F248799

General Info

Members Datasets Scaffolds Average Seq Length
166 108 332 202

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0174444|Ga0373937_0174444_846_1550
Length 234
Sequence MRLPLSGRLPAVVTMPPDAANPSAPRRLLIATTNPHKIQELREILVGLPFALVSPGDLGLSLAVEETGTTFAENAVLKATAWADASGMLALADDSGLEIDALGGEPGIYSARWAGADVSYEERFRLLLARLADAPAERRTARYRAAIAVAEPAPSGLYGVVEGTLEGQIAFAPAGSGGFGYDPIFYVPEQRRTVGQMSAEEKHRISHRARAATAARMLLQQLATKQDTSDVGQA

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
12 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
17 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
18 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
19 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
20 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
27 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
28 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
29 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
30 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
31 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
32 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
33 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
34 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
35 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
36 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
37 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
38 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
39 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
40 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
41 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
42 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
46 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
47 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
48 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
49 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
50 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
51 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
52 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
53 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
54 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
55 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
56 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
57 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
58 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
59 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
62 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
63 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
64 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
65 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
73 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
74 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
75 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
76 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
88 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
89 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
90 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
91 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
92 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
101 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
105 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
106 2831426010 Nostoc sp. 106C Isolate Unclassified
107 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
108 2849660919 Nostoc sp. T09 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.39
Metatranscriptomes 1.81
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 79.52
Stem 0
Stem Tuber 0
Unclassified 11.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0174444 3300036401 Bacteria 2018
2 Ga0058860_10901835 3300004801 Unclassified 1188
3 Ga0065707_10419084 3300005295 Bacteria 811
4 Ga0070683_100031081 3300005329 Bacteria 4852
5 Ga0070660_100703399 3300005339 Bacteria 847
6 Ga0070706_100152163 3300005467 Bacteria 2160
7 Ga0070684_100146138 3300005535 Bacteria 2140
8 Ga0068855_100600437 3300005563 Bacteria 1187
9 Ga0068857_100366978 3300005577 Bacteria 1335
10 Ga0068854_100427718 3300005578 Bacteria 1101
