F249001

General Info

Members Datasets Scaffolds Average Seq Length
166 134 159 209

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0261835|Ga0495629_0261835_202_834
Length 191
Sequence LPISHDHIRDGAEIYRRSFAIIRQEADLARFDPVEERVAVRIIHACGMTEIGGAAILCDSKMVANGITRTRLPVDNAVICTLDDPAVPGIARRIGNTRTAAALELWGDRLAGAVVAVGNAPTALFRLLEMLDAGAPPPAAVIGLPVGFVGAMESKEALAADGRLPFLIVRGRRGGSAMAVAAVNALASDLE

Samples

Sample ID Description Type Environment
1 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
2 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
3 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
4 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
5 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
6 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
121 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
125 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
130 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
131 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
134 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.78
Metatranscriptomes 0
Isolates 4.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.43
Nodule 0
Rhizoplane 12.05
Rhizosphere 71.69
Stem 0
Stem Tuber 0
Unclassified 7.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100294537 3300005334 Bacteria 1308
2 Ga0070682_100079352 3300005337 Bacteria 2119
3 Ga0068868_100004610 3300005338 Bacteria 9668
4 Ga0070689_100089424 3300005340 Bacteria 2425
5 Ga0070661_100039654 3300005344 Bacteria 3432
6 Ga0070692_10005089 3300005345 Bacteria 5560
7 Ga0070692_10029434 3300005345 Bacteria 2737
8 Ga0070668_100203860 3300005347 Bacteria 1624
9 Ga0070669_100188064 3300005353 Bacteria 1619
10 Ga0070700_100213290 3300005441 Bacteria 1363
11 Ga0070663_100016653 3300005455 Bacteria 4781
12 Ga0070663_100054776 3300005455 Bacteria 2852
13 Ga0070681_10809574 3300005458 Bacteria 854
14 Ga0068867_100142057 3300005459 Bacteria 1878
15 Ga0070685_10100628 3300005466 Bacteria 1764
16 Ga0070707_100776103 3300005468 Bacteria 922
17 Ga0068862_100055616 3300005844 Bacteria 3389
18 Ga0070717_10770150 3300006028 Bacteria 875
19 Ga0075363_100233773 3300006048 Bacteria 1056
20 Ga0075364_10043680 3300006051 Bacteria 2914
21 Ga0070716_100030276 3300006173 Bacteria 2934
22 Ga0070712_100138042 3300006175 Bacteria 1857
23 Ga0070712_100426699 3300006175 Bacteria 1100
24 Ga0075367_10346926 3300006178 Bacteria 937
25 Ga0075369_10005193 3300006186 Bacteria 4851
26 Ga0075369_10021191 3300006186 Bacteria 2668
27 Ga0099794_10009892 3300007265 Bacteria 4031
28 Ga0099795_10006278 3300007788 Bacteria 3234
29 Ga0099795_10028700 3300007788 Bacteria 1895
30 Ga0105245_10014721 3300009098 Bacteria 6812
31 Ga0105245_10187639 3300009098 Bacteria 1979
32 Ga0105247_10339651 3300009101 Bacteria 1053
33 Ga0114129_11049446 3300009147 Bacteria 1023
34 Ga0105242_10983360 3300009176 Bacteria 850
35 Ga0105249_10128300 3300009553 Bacteria 2418
36 Ga0099796_10041059 3300010159 Bacteria 1565
37 Ga0099796_10078715 3300010159 Bacteria 1204
38 Ga0099796_10115833 3300010159 Bacteria 1025
39 Ga0157369_10074016 3300013105 Bacteria 3653
40 Ga0163162_11030504 3300013306 Bacteria 931
