F249451

General Info

Members Datasets Scaffolds Average Seq Length
166 130 162 302

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2886848708|2886854228
Length 345
Sequence TSMTMSLSTTPRSRSCATALATLALCAPLMALAATAPAQPPKPAKPSRSSADILATAPASVWRDVDPDNLLVMTLPQGQVFIELAPRFAPAHVDNIRALARGGYYDGLAIVRVQDNFVTQWGDPNADDEDTGMKGKGKPFPAGAKAHLPAEFSIPLKGVPMTVLPDVDGWAPRVGQVDGFAAAADPKAGKAWLAHCYGSVGAGRGNAADSSTGAELYAVIGQAPRGLDLNITVVGRVLKGMEFLSSLPRGGAAMGFYDKPEQRLGIERVALAAALPAEQRPALQVLRTDTPTWQELLDARRHRGGWFVHSPGYTDLCSAAVPVRVKPAAGPEVKLNEPKSPESRR

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2831864461 Roseateles noduli HZ7 Isolate Nodule
5 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
6 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
58 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
76 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
89 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
117 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
118 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
119 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
120 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
121 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
122 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
123 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
126 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
127 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
128 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
129 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.39
Metatranscriptomes 0
Isolates 3.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.13
Nodule 1.81
Rhizoplane 0
Rhizosphere 50
Stem 0
Stem Tuber 0
Unclassified 15.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000222 3300002705 Bacteria 39568
2 JGI25156J39149_1000835 3300002705 Bacteria 15565
3 JGI25157J39369_1000056 3300002741 Bacteria 107681
4 JGI25157J39369_1000100 3300002741 Bacteria 73363
5 JGI25406J46586_10025669 3300003203 Bacteria 2284
6 rootH1_10001028 3300003316 Bacteria 11892
7 rootH1_10021924 3300003316 Bacteria 2643
8 rootL2_10001519 3300003322 Bacteria 91967
9 rootL2_10086213 3300003322 Bacteria 2507
10 rootH1_10013770 3300003316 Bacteria 3901
11 rootH1_10013770 3300003323 Bacteria 5331
12 rootH1_10013771 3300003316 Bacteria 3106
13 rootH1_10013771 3300003323 Bacteria 14908
14 rootH1_10054607 3300003323 Bacteria 4086
15 rootH1_10187076 3300003323 Bacteria 4759
16 rootH1_10402802 3300003323 Bacteria 1605
17 Ga0055539_1000400 3300003752 Bacteria 16967
18 Ga0055539_1002889 3300003752 Bacteria 2506
19 Ga0055533_1000080 3300003756 Bacteria 131291
20 Ga0055525_1001331 3300003759 Bacteria 4884
21 Ga0055535_1000198 3300003761 Bacteria 63889
22 Ga0055529_1000911 3300003763 Bacteria 16150
23 Ga0055526_1001599 3300003771 Bacteria 15892
24 Ga0055524_1001433 3300003775 Bacteria 13696
25 Ga0055531_10002486 3300003794 Bacteria 12290
26 Ga0055531_10006204 3300003794 Bacteria 6825
27 Ga0055531_10008645 3300003794 Bacteria 5329
28 Ga0065165_1000411 3300005262 Bacteria 68430
29 Ga0065165_1000678 3300005262 Bacteria 49056
30 Ga0070658_10025275 3300005327 Bacteria 4762
31 Ga0070658_10405127 3300005327 Bacteria 1172
32 Ga0070683_100173965 3300005329 Bacteria 2044
33 Ga0070690_100017473 3300005330 Bacteria 4314
34 Ga0070682_100168179 3300005337 Bacteria 1521
35 Ga0070660_100069284 3300005339 Bacteria 2750
36 Ga0068855_100004750 3300005563 Bacteria 16587
37 Ga0068857_100001183 3300005577 Bacteria 20375
38 Ga0068854_100011407 3300005578 Bacteria 5784
39 Ga0068856_100000722 3300005614 Bacteria 35876
40 Ga0068859_100166944 3300005617 Bacteria 2281
41 Ga0068859_100220955 3300005617 Bacteria 1982
42 Ga0068864_100225463 3300005618 Bacteria 1731
43 Ga0068861_100054241 3300005719 Bacteria 3053
44 Ga0068863_100271160 3300005841 Bacteria 1643
45 Ga0068862_100274169 3300005844 Bacteria 1544
46 Ga0081539_10000007 3300005985 Bacteria 532790
47 Ga0075366_10023262 3300006195 Bacteria 3609
48 Ga0075366_10086902 3300006195 Bacteria 1871
49 Ga0075370_10005976 3300006353 Bacteria 6092
50 Ga0075370_10007965 3300006353 Bacteria 5429
51 Ga0075370_10012173 3300006353 Bacteria 4539
52 Ga0097620_100166945 3300006931 Bacteria 2281
53 Ga0097620_100220965 3300006931 Bacteria 1982
54 Ga0099823_1001509 3300006944 Bacteria 19439
55 Ga0105241_10458162 3300009174 Bacteria 1129
56 Ga0105237_10042201 3300009545 Bacteria 4601
57 Ga0105238_10050906 3300009551 Bacteria 4168
58 Ga0105249_10067641 3300009553 Bacteria 3292
59 Ga0105239_10019812 3300010375 Bacteria 7424
60 Ga0105239_10043391 3300010375 Bacteria 4929
61 Ga0157319_1000001 3300012497 Bacteria 423237
62 Ga0157378_10082653 3300013297 Bacteria 2905
63 Ga0157376_10364515 3300014969 Bacteria 1387
64 Ga0213872_10001185 3300021361 Bacteria 17711
65 Ga0213872_10002829 3300021361 Bacteria 9921
66 Ga0209674_100003 3300025226 Bacteria 2196646
67 Ga0209563_100049 3300025230 Bacteria 358472
68 Ga0207427_101398 3300025231 Bacteria 8819
69 Ga0209258_100189 3300025242 Bacteria 128268
70 Ga0209258_101303 3300025242 Bacteria 9247
71 Ga0209646_1000124 3300025246 Bacteria 138207
72 Ga0209026_1000085 3300025250 Bacteria 185778
73 Ga0209677_100135 3300025253 Bacteria 69251
74 Ga0209677_100203 3300025253 Bacteria 47561
75 Ga0209759_1000068 3300025256 Bacteria 183479
76 Ga0209759_1000657 3300025256 Bacteria 32051
77 Ga0209759_1001691 3300025256 Bacteria 11476
78 Ga0209759_1005098 3300025256 Bacteria 4690
79 Ga0209759_1022373 3300025256 Bacteria 1414
80 Ga0209455_1000092 3300025272 Bacteria 220516
81 Ga0209673_1004856 3300025273 Bacteria 7023
82 Ga0209564_1000005 3300025295 Bacteria 1147192
83 Ga0209758_1000167 3300025297 Bacteria 151074
84 Ga0209050_1003666 3300025298 Bacteria 11084
85 Ga0209256_1002220 3300025299 Bacteria 16591
86 Ga0209256_1002624 3300025299 Bacteria 14196
87 Ga0209051_1002002 3300025303 Bacteria 15550
88 Ga0209051_1006130 3300025303 Bacteria 6835
89 Ga0209257_1002900 3300025304 Bacteria 15886
90 Ga0209257_1003449 3300025304 Bacteria 13551
91 Ga0207671_10152979 3300025914 Bacteria 1783
92 Ga0207657_10015862 3300025919 Bacteria 7280
93 Ga0207700_10277742 3300025928 Bacteria 1440
94 Ga0207670_10170176 3300025936 Bacteria 1633
95 Ga0207667_10002685 3300025949 Bacteria 22003
96 Ga0207640_10004602 3300025981 Bacteria 7486
97 Ga0207639_10046603 3300026041 Bacteria 3272
98 Ga0207674_10003076 3300026116 Bacteria 20639
99 Ga0207675_100110690 3300026118 Bacteria 2591
100 Ga0209389_1010744 3300027296 Bacteria 8266
101 Ga0209371_1019515 3300027312 Bacteria 1689
102 Ga0268265_10246738 3300028380 Bacteria 1579
103 Ga0265336_10000006 3300028666 Bacteria 348453
104 Ga0307517_10129087 3300028786 Bacteria 1829
105 Ga0265324_10004852 3300029957 Bacteria 5931
106 Ga0307516_10001445 3300031730 Bacteria 32809
107 Ga0307516_10028233 3300031730 Bacteria 5680
108 Ga0307414_10136279 3300032004 Bacteria 1914
109 Ga0307415_100108804 3300032126 Bacteria 2052
110 Ga0307415_100312321 3300032126 Bacteria 1307
111 Ga0373934_0032114 3300035086 Bacteria 2058
112 Ga0395898_0130038 3300037466 Bacteria 2412
113 Ga0395901_0005776 3300038443 Bacteria 12530
114 Ga0436361_0034970 3300039447 Bacteria 88532
115 Ga0436361_0819273 3300039447 Bacteria 14208
116 Ga0436361_0999087 3300039447 Bacteria 7297
117 Ga0450890_000224 3300042127 Bacteria 8536
118 Ga0439459_0003865 3300042438 Bacteria 2394
119 Ga0466963_0076007 3300044694 Bacteria 2267
120 Ga0453684_0154195 3300044712 Bacteria 2726
121 Ga0451576_0178482 3300045051 Unclassified 2217
122 Ga0495650_0040463 3300046471 Bacteria 2000
123 Ga0495639_0003760 3300046475 Bacteria 6529
124 Ga0495585_0039885 3300046492 Bacteria 2638
125 Ga0495583_0000224 3300046506 Bacteria 95810
126 Ga0495606_0001614 3300046507 Bacteria 29404
127 Ga0495632_0007550 3300046519 Bacteria 6811
128 Ga0495668_0125288 3300046616 Bacteria 1406
129 Ga0495625_0084584 3300046660 Bacteria 2203
130 Ga0495669_0042527 3300046684 Bacteria 2020
131 Ga0495649_0027973 3300046694 Bacteria 3126
132 Ga0495683_0173956 3300047323 Bacteria 988
133 Ga0495686_0002569 3300047472 Bacteria 16905
134 Ga0496124_0018975 3300048927 Bacteria 6419
135 Ga0496125_0028259 3300048928 Bacteria 5071
136 Ga0501034_0000221 3300049571 Bacteria 108958
137 Ga0501068_0003038 3300049584 Bacteria 8961
138 Ga0501069_0112271 3300049585 Bacteria 1553
139 Ga0501071_0029181 3300049587 Bacteria 3891
140 Ga0501073_0006306 3300049589 Bacteria 8835
141 Ga0501079_0006277 3300049741 Bacteria 8914
142 Ga0501080_0001582 3300049742 Bacteria 19293
143 nmdc:mga0k408_45711_c1 3300050493 Bacteria 2527
144 nmdc:mga0k408_82015_c1 3300050493 Bacteria 1889
145 nmdc:mga07m45_43139_c1 3300050496 Bacteria 2529
146 Ga0500635_0000057 3300053080 Bacteria 73077
147 Ga0500646_0005262 3300053090 Bacteria 3271
148 Ga0500583_0040719 3300053092 Bacteria 2106
149 Ga0500651_0058461 3300053093 Bacteria 2411
150 Ga0500641_0007040 3300053096 Bacteria 4006
151 Ga0500642_0000927 3300053130 Bacteria 8498
152 Ga0500652_000467 3300053131 Bacteria 14320
153 Ga0500652_059569 3300053131 Bacteria 1570
154 Ga0500658_0096256 3300053134 Bacteria 1286
155 Ga0500568_0011461 3300053139 Bacteria 4111
156 Ga0500568_0054747 3300053139 Bacteria 1559
157 Ga0500577_0007059 3300053142 Bacteria 3133
158 Ga0500616_0000062 3300053153 Bacteria 245744
159 Ga0500622_0000128 3300053156 Bacteria 79659
160 Ga0500570_021811 3300053724 Bacteria 3562
161 Ga0500645_059526 3300053730 Bacteria 1106
162 Ga0501082_0075310 3300060353 Bacteria 2908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_0003038 Ga0501068_0003038_4086_4997 270
2 3300049587 Ga0501071_0029181 Ga0501071_0029181_24_935 270
3 3300049589 Ga0501073_0006306 Ga0501073_0006306_4959_5870 270
4 3300049741 Ga0501079_0006277 Ga0501079_0006277_268_1179 270
5 3300049742 Ga0501080_0001582 Ga0501080_0001582_543_1454 270
6 3300060353 Ga0501082_0075310 Ga0501082_0075310_1760_2671 270
7 3300006195 Ga0075366_10023262 Ga0075366_100232623 273
8 3300049585 Ga0501069_0112271 Ga0501069_0112271_576_1487 273
9 3300050493 nmdc:mga0k408_45711_c1 nmdc:mga0k408_45711_c1_546_1391 273
10 3300053096 Ga0500641_0007040 Ga0500641_0007040_929_1777 273
11 3300006944 Ga0099823_1001509 Ga0099823_100150923 274
12 3300027296 Ga0209389_1010744 Ga0209389_10107442 274
13 3300003322 rootL2_10086213 rootL2_100862134 275
14 3300003323 rootH1_10013771 rootH1_100137712 275
15 3300025299 Ga0209256_1002220 Ga0209256_100222016 275
16 3300021361 Ga0213872_10001185 Ga0213872_100011851 278
17 3300021361 Ga0213872_10002829 Ga0213872_100028295 278
18 3300025298 Ga0209050_1003666 Ga0209050_10036666 278
19 3300025303 Ga0209051_1002002 Ga0209051_100200212 278
20 3300025304 Ga0209257_1002900 Ga0209257_100290013 278
21 3300039447 Ga0436361_0034970 Ga0436361_0034970_14489_15445 278
22 3300039447 Ga0436361_0819273 Ga0436361_0819273_4786_5673 278
23 3300003203 JGI25406J46586_10025669 JGI25406J46586_100256694 279
24 3300003794 Ga0055531_10006204 Ga0055531_100062046 279
25 3300005844 Ga0068862_100274169 Ga0068862_1002741691 279
26 3300005985 Ga0081539_10000007 Ga0081539_10000007299 279
27 3300010375 Ga0105239_10043391 Ga0105239_100433912 279
28 3300025928 Ga0207700_10277742 Ga0207700_102777422 279
29 3300028380 Ga0268265_10246738 Ga0268265_102467382 279
30 3300009553 Ga0105249_10067641 Ga0105249_100676416 280
31 3300053134 Ga0500658_0096256 Ga0500658_0096256_10_888 280
32 3300003794 Ga0055531_10002486 Ga0055531_1000248613 281
33 3300003794 Ga0055531_10008645 Ga0055531_100086454 281
34 3300005617 Ga0068859_100166944 Ga0068859_1001669444 281
35 3300006931 Ga0097620_100166945 Ga0097620_1001669454 281
36 3300012497 Ga0157319_1000001 Ga0157319_1000001141 281
37 3300025256 Ga0209759_1022373 Ga0209759_10223732 281
38 3300025304 Ga0209257_1003449 Ga0209257_10034492 281
39 3300003323 rootH1_10402802 rootH1_104028021 282
40 3300031730 Ga0307516_10028233 Ga0307516_100282335 282
41 3300044712 Ga0453684_0154195 Ga0453684_0154195_1460_2419 282
42 3300047323 Ga0495683_0173956 Ga0495683_0173956_88_936 282
43 3300003775 Ga0055524_1001433 Ga0055524_100143315 283
44 3300006353 Ga0075370_10007965 Ga0075370_100079652 283
45 3300014969 Ga0157376_10364515 Ga0157376_103645152 283
46 3300025299 Ga0209256_1002624 Ga0209256_10026242 283
47 3300050493 nmdc:mga0k408_82015_c1 nmdc:mga0k408_82015_c1_84_935 283
48 3300050496 nmdc:mga07m45_43139_c1 nmdc:mga07m45_43139_c1_916_1971 283
49 3300053092 Ga0500583_0040719 Ga0500583_0040719_887_1846 283
50 3300053139 Ga0500568_0054747 Ga0500568_0054747_322_1257 283
51 3300053153 Ga0500616_0000062 Ga0500616_0000062_173121_174092 283
52 3300005339 Ga0070660_100069284 Ga0070660_1000692842 284
53 3300025256 Ga0209759_1005098 Ga0209759_10050982 284
54 3300025919 Ga0207657_10015862 Ga0207657_100158626 284
55 3300028666 Ga0265336_10000006 Ga0265336_10000006308 284
56 3300029957 Ga0265324_10004852 Ga0265324_100048524 284
57 3300048928 Ga0496125_0028259 Ga0496125_0028259_323_1300 284
58 3300049571 Ga0501034_0000221 Ga0501034_0000221_22057_22974 284
59 iso_pu_bacteria 2585428057 2587727185 284
60 iso_pu_bacteria 2585428058 2587731868 284
61 iso_pu_bacteria 2588253510 2588291597 284
62 3300005617 Ga0068859_100220955 Ga0068859_1002209552 285
63 3300006931 Ga0097620_100220965 Ga0097620_1002209652 285
64 3300025297 Ga0209758_1000167 Ga0209758_1000167111 285
65 3300025303 Ga0209051_1006130 Ga0209051_10061306 285
66 3300045051 Ga0451576_0178482 Ga0451576_0178482_695_1624 285
67 3300003323 rootH1_10187076 rootH1_101870762 286
68 3300005327 Ga0070658_10405127 Ga0070658_104051272 286
69 3300032004 Ga0307414_10136279 Ga0307414_101362792 286
70 3300032126 Ga0307415_100108804 Ga0307415_1001088041 286
71 iso_pu_bacteria 2894414249 2894416313 286
72 3300003771 Ga0055526_1001599 Ga0055526_10015996 287
73 3300005337 Ga0070682_100168179 Ga0070682_1001681792 287
74 3300005618 Ga0068864_100225463 Ga0068864_1002254632 287
75 3300006353 Ga0075370_10005976 Ga0075370_100059763 287
76 3300025256 Ga0209759_1000657 Ga0209759_10006575 287
77 3300025273 Ga0209673_1004856 Ga0209673_10048562 287
78 3300025295 Ga0209564_1000005 Ga0209564_1000005346 287
79 3300028786 Ga0307517_10129087 Ga0307517_101290872 287
80 3300032126 Ga0307415_100312321 Ga0307415_1003123212 287
81 3300044694 Ga0466963_0076007 Ga0466963_0076007_44_1123 287
82 3300046519 Ga0495632_0007550 Ga0495632_0007550_3540_4466 287
83 3300053090 Ga0500646_0005262 Ga0500646_0005262_1732_2658 287
84 3300053093 Ga0500651_0058461 Ga0500651_0058461_905_1831 287
85 3300053130 Ga0500642_0000927 Ga0500642_0000927_909_1835 287
86 3300053131 Ga0500652_000467 Ga0500652_000467_2087_3013 287
87 3300053139 Ga0500568_0011461 Ga0500568_0011461_900_1826 287
88 3300053142 Ga0500577_0007059 Ga0500577_0007059_1588_2514 287
89 3300053156 Ga0500622_0000128 Ga0500622_0000128_11192_12118 287
90 3300053724 Ga0500570_021811 Ga0500570_021811_1772_2698 287
91 3300053730 Ga0500645_059526 Ga0500645_059526_52_978 287
92 iso_pu_bacteria 2831864461 2831866657 287
93 3300003316 rootH1_10001028 rootH1_1000102816 288
94 3300003322 rootL2_10001519 rootL2_1000151923 288
95 3300003323 rootH1_10013770 rootH1_100137703 288
96 3300003323 rootH1_10054607 rootH1_100546074 288
97 3300048927 Ga0496124_0018975 Ga0496124_0018975_5280_6356 288
98 3300005262 Ga0065165_1000678 Ga0065165_100067820 289
99 3300039447 Ga0436361_0999087 Ga0436361_0999087_827_1753 289
100 3300005262 Ga0065165_1000411 Ga0065165_100041116 290
101 3300027312 Ga0209371_1019515 Ga0209371_10195152 290
102 3300046660 Ga0495625_0084584 Ga0495625_0084584_234_1199 290
103 3300053080 Ga0500635_0000057 Ga0500635_0000057_7547_8497 290
104 iso_pu_bacteria 2886848708 2886854228 290
105 3300003761 Ga0055535_1000198 Ga0055535_100019859 291
106 3300003763 Ga0055529_1000911 Ga0055529_10009114 291
107 3300005841 Ga0068863_100271160 Ga0068863_1002711602 291
108 3300025242 Ga0209258_100189 Ga0209258_10018966 291
109 3300025242 Ga0209258_101303 Ga0209258_1013035 291
110 3300025256 Ga0209759_1001691 Ga0209759_10016914 291
111 3300025272 Ga0209455_1000092 Ga0209455_100009264 291
112 3300031730 Ga0307516_10001445 Ga0307516_100014459 291
113 3300037466 Ga0395898_0130038 Ga0395898_0130038_995_1954 291
114 3300042127 Ga0450890_000224 Ga0450890_000224_7352_8413 291
115 3300046475 Ga0495639_0003760 Ga0495639_0003760_5180_6172 291
116 3300005327 Ga0070658_10025275 Ga0070658_100252754 292
117 3300005563 Ga0068855_100004750 Ga0068855_1000047507 292
118 3300009545 Ga0105237_10042201 Ga0105237_100422012 292
119 3300009551 Ga0105238_10050906 Ga0105238_100509063 292
120 3300010375 Ga0105239_10019812 Ga0105239_100198123 292
121 3300025949 Ga0207667_10002685 Ga0207667_1000268513 292
122 3300038443 Ga0395901_0005776 Ga0395901_0005776_5379_6341 292
123 3300042438 Ga0439459_0003865 Ga0439459_0003865_1315_2376 292
124 3300046471 Ga0495650_0040463 Ga0495650_0040463_874_1878 292
125 3300046506 Ga0495583_0000224 Ga0495583_0000224_34_996 292
126 3300046507 Ga0495606_0001614 Ga0495606_0001614_4452_5414 292
127 3300046616 Ga0495668_0125288 Ga0495668_0125288_70_1032 292
128 3300046684 Ga0495669_0042527 Ga0495669_0042527_331_1293 292
129 3300046694 Ga0495649_0027973 Ga0495649_0027973_431_1393 292
130 3300047472 Ga0495686_0002569 Ga0495686_0002569_13803_14765 292
131 3300053131 Ga0500652_059569 Ga0500652_059569_278_1240 292
132 3300002705 JGI25156J39149_1000222 JGI25156J39149_100022234 293
133 3300002705 JGI25156J39149_1000835 JGI25156J39149_100083510 293
134 3300002741 JGI25157J39369_1000056 JGI25157J39369_100005652 293
135 3300002741 JGI25157J39369_1000100 JGI25157J39369_100010014 293
136 3300003316 rootH1_10021924 rootH1_100219242 293
137 3300003752 Ga0055539_1000400 Ga0055539_100040012 293
138 3300003752 Ga0055539_1002889 Ga0055539_10028892 293
139 3300003756 Ga0055533_1000080 Ga0055533_1000080116 293
140 3300003759 Ga0055525_1001331 Ga0055525_10013311 293
141 3300005329 Ga0070683_100173965 Ga0070683_1001739652 293
142 3300005330 Ga0070690_100017473 Ga0070690_1000174733 293
143 3300005577 Ga0068857_100001183 Ga0068857_10000118312 293
144 3300005578 Ga0068854_100011407 Ga0068854_1000114074 293
145 3300005614 Ga0068856_100000722 Ga0068856_10000072223 293
146 3300005719 Ga0068861_100054241 Ga0068861_1000542413 293
147 3300006195 Ga0075366_10086902 Ga0075366_100869022 293