11 Ga0075431_100069633 3300006847 Bacteria 3630
12 Ga0075431_100517592 3300006847 Bacteria 1183
13 Ga0075429_100025741 3300006880 Bacteria 5109
14 Ga0105250_10000030 3300009092 Bacteria 177339
15 Ga0111539_10536984 3300009094 Bacteria 1362
16 Ga0114129_10108032 3300009147 Bacteria 3842
17 Ga0114129_10128116 3300009147 Bacteria 3488
18 Ga0114129_10323510 3300009147 Bacteria 2050
19 Ga0114129_10689220 3300009147 Bacteria 1314
20 Ga0157379_10000378 3300014968 Bacteria 35917
21 Ga0206350_10643555 3300020080 Bacteria 1244
22 Ga0213876_10013687 3300021384 Bacteria 4301
23 Ga0213876_10044277 3300021384 Unclassified 2352
24 Ga0213876_10162572 3300021384 Bacteria 1188
25 Ga0213875_10031882 3300021388 Unclassified 2492
26 Ga0224712_10232862 3300022467 Bacteria 846
27 Ga0207696_1000224 3300025711 Bacteria 81312
28 Ga0207684_10418236 3300025910 Bacteria 1152
29 Ga0207661_10179710 3300025944 Bacteria 1847
30 Ga0207640_10289394 3300025981 Bacteria 1291
31 Ga0207674_10389144 3300026116 Bacteria 1348
32 Ga0265326_10061920 3300028558 Unclassified 1058
33 Ga0265334_10052448 3300028573 Bacteria 1561
34 Ga0265318_10053891 3300028577 Bacteria 1507
35 Ga0265323_10023206 3300028653 Bacteria 2367
36 Ga0265338_10112649 3300028800 Bacteria 2187
37 Ga0265328_10086979 3300031239 Bacteria 1154
38 Ga0265320_10023845 3300031240 Unclassified 3248
39 Ga0265325_10137357 3300031241 Bacteria 1165
40 Ga0265316_10157196 3300031344 Bacteria 1701
41 Ga0265316_10193247 3300031344 Bacteria 1511
42 Ga0265313_10124207 3300031595 Bacteria 1123
43 Ga0316575_10046268 3300031665 Bacteria 1728
44 Ga0316575_10094788 3300031665 Bacteria 1211
45 Ga0316577_10092740 3300031733 Bacteria 1691
46 Ga0316577_10189801 3300031733 Bacteria 1161
47 Ga0316577_10247884 3300031733 Bacteria 1008
48 Ga0316583_10002885 3300032133 Bacteria 6036
49 Ga0316574_0122721 3300035398 Bacteria 1669
50 Ga0316574_0558197 3300035398 Bacteria 710
51 Ga0373933_0609141 3300035724 Bacteria 717
52 Ga0316582_0071907 3300036647 Unclassified 2241
53 Ga0316582_0436973 3300036647 Bacteria 902
54 Ga0316584_0196842 3300036712 Bacteria 1488
55 Ga0395900_0005686 3300037418 Bacteria 13035
56 Ga0395900_0040583 3300037418 Bacteria 4796
57 Ga0395898_0024587 3300037466 Bacteria 6075
58 Ga0436364_0154272 3300037853 Unclassified 2060
59 Ga0237819_03189 3300038705 Bacteria 2978
60 Ga0400484_11675 3300038725 Bacteria 1070
61 Ga0400484_16228 3300038725 Bacteria 13154
62 Ga0400490_51969 3300038726 Bacteria 2761
63 Ga0400485_05963 3300038735 Bacteria 1363
64 Ga0400485_06371 3300038735 Bacteria 2098
65 Ga0400485_13606 3300038735 Bacteria 1508
66 Ga0400488_62599 3300038741 Bacteria 1050
67 Ga0400486_02699 3300038742 Bacteria 2079
68 Ga0400486_07851 3300038742 Bacteria 8775
69 Ga0400483_020588 3300039062 Bacteria 6200
70 Ga0400483_045759 3300039062 Bacteria 1669
71 Ga0400483_053567 3300039062 Unclassified 1858
72 Ga0400483_209525 3300039062 Bacteria 7710
73 Ga0400483_288022 3300039062 Bacteria 1860
74 Ga0400489_43383 3300039093 Bacteria 22865
75 Ga0400489_65044 3300039093 Bacteria 1550
76 Ga0400489_92858 3300039093 Bacteria 8978
77 Ga0400487_42363 3300039110 Bacteria 2154
78 Ga0436365_0645207 3300039437 Bacteria 2948
79 Ga0436365_1085262 3300039437 Bacteria 31252
80 Ga0436365_1855865 3300039437 Bacteria 1081
81 Ga0436365_1857975 3300039437 Bacteria 6886
82 Ga0436360_0631666 3300039438 Bacteria 1006
83 Ga0436360_0810211 3300039438 Bacteria 1047
84 Ga0436362_0789444 3300039453 Unclassified 1366
85 Ga0436362_0820081 3300039453 Bacteria 1271
86 Ga0451841_1386344 3300041498 Bacteria 8822
87 Ga0451853_2932710 3300041512 Bacteria 2397
88 Ga0451577_0128341 3300042876 Bacteria 2273
89 Ga0466972_0039933 3300044658 Unclassified 2289
90 Ga0453683_0062983 3300044673 Bacteria 2319
91 Ga0453683_0346723 3300044673 Unclassified 954
92 Ga0466966_0007122 3300044684 Bacteria 7412
93 Ga0466966_0020532 3300044684 Bacteria 4341
94 Ga0466961_0045450 3300044693 Bacteria 2809
95 Ga0466964_0005872 3300044706 Unclassified 4568
96 Ga0453684_0015564 3300044712 Bacteria 12007
97 Ga0453684_0106972 3300044712 Bacteria 3407
98 Ga0453684_0407731 3300044712 Bacteria 1521
99 Ga0453684_0462811 3300044712 Unclassified 1410
100 Ga0453684_0497874 3300044712 Unclassