_0010600 3300048924 Bacteria 10355
115 Ga0496124_0021718 3300048927 Bacteria 5908
116 Ga0496124_0051847 3300048927 Bacteria 3489
117 Ga0496124_0073937 3300048927 Bacteria 2818
118 Ga0496124_0075957 3300048927 Bacteria 2775
119 Ga0496124_0236029 3300048927 Bacteria 1363
120 Ga0496124_0304535 3300048927 Bacteria 1149
121 Ga0496125_0146382 3300048928 Bacteria 1632
122 Ga0496126_0006241 3300048929 Bacteria 13320
123 Ga0501036_0677055 3300049572 Bacteria 853
124 Ga0501042_0056646 3300049578 Bacteria 2797
125 Ga0501046_0012314 3300049580 Bacteria 7288
126 Ga0501047_0053916 3300049581 Bacteria 3890
127 Ga0501047_0279675 3300049581 Bacteria 1514
128 Ga0501047_0456064 3300049581 Bacteria 1107
129 Ga0501048_0012067 3300049582 Bacteria 6439
130 Ga0501071_0040212 3300049587 Bacteria 3346
131 Ga0501072_0051032 3300049588 Bacteria 3257
132 Ga0501072_0146758 3300049588 Bacteria 1881
133 Ga0501249_000711 3300049679 Bacteria 7533
134 Ga0501081_0023890 3300049743 Bacteria 4100
135 Ga0501035_0155387 3300049822 Bacteria 1983
136 Ga0501035_0531801 3300049822 Bacteria 965
137 Ga0501044_0248192 3300049823 Bacteria 1722
138 Ga0501045_0479400 3300049824 Bacteria 924
139 Ga0501204_003980 3300049850 Bacteria 1574
140 nmdc:mga06z11_285_c1 3300050494 Bacteria 19690
141 nmdc:mga06z11_320599_c1 3300050494 Bacteria 924
142 nmdc:mga04h51_154_c1 3300050495 Bacteria 19692
143 nmdc:mga07m45_2928_c1 3300050496 Bacteria 8102
144 Ga0500635_0000120 3300053080 Bacteria 46183
145 Ga0500641_0009304 3300053096 Bacteria 3531
146 Ga0500595_007502 3300053119 Bacteria 4526
147 Ga0500608_000152 3300053122 Bacteria 28853
148 Ga0500618_000417 3300053125 Bacteria 28704
149 Ga0500618_002113 3300053125 Bacteria 7866
150 Ga0500618_002298 3300053125 Bacteria 7357
151 Ga0500636_0001268 3300053177 Bacteria 13695
152 Ga0500636_0035048 3300053177 Bacteria 2971
153 Ga0500637_0007582 3300053178 Bacteria 5434
154 Ga0501084_0016285 3300054114 Bacteria 6174
155 Ga0501082_0062118 3300060353 Bacteria 3215

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0531801 Ga0501035_0531801_88_852 237
2 3300010375 Ga0105239_10006274 Ga0105239_100062749 240
3 3300015685 Ga0183369_1014 Ga0183369_101499 241
4 3300049581 Ga0501047_0279675 Ga0501047_0279675_558_1322 241
5 3300049823 Ga0501044_0248192 Ga0501044_0248192_833_1597 241
6 3300049572 Ga0501036_0677055 Ga0501036_0677055_12_749 243
7 iso_pu_bacteria 2854681122 2854684417 246
8 iso_pu_bacteria 2522572158 2523103640 248
9 iso_pu_bacteria 2524023250 2524612044 250
10 3300049582 Ga0501048_0012067 Ga0501048_0012067_4747_5508 251
11 iso_pu_bacteria 2582581305 2585259926 251
12 iso_pu_bacteria 2751185897 2753763203 251
13 iso_pu_bacteria 2858950400 2858952981 251
14 iso_pu_bacteria 2919138771 2919142933 251
15 iso_pu_bacteria 2919709256 2919709285 251
16 3300045051 Ga0451576_0011501 Ga0451576_0011501_9271_10035 252
17 3300003322 rootL2_10113266 rootL2_101132662 253
18 3300021361 Ga0213872_10003255 Ga0213872_100032553 253
19 3300039447 Ga0436361_0254519 Ga0436361_0254519_2628_3395 253
20 3300042876 Ga0451577_0138475 Ga0451577_0138475_1240_2043 253
21 3300053096 Ga0500641_0009304 Ga0500641_0009304_1901_2668 253
22 3300053119 Ga0500595_007502 Ga0500595_007502_2746_3513 253
23 3300053125 Ga0500618_000417 Ga0500618_000417_14311_15078 253
24 iso_pu_bacteria 2857564685 2857566460 254
25 3300003322 rootL2_10005965 rootL2_100059653 255
26 3300005347 Ga0070668_100003465 Ga0070668_1000034654 255
27 3300005355 Ga0070671_100000226 Ga0070671_1000002264 255
28 3300005355 Ga0070671_100420790 Ga0070671_1004207902 255
29 3300005841 Ga0068863_100581912 Ga0068863_1005819122 255
30 3300005842 Ga0068858_100006083 Ga0068858_1000060835 255
31 3300006042 Ga0075368_10000807 Ga0075368_1000080710 255
32 3300006178 Ga0075367_10001162 Ga0075367_100011627 255
33 3300006353 Ga0075370_10001312 Ga0075370_100013129 255
34 3300009177 Ga0105248_10029506 Ga0105248_100295064 255
35 3300009177 Ga0105248_10131561 Ga0105248_101315614 255
36 3300009978 Ga0105148_100976 Ga0105148_1009762 255
37 3300013306 Ga0163162_10309694 Ga0163162_103096942 255
38 3300017792 Ga0163161_10004089 Ga0163161_100040897 255
39 3300025229 Ga0209147_100943 Ga0209147_1009436 255
40 3300025292 Ga0209676_1004546 Ga0209676_10045466 255
41 3300025298 Ga0209050_1004497 Ga0209050_10044976 255
42 3300025931 Ga0207644_10000228 Ga0207644_1000022833 255
43 3300025931 Ga0207644_10480353 Ga0207644_104803532 255
44 3300025941 Ga0207711_10000161 Ga0207711_1000016166 255
45 3300025972 Ga0207668_10002490 Ga0207668_100024904 255
46 3300025986 Ga0207658_10038683 Ga0207658_100386832 255
47 3300026035 Ga0207703_10021536 Ga0207703_100215366 255
48 3300027866 Ga0209813_10000187 Ga0209813_100001879 255
49 3300031507 Ga0307509_10000072 Ga0307509_1000007214 255
50 3300042876 Ga0451577_0031443 Ga0451577_0031443_3169_3954 255
51 3300046460 Ga0495638_0000016 Ga0495638_0000016_179364_180137 255
52 3300046506 Ga0495583_0000290 Ga0495583_0000290_48733_49506 255
53 3300046522 Ga0495643_0000073 Ga0495643_0000073_5719_6492 255
54 3300046524 Ga0495648_0000013 Ga0495648_0000013_216369_217142 255
55 3300046558 Ga0495633_0000417 Ga0495633_0000417_10592_11365 255
56 3300046692 Ga0495671_0000018 Ga0495671_0000018_218865_219638 255
57 3300047469 Ga0495673_0000130 Ga0495673_0000130_65380_66153 255
58 3300047470 Ga0495681_0001922 Ga0495681_0001922_4960_5733 255
59 3300048904 Ga0496101_0099327 Ga0496101_0099327_553_1326 255
60 3300048906 Ga0496103_0078949 Ga0496103_0078949_289_1062 255
61 3300048919 Ga0496116_0036439 Ga0496116_0036439_668_1441 255
62 3300048920 Ga0496117_0007873 Ga0496117_0007873_6153_6926 255
63 3300048921 Ga0496118_0002009 Ga0496118_0002009_14886_15659 255
64 3300048922 Ga0496119_0028366 Ga0496119_0028366_930_1703 255
65 3300048923 Ga0496120_0019525 Ga0496120_0019525_2725_3498 255
66 3300048924 Ga0496121_0010600 Ga0496121_0010600_8588_9361 255
67 3300048927 Ga0496124_0021718 Ga0496124_0021718_4456_5229 255
68 3300048927 Ga0496124_0051847 Ga0496124_0051847_2401_3174 255
69 3300048927 Ga0496124_0073937 Ga0496124_0073937_1052_1825 255
70 3300048928 Ga0496125_0146382 Ga0496125_0146382_108_881 255
71 3300049679 Ga0501249_000711 Ga0501249_000711_5814_6587 255
72 3300049822 Ga0501035_0155387 Ga0501035_0155387_644_1417 255
73 3300049850 Ga0501204_003980 Ga0501204_003980_443_1216 255
74 3300050494 nmdc:mga06z11_285_c1 nmdc:mga06z11_285_c1_8701_9474 255
75 3300050495 nmdc:mga04h51_154_c1 nmdc:mga04h51_154_c1_8701_9474 255
76 3300050496 nmdc:mga07m45_2928_c1 nmdc:mga07m45_2928_c1_6818_7591 255
77 3300053122 Ga0500608_000152 Ga0500608_000152_18412_19185 255
78 3300053125 Ga0500618_002113 Ga0500618_002113_2740_3513 255
79 3300053177 Ga0500636_0035048 Ga0500636_0035048_581_1354 255
80 iso_pu_bacteria 2597490356 2599101245 255
81 iso_pu_bacteria 2846952575 2846954035 255
82 iso_pu_bacteria 2848858292 2848859790 255
83 3300005335 Ga0070666_10062105 Ga0070666_100621052 256
84 3300026023 Ga0207677_10178375 Ga0207677_101783751 256
85 3300031239 Ga0265328_10000608 Ga0265328_1000060814 256
86 3300031250 Ga0265331_10000125 Ga0265331_1000012567 256
87 3300031344 Ga0265316_10041856 Ga0265316_100418563 256
88 3300031344 Ga0265316_10167531 Ga0265316_101675312 256
89 3300031616 Ga0307508_10303895 Ga0307508_103038952 256
90 3300031731 Ga0307405_10187278 Ga0307405_101872782 256
91 3300031824 Ga0307413_10074272 Ga0307413_100742722 256
92 3300031911 Ga0307412_10126084 Ga0307412_101260841 256
93 3300032002 Ga0307416_100025655 Ga0307416_1000256552 256
94 3300032002 Ga0307416_100055190 Ga0307416_1000551902 256
95 3300032126 Ga0307415_100152191 Ga0307415_1001521912 256
96 3300032126 Ga0307415_100189625 Ga0307415_1001896252 256
97 3300037418 Ga0395900_0011116 Ga0395900_0011116_7836_8618 256
98 3300037418 Ga0395900_0045198 Ga0395900_0045198_1438_2220 256
99 3300037466 Ga0395898_0031665 Ga0395898_0031665_4097_4879 256
100 3300037466 Ga0395898_0074617 Ga0395898_0074617_1986_2768 256
101 3300037471 Ga0395905_0046658 Ga0395905_0046658_878_1660 256
102 3300038443 Ga0395901_0483890 Ga0395901_0483890_225_1007 256
103 3300039437 Ga0436365_0602290 Ga0436365_0602290_235_1038 256
104 3300042876 Ga0451577_0300930 Ga0451577_0300930_183_1043 256
105 3300044694 Ga0466963_0185282 Ga0466963_0185282_562_1392 256
106 3300044712 Ga0453684_0003300 Ga0453684_0003300_35015_35824 256
107 3300044712 Ga0453684_0011958 Ga0453684_0011958_4649_5509 256
108 3300044712 Ga0453684_0087866 Ga0453684_0087866_702_1511 256
109 3300045051 Ga0451576_0110461 Ga0451576_0110461_1135_1944 256
110 3300045051 Ga0451576_0267064 Ga0451576_0267064_510_1292 256
111 3300045051 Ga0451576_0274851 Ga0451576_0274851_121_930 256
112 3300045976 Ga0466967_0708912 Ga0466967_0708912_156_986 256
113 3300046516 Ga0495628_0351901 Ga0495628_0351901_267_1043 256
114 3300046558 Ga0495633_0063303 Ga0495633_0063303_85_882 256
115 3300047444 Ga0495675_0250174 Ga0495675_0250174_46_822 256
116 3300049578 Ga0501042_0056646 Ga0501042_0056646_1190_1972 256
117 3300049580 Ga0501046_0012314 Ga0501046_0012314_3705_4487 256
118 3300049581 Ga0501047_0053916 Ga0501047_0053916_454_1236 256
119 3300049581 Ga0501047_0456064 Ga0501047_0456064_288_1070 256
120 3300049587 Ga0501071_0040212 Ga0501071_0040212_1251_2033 256
121 3300049588 Ga0501072_0051032 Ga0501072_0051032_392_1174 256
122 3300049588 Ga0501072_0146758 Ga0501072_0146758_47_835 256
123 3300049743 Ga0501081_0023890 Ga0501081_0023890_1368_2150 256
124 3300049824 Ga0501045_0479400 Ga0501045_0479400_57_839 256
125 3300050494 nmdc:mga06z11_320599_c1 nmdc:mga06z11_320599_c1_42_821 256
126 3300053125 Ga0500618_002298 Ga0500618_002298_2580_3365 256
127 3300054114 Ga0501084_0016285 Ga0501084_0016285_2997_3779 256
128 3300060353 Ga0501082_0062118 Ga0501082_0062118_1078_1860 256
129 3300005548 Ga0070665_100170448 Ga0070665_1001704482 257
130 3300053080 Ga0500635_0000120 Ga0500635_0000120_39214_39993 257
131 3300053177 Ga0500636_0001268 Ga0500636_0001268_2658_3437 257
132 3300053178 Ga0500637_0007582 Ga0500637_0007582_1664_2443 257
133 3300003771 Ga0055526_1000001 Ga0055526_100000193 258
134 3300003771 Ga0055526_1000040 Ga0055526_100004080 258
135 3300009036 Ga0105244_10010549 Ga0105244_100105493 258
136 3300025295 Ga0209564_1000002 Ga0209564_1000002472 258
137 3300025295 Ga0209564_1000096 Ga0209564_1000096165 258
138 3300025728 Ga0207655_1015457 Ga0207655_10154576 258
139 3300033180 Ga0307510_10302776 Ga0307510_103027762 258
140 3300035112 Ga0373932_0035899 Ga0373932_0035899_308_1096 258
141 3300046471 Ga0495650_0000279 Ga0495650_0000279_82333_83109 258
142 3300046474 Ga0495605_0000073 Ga0495605_0000073_50398_51174 258
143 3300046507 Ga0495606_0000049 Ga0495606_0000049_85554_86330 258
144 3300046512 Ga0495610_0001410 Ga0495610_0001410_2714_3490 258
145 3300046558 Ga0495633_0002897 Ga0495633_0002897_2646_3422 258
146 3300046616 Ga0495668_0000077 Ga0495668_0000077_85507_86283 258
147 3300046616 Ga0495668_0001465 Ga0495668_0001465_14502_15278 258
148 3300046660 Ga0495625_0000631 Ga0495625_0000631_14739_15515 258
149 3300047472 Ga0495686_0023037 Ga0495686_0023037_879_1655 258
150 3300048905 Ga0496102_0092765 Ga0496102_0092765_1351_2148 258
151 3300048907 Ga0496104_0041978 Ga0496104_0041978_3072_3869 258
152 3300048910 Ga0496107_0041953 Ga0496107_0041953_1368_2144 258
153 3300048910 Ga0496107_0090537 Ga0496107_0090537_891_1688 258
154 3300048916 Ga0496113_0232557 Ga0496113_0232557_382_1266 258
155 3300048918 Ga0496115_0119303 Ga0496115_0119303_881_1765 258
156 3300048919 Ga0496116_0010302 Ga0496116_0010302_4129_4905 258
157 3300048927 Ga0496124_0075957 Ga0496124_0075957_1022_1798 258
158 3300048927 Ga0496124_0236029 Ga0496124_0236029_219_995 258
159 3300048927 Ga0496124_0304535 Ga0496124_0304535_163_939 258
160 3300048929 Ga0496126_0006241 Ga0496126_0006241_9819_10595 258
161 iso_pu_bacteria 2508501114 2509075249 258
162 3300002738 JGI25154J39366_1000278 JGI25154J39366_100027826 259
163 3300026118 Ga0207675_100551124 Ga0207675_1005511242 259
164 3300031344 Ga0265316_10000005 Ga0265316_1000000591 259
165 3300044673 Ga0453683_0068659 Ga0453683_0068659_1032_1832 259
166 3300045051 Ga0451576_0000955 Ga0451576_0000955_31208_32059 259
167 3300045051 Ga0451576_0013848 Ga0451576_0013848_6171_6971 259
168 3300045051 Ga0451576_0032402 Ga0451576_0032402_3195_4061 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