148 3300006353 Ga0075370_10012173 Ga0075370_100121734 293
149 3300009174 Ga0105241_10458162 Ga0105241_104581622 293
150 3300013297 Ga0157378_10082653 Ga0157378_100826532 293
151 3300025226 Ga0209674_100003 Ga0209674_1000031849 293
152 3300025230 Ga0209563_100049 Ga0209563_100049311 293
153 3300025231 Ga0207427_101398 Ga0207427_1013982 293
154 3300025246 Ga0209646_1000124 Ga0209646_100012457 293
155 3300025250 Ga0209026_1000085 Ga0209026_100008557 293
156 3300025253 Ga0209677_100135 Ga0209677_10013518 293
157 3300025253 Ga0209677_100203 Ga0209677_10020343 293
158 3300025256 Ga0209759_1000068 Ga0209759_100006855 293
159 3300025914 Ga0207671_10152979 Ga0207671_101529792 293
160 3300025936 Ga0207670_10170176 Ga0207670_101701762 293
161 3300025981 Ga0207640_10004602 Ga0207640_100046026 293
162 3300026041 Ga0207639_10046603 Ga0207639_100466032 293
163 3300026116 Ga0207674_10003076 Ga0207674_100030768 293
164 3300026118 Ga0207675_100110690 Ga0207675_1001106902 293
165 3300035086 Ga0373934_0032114 Ga0373934_0032114_255_1226 293
166 3300046492 Ga0495585_0039885 Ga0495585_0039885_896_1894 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00160

Pro_isomerase

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

70

271

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ex1-assembly2.cif.gz_D crystal structure of cyclophilin aquacyp300 from hirschia baltica 0.9169 25 286
5ex1-assembly2.cif.gz_D crystal structure of cyclophilin aquacyp300 from hirschia baltica 0.8458 25 286
5ex2-assembly2.cif.gz_B crystal structure of cyclophilin aquacyp293 from hirschia baltica 0.7961 26 291
3bo7-assembly1.cif.gz_A crystal structure of toxoplasma gondii peptidyl-prolyl cis-trans isomerase, 541.m00136 0.7886 34 229
5xjc-assembly1.cif.gz_S cryo-em structure of the human spliceosome just prior to exon ligation at 3.6 angstrom 0.7848 26 231
ID Description Score Start End Superfamily
af_A0A0R0L6H2_25_167_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8331 34 208 2.40.100.10
3bo7A00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.7886 34 229 2.40.100.10
af_A0A0R4J2Z8_2_164_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.7844 34 230 2.40.100.10
af_A0A0R0L6H2_25_167_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.784 34 208 2.40.100.10
af_Q86IX8_29_167_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.7596 36 202 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A2G3J8I5-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9757 12 286 GO:0140839
GO:0140840
AF-A0A1I4XE05-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9728 12 285 GO:0140839
GO:0140840
AF-A0A7W3IHY8-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.972 12 285 GO:0003755
AF-A0A2S6B3Q5-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9713 12 285 GO:0140839
GO:0140840
AF-A0A7H0G1M1-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9707 12 285 GO:0140839
GO:0140840

Feature Viewer

pLDDT pTM Quality
92.25 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map