41 Ga0157372_10285251 3300013307 Bacteria 1920
42 Ga0157375_10291052 3300013308 Bacteria 1796
43 Ga0157379_11251404 3300014968 Bacteria 715
44 Ga0163161_10273098 3300017792 Bacteria 1323
45 Ga0207642_10221054 3300025899 Bacteria 1058
46 Ga0207645_10053749 3300025907 Bacteria 2573
47 Ga0207705_10079486 3300025909 Bacteria 2388
48 Ga0207684_10513259 3300025910 Bacteria 1027
49 Ga0207657_10105420 3300025919 Bacteria 2334
50 Ga0207646_10994257 3300025922 Bacteria 741
51 Ga0207681_10377019 3300025923 Bacteria 1141
52 Ga0207650_10192732 3300025925 Bacteria 1629
53 Ga0207687_10129533 3300025927 Bacteria 1899
54 Ga0207700_10516707 3300025928 Bacteria 1058
55 Ga0207700_11176468 3300025928 Bacteria 685
56 Ga0207670_10130138 3300025936 Bacteria 1842
57 Ga0207689_10031242 3300025942 Bacteria 4435
58 Ga0207661_10305955 3300025944 Bacteria 1426
59 Ga0207712_10192238 3300025961 Bacteria 1612
60 Ga0207678_10023195 3300026067 Bacteria 5428
61 Ga0207708_10007437 3300026075 Bacteria 8097
62 Ga0207675_100007502 3300026118 Bacteria 10303
63 Ga0207683_10296172 3300026121 Bacteria 1480
64 Ga0207698_10934739 3300026142 Bacteria 876
65 Ga0209588_1015560 3300027671 Bacteria 2340
66 Ga0307513_10109313 3300031456 Unclassified 2763
67 Ga0307508_10000180 3300031616 Bacteria 76716
68 Ga0307508_10261292 3300031616 Bacteria 1326
69 Ga0265314_10045549 3300031711 Bacteria 3101
70 Ga0307410_10502413 3300031852 Bacteria 998
71 Ga0307406_10122578 3300031901 Bacteria 1810
72 Ga0307407_10049795 3300031903 Bacteria 2393
73 Ga0307409_100004148 3300031995 Bacteria 8064
74 Ga0307409_100280483 3300031995 Bacteria 1540
75 Ga0307416_100007932 3300032002 Bacteria 6797
76 Ga0307416_101148083 3300032002 Bacteria 882
77 Ga0307414_10105118 3300032004 Bacteria 2134
78 Ga0307414_10380725 3300032004 Bacteria 1220
79 Ga0307415_100007485 3300032126 Bacteria 5977
80 Ga0373945_0262488 3300035116 Bacteria 732
81 Ga0373943_0010319 3300035170 Bacteria 4190
82 Ga0373943_0024404 3300035170 Bacteria 2819
83 Ga0373931_0200215 3300035691 Bacteria 1193
84 Ga0373935_0022012 3300035692 Bacteria 3904
85 Ga0373935_0234203 3300035692 Bacteria 1280
86 Ga0373927_0004092 3300035695 Bacteria 10274
87 Ga0373947_0101235 3300035725 Bacteria 1811
88 Ga0373947_0141302 3300035725 Bacteria 1544
89 Ga0373947_0180689 3300035725 Bacteria 1373
90 Ga0373925_0136065 3300037068 Bacteria 1920
91 Ga0436364_0749300 3300037853 Bacteria 922
92 Ga0436364_0793327 3300037853 Bacteria 914
93 Ga0395901_0507021 3300038443 Bacteria 1228
94 Ga0436365_0601201 3300039437 Bacteria 1186
95 Ga0436365_0618907 3300039437 Bacteria 3711
96 Ga0436360_0171574 3300039438 Bacteria 956
97 Ga0436360_0454492 3300039438 Bacteria 2586
98 Ga0436363_1104978 3300039450 Bacteria 874
99 Ga0436362_1018140 3300039453 Bacteria 1701
100 Ga0450901_013686 3300042533 Bacteria 850
101 Ga0466972_0041967 3300044658 Bacteria 2226
102 Ga0466965_0154219 3300044683 Bacteria 1202
103 Ga0466961_0034007 3300044693 Bacteria 3274
104 Ga0466970_0071403 3300044765 Bacteria 1867
105 Ga0466960_0139403 3300044901 Bacteria 1287
106 Ga0466960_0154446 3300044901 Bacteria 1228
107 Ga0495629_0261835 3300046459 Bacteria 1189
108 Ga0495653_0453948 3300046463 Bacteria 806
109 Ga0495580_0311077 3300046472 Bacteria 1072
110 Ga0495628_0393947 3300046516 Bacteria 1013
111 Ga0495630_0119104 3300046517 Bacteria 2002
112 Ga0495630_0134345 3300046517 Bacteria 1880
113 Ga0495640_0041727 3300046533 Bacteria 3205
114 Ga0495640_0078800 3300046533 Bacteria 2194
115 Ga0495667_0291147 3300046559 Bacteria 1035
116 Ga0495581_0091418 3300047315 Bacteria 1766
117 Ga0495674_0068402 3300047319 Bacteria 3074
118 Ga0495614_0108486 3300048089 Bacteria 1218
119 Ga0496100_0174246 3300048903 Bacteria 1552
120 Ga0496101_0124284 3300048904 Bacteria 1954
121 Ga0496102_0064383 3300048905 Bacteria 3358
122 Ga0496102_0452506 3300048905 Bacteria 1204
123 Ga0496104_0639935 3300048907 Bacteria 972
124 Ga0496105_0021628 3300048908 Bacteria 5206
125 Ga0496105_0238022 3300048908 Bacteria 1478
126 Ga0496105_0573920 3300048908 Bacteria 878
127 Ga0496108_0228764 3300048911 Bacteria 1617
128 Ga0496108_0604695 3300048911 Bacteria 955
129 Ga0496109_0065731 3300048912 Bacteria 3320
130 Ga0496109_0187360 3300048912 Bacteria 1944
131 Ga0496110_0447630 3300048913 Bacteria 1177
132 Ga0496111_0383080 3300048914 Bacteria 1040
133 Ga0496112_0016649 3300048915 Bacteria 6893
134 Ga0496112_0323147 3300048915 Bacteria 1487
135 Ga0496113_0314820 3300048916 Bacteria 1254
136 Ga0496113_0448711 3300048916 Bacteria 1036
137 Ga0496115_0736371 3300048918 Bacteria 772
138 Ga0496124_0004201 3300048927 Bacteria 16955
139 Ga0501032_0078040 3300049569 Bacteria 2205
140 Ga0501034_0730435 3300049571 Bacteria 887
141 Ga0501038_0232789 3300049574 Bacteria 1465
142 Ga0501073_0117048 3300049589 Bacteria 1847
143 Ga0501074_0410658 3300049590 Bacteria 960
144 nmdc:mga03683_7298_c1 3300050489 Bacteria 3830
145 nmdc:mga03683_86651_c1 3300050489 Bacteria 1360
146 nmdc:mga0yw44_353_c3 3300050492 Bacteria 9369
147 nmdc:mga06z11_72186_c1 3300050494 Bacteria 1829
148 nmdc:mga0n895_476359_c1 3300050512 Bacteria 1259
149 nmdc:mga08x19_5991_c1 3300050514 Bacteria 7189
150 nmdc:mga0sz30_18965_c1 3300050516 Bacteria 2758
151 Ga0495601_0006281 3300053077 Bacteria 6941
152 Ga0495601_0091423 3300053077 Bacteria 1959
153 Ga0495595_0033033 3300053084 Bacteria 2333
154 Ga0495619_0016566 3300053085 Bacteria 4666
155 Ga0500595_022879 3300053119 Bacteria 2203
156 Ga0500618_007327 3300053125 Bacteria 3156
157 Ga0500658_0154275 3300053134 Bacteria 1037
158 Ga0500616_0000923 3300053153 Bacteria 32124
159 Ga0466962_0003251 3300061719 Bacteria 7720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047319 Ga0495674_0068402 Ga0495674_0068402_1026_1586 181
2 3300005455 Ga0070663_100016653 Ga0070663_1000166533 189
3 3300026067 Ga0207678_10023195 Ga0207678_100231953 189
4 3300046459 Ga0495629_0261835 Ga0495629_0261835_202_834 189
5 3300048907 Ga0496104_0639935 Ga0496104_0639935_30_686 197
6 3300048908 Ga0496105_0021628 Ga0496105_0021628_4340_4996 197
7 3300048918 Ga0496115_0736371 Ga0496115_0736371_32_688 197
8 3300007788 Ga0099795_10028700 Ga0099795_100287002 200
9 3300010159 Ga0099796_10041059 Ga0099796_100410592 200
10 iso_pu_bacteria 2928142448 2928144418 203
11 3300013306 Ga0163162_11030504 Ga0163162_110305042 205
12 3300031616 Ga0307508_10000180 Ga0307508_100001808 205
13 iso_pu_bacteria 2599185156 2599334673 205
14 iso_pu_bacteria 2842922631 2842925797 205
15 iso_pu_bacteria 2915358134 2915365126 205
16 3300009098 Ga0105245_10014721 Ga0105245_100147212 206
17 3300025927 Ga0207687_10129533 Ga0207687_101295332 206
18 3300031852 Ga0307410_10502413 Ga0307410_105024132 206
19 3300031901 Ga0307406_10122578 Ga0307406_101225782 206
20 3300031903 Ga0307407_10049795 Ga0307407_100497952 206
21 3300031995 Ga0307409_100004148 Ga0307409_1000041482 206
22 3300031995 Ga0307409_100280483 Ga0307409_1002804832 206
23 3300032002 Ga0307416_100007932 Ga0307416_1000079324 206
24 3300032002 Ga0307416_101148083 Ga0307416_1011480832 206
25 3300032004 Ga0307414_10380725 Ga0307414_103807252 206
26 3300032126 Ga0307415_100007485 Ga0307415_1000074852 206
27 3300035691 Ga0373931_0200215 Ga0373931_0200215_331_954 206
28 3300042533 Ga0450901_013686 Ga0450901_013686_47_667 206
29 3300044658 Ga0466972_0041967 Ga0466972_0041967_1180_1803 206
30 3300044683 Ga0466965_0154219 Ga0466965_0154219_231_854 206
31 3300044693 Ga0466961_0034007 Ga0466961_0034007_2079_2702 206
32 3300044765 Ga0466970_0071403 Ga0466970_0071403_491_1114 206
33 3300044901 Ga0466960_0139403 Ga0466960_0139403_424_1044 206
34 3300050489 nmdc:mga03683_7298_c1 nmdc:mga03683_7298_c1_2039_2662 206
35 3300061719 Ga0466962_0003251 Ga0466962_0003251_6115_6738 206
36 iso_pu_bacteria 8018150411 8018153456 206
37 3300006048 Ga0075363_100233773 Ga0075363_1002337732 207
38 3300006051 Ga0075364_10043680 Ga0075364_100436802 207
39 3300006173 Ga0070716_100030276 Ga0070716_1000302763 207
40 3300007265 Ga0099794_10009892 Ga0099794_100098922 207
41 3300010159 Ga0099796_10078715 Ga0099796_100787151 207
42 3300027671 Ga0209588_1015560 Ga0209588_10155603 207
43 3300031616 Ga0307508_10261292 Ga0307508_102612922 207
44 3300035170 Ga0373943_0024404 Ga0373943_0024404_1405_2034 207
45 3300035695 Ga0373927_0004092 Ga0373927_0004092_6550_7179 207
46 3300035725 Ga0373947_0101235 Ga0373947_0101235_910_1539 207
47 3300037068 Ga0373925_0136065 Ga0373925_0136065_234_863 207
48 3300039437 Ga0436365_0601201 Ga0436365_0601201_235_858 207
49 3300039438 Ga0436360_0454492 Ga0436360_0454492_1344_1970 207
50 3300039453 Ga0436362_1018140 Ga0436362_1018140_390_1016 207
51 3300044901 Ga0466960_0154446 Ga0466960_0154446_379_1002 207
52 3300053119 Ga0500595_022879 Ga0500595_022879_1051_1677 207
53 iso_pu_bacteria 2919450847 2919451820 207
54 3300005441 Ga0070700_100213290 Ga0070700_1002132901 208
55 3300005458 Ga0070681_10809574 Ga0070681_108095742 208
56 3300005468 Ga0070707_100776103 Ga0070707_1007761032 208
57 3300006028 Ga0070717_10770150 Ga0070717_107701502 208
58 3300006178 Ga0075367_10346926 Ga0075367_103469262 208
59 3300006186 Ga0075369_10005193 Ga0075369_100051933 208
60 3300006186 Ga0075369_10021191 Ga0075369_100211912 208
61 3300009147 Ga0114129_11049446 Ga0114129_110494462 208
62 3300010159 Ga0099796_10115833 Ga0099796_101158332 208
63 3300025910 Ga0207684_10513259 Ga0207684_105132591 208
64 3300025922 Ga0207646_10994257 Ga0207646_109942571 208
65 3300031456 Ga0307513_10109313 Ga0307513_101093134 208
66 3300035692 Ga0373935_0022012 Ga0373935_0022012_776_1408 208
67 3300035725 Ga0373947_0180689 Ga0373947_0180689_702_1334 208
68 3300046533 Ga0495640_0041727 Ga0495640_0041727_1620_2252 208
69 3300049569 Ga0501032_0078040 Ga0501032_0078040_1068_1697 208
70 3300049574 Ga0501038_0232789 Ga0501038_0232789_545_1174 208
71 3300049589 Ga0501073_0117048 Ga0501073_0117048_704_1333 208
72 3300050489 nmdc:mga03683_86651_c1 nmdc:mga03683_86651_c1_197_829 208
73 3300050492 nmdc:mga0yw44_353_c3 nmdc:mga0yw44_353_c3_5377_6009 208
74 3300050494 nmdc:mga06z11_72186_c1 nmdc:mga06z11_72186_c1_325_957 208
75 3300050516 nmdc:mga0sz30_18965_c1 nmdc:mga0sz30_18965_c1_1543_2175 208
76 3300053153 Ga0500616_0000923 Ga0500616_0000923_18407_19039 208
77 3300005345 Ga0070692_10005089 Ga0070692_100050895 209
78 3300006175 Ga0070712_100138042 Ga0070712_1001380422 209
79 3300006175 Ga0070712_100426699 Ga0070712_1004266992 209
80 3300007788 Ga0099795_10006278 Ga0099795_100062783 209
81 3300009101 Ga0105247_10339651 Ga0105247_103396512 209
82 3300014968 Ga0157379_11251404 Ga0157379_112514041 209
83 3300025928 Ga0207700_10516707 Ga0207700_105167072 209
84 3300025928 Ga0207700_11176468 Ga0207700_111764681 209
85 3300031711 Ga0265314_10045549 Ga0265314_100455493 209
86 3300032004 Ga0307414_10105118 Ga0307414_101051182 209
87 3300035116 Ga0373945_0262488 Ga0373945_0262488_52_687 209
88 3300035170 Ga0373943_0010319 Ga0373943_0010319_1954_2598 209
89 3300035692 Ga0373935_0234203 Ga0373935_0234203_511_1146 209
90 3300035725 Ga0373947_0141302 Ga0373947_0141302_10_654 209
91 3300037853 Ga0436364_0749300 Ga0436364_0749300_234_881 209
92 3300037853 Ga0436364_0793327 Ga0436364_0793327_164_799 209
93 3300038443 Ga0395901_0507021 Ga0395901_0507021_54_719 209
94 3300039437 Ga0436365_0618907 Ga0436365_0618907_294_929 209
95 3300039438 Ga0436360_0171574 Ga0436360_0171574_137_772 209
96 3300039450 Ga0436363_1104978 Ga0436363_1104978_188_823 209
97 3300046463 Ga0495653_0453948 Ga0495653_0453948_145_780 209
98 3300046472 Ga0495580_0311077 Ga0495580_0311077_101_745 209
99 3300046516 Ga0495628_0393947 Ga0495628_0393947_332_967 209
100 3300046517 Ga0495630_0119104 Ga0495630_0119104_239_883 209
101 3300046517 Ga0495630_0134345 Ga0495630_0134345_705_1340 209
102 3300046533 Ga0495640_0078800 Ga0495640_0078800_1514_2158 209
103 3300046559 Ga0495667_0291147 Ga0495667_0291147_255_890 209
104 3300047315 Ga0495581_0091418 Ga0495581_0091418_442_1086 209
105 3300048089 Ga0495614_0108486 Ga0495614_0108486_133_765 209
106 3300048903 Ga0496100_0174246 Ga0496100_0174246_887_1534 209
107 3300048904 Ga0496101_0124284 Ga0496101_0124284_25_660 209
108 3300048905 Ga0496102_0064383 Ga0496102_0064383_378_1013 209
109 3300048905 Ga0496102_0452506 Ga0496102_0452506_309_944 209
110 3300048908 Ga0496105_0238022 Ga0496105_0238022_51_686 209
111 3300048908 Ga0496105_0573920 Ga0496105_0573920_15_707 209
112 3300048911 Ga0496108_0228764 Ga0496108_0228764_17_652 209
113 3300048911 Ga0496108_0604695 Ga0496108_0604695_156_791 209
114 3300048912 Ga0496109_0187360 Ga0496109_0187360_135_770 209
115 3300048913 Ga0496110_0447630 Ga0496110_0447630_183_818 209
116 3300048915 Ga0496112_0016649 Ga0496112_0016649_2322_2957 209
117 3300048915 Ga0496112_0323147 Ga0496112_0323147_149_784 209
118 3300048916 Ga0496113_0314820 Ga0496113_0314820_235_891 209
119 3300048916 Ga0496113_0448711 Ga0496113_0448711_84_719 209
120 3300048927 Ga0496124_0004201 Ga0496124_0004201_12291_12923 209
121 3300049571 Ga0501034_0730435 Ga0501034_0730435_245_877 209
122 3300049590 Ga0501074_0410658 Ga0501074_0410658_76_708 209
123 3300050512 nmdc:mga0n895_476359_c1 nmdc:mga0n895_476359_c1_554_1189 209
124 3300050514 nmdc:mga08x19_5991_c1 nmdc:mga08x19_5991_c1_3687_4322 209
125 3300053077 Ga0495601_0006281 Ga0495601_0006281_450_1094 209
126 3300053077 Ga0495601_0091423 Ga0495601_0091423_229_864 209
127 3300053084 Ga0495595_0033033 Ga0495595_0033033_389_1024 209
128 3300053085 Ga0495619_0016566 Ga0495619_0016566_194_829 209
129 3300053125 Ga0500618_007327 Ga0500618_007327_335_973 209
130 3300053134 Ga0500658_0154275 Ga0500658_0154275_198_833 209
131 iso_pu_bacteria 2828305725 2828307815 209
132 3300009176 Ga0105242_10983360 Ga0105242_109833601 210
133 3300005334 Ga0068869_100294537 Ga0068869_1002945372 211
134 3300005337 Ga0070682_100079352 Ga0070682_1000793522 211
135 3300005338 Ga0068868_100004610 Ga0068868_10000461010 211
136 3300005340 Ga0070689_100089424 Ga0070689_1000894242 211
137 3300005344 Ga0070661_100039654 Ga0070661_1000396541 211
138 3300005345 Ga0070692_10029434 Ga0070692_100294342 211
139 3300005347 Ga0070668_100203860 Ga0070668_1002038602 211
140 3300005353 Ga0070669_100188064 Ga0070669_1001880642 211
141 3300005455 Ga0070663_100054776 Ga0070663_1000547763 211
142 3300005459 Ga0068867_100142057 Ga0068867_1001420572 211
143 3300005466 Ga0070685_10100628 Ga0070685_101006282 211
144 3300005844 Ga0068862_100055616 Ga0068862_1000556162 211
145 3300009098 Ga0105245_10187639 Ga0105245_101876392 211
146 3300009553 Ga0105249_10128300 Ga0105249_101283002 211
147 3300013105 Ga0157369_10074016 Ga0157369_100740163 211
148 3300013307 Ga0157372_10285251 Ga0157372_102852511 211
149 3300013308 Ga0157375_10291052 Ga0157375_102910522 211
150 3300017792 Ga0163161_10273098 Ga0163161_102730982 211
151 3300025899 Ga0207642_10221054 Ga0207642_102210542 211
152 3300025907 Ga0207645_10053749 Ga0207645_100537492 211
153 3300025909 Ga0207705_10079486 Ga0207705_100794862 211
154 3300025919 Ga0207657_10105420 Ga0207657_101054202 211
155 3300025923 Ga0207681_10377019 Ga0207681_103770192 211
156 3300025925 Ga0207650_10192732 Ga0207650_101927322 211
157 3300025936 Ga0207670_10130138 Ga0207670_101301382 211
158 3300025942 Ga0207689_10031242 Ga0207689_100312424 211
159 3300025944 Ga0207661_10305955 Ga0207661_103059552 211
160 3300025961 Ga0207712_10192238 Ga0207712_101922382 211
161 3300026075 Ga0207708_10007437 Ga0207708_100074373 211
162 3300026118 Ga0207675_100007502 Ga0207675_1000075029 211
163 3300026121 Ga0207683_10296172 Ga0207683_102961722 211
164 3300026142 Ga0207698_10934739 Ga0207698_109347391 211
165 3300048912 Ga0496109_0065731 Ga0496109_0065731_590_1225 211
166 3300048914 Ga0496111_0383080 Ga0496111_0383080_319_954 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02570