54

292

0.99

PF00106

adh_short

short chain dehydrogenase

50

245

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pd3-assembly1.cif.gz_B crystal structure of the helicobacter pylori enoyl-acyl carrier protein reductase in complex with hydroxydiphenyl ether compounds, triclosan and diclosan 0.9771 10 257
5ycs-assembly1.cif.gz_B x-ray structure of enoyl-acyl carrier protein reductase from bacillus anthracis with triclosan 0.9762 9 259
5tf4-assembly2.cif.gz_F crystal structure of enoyl-(acyl carrier protein) reductase from bartonella henselae in complext with nad 0.9759 10 259
8jfn-assembly1.cif.gz_A-4 crystal structure of enoyl-acp reductase fabi in complex with nad+ and crotonyl-acp from helicobacter pylori 0.9749 10 257
8jfm-assembly2.cif.gz_E crystal structure of enoyl-acp reductase fabi in complex with nadh from helicobacter pylori 0.9746 9 257
ID Description Score Start End Superfamily
af_P0AEK4_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9737 10 257 3.40.50.720
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9658 10 259 3.40.50.720
2p91A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9642 10 257 3.40.50.720
4cv1H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 11 259 3.40.50.720
af_Q2FZQ3_8_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9572 16 204 3.40.50.720
ID Description Score Start End GO Terms
AF-B6IRJ9-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9912 11 259 GO:0004318
GO:0006633
AF-A0A840G4W0-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9904 11 259 GO:0004318
GO:0006633
AF-K9HME3-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9889 11 259 GO:0004318
GO:0006633
AF-A0A158M1Y4-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.9888 94 257 GO:0004318
GO:0006633
AF-A0A8B6M185-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.9885 7 257 GO:0004318
GO:0006633

Feature Viewer

pLDDT pTM Quality
92.35 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map