CbiC

Precorrin-8X methylmutase

51

189

0.98

PF02570

CbiC

Precorrin-8X methylmutase

13

54

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f2v-assembly1.cif.gz_A crystal structure analysis of precorrin-8x methylmutase of aerobic vitamin b12 synthesis 0.9907 4 206
4au1-assembly1.cif.gz_A crystal structure of cobh (precorrin-8x methyl mutase) complexed with c5 desmethyl-hba 0.9882 4 209
3e7d-assembly1.cif.gz_A crystal structure of precorrin-8x methyl mutase cbic/cobh from brucella melitensis 0.9875 6 205
5n0g-assembly1.cif.gz_A-2 crystal structure of cobh t85a (precorrin-8x methyl mutase) complexed with c5 allyl-hba 0.9871 4 209
4au1-assembly1.cif.gz_A crystal structure of cobh (precorrin-8x methyl mutase) complexed with c5 desmethyl-hba 0.9741 4 209
ID Description Score Start End Superfamily
3e7dD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9885 6 208 3.40.50.10230
3e7dD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.979 6 208 3.40.50.10230
1v9cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9225 13 204 3.40.50.10230
2afvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9095 3 208 3.40.50.10230
af_Q58340_4_210_3.40.50.10230 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9069 6 204 3.40.50.10230
ID Description Score Start End GO Terms
AF-A0A511DQT6-F1-model_v4 Precorrin-8X methylmutase 0.9991 42 209 GO:0009236
GO:0016993
AF-A0A6G3X8A9-F1-model_v4 Precorrin-8X methylmutase (EC 5.4.99.61) 0.9988 62 180 GO:0009236
GO:0016993
AF-A0A6G2Y3G0-F1-model_v4 deleted 0.9988 2 96
AF-A0A149UQA8-F1-model_v4 deleted 0.9979 108 209
AF-A0A149RZR5-F1-model_v4 deleted 0.9973 7 209

Feature Viewer

pLDDT pTM Quality
96.01 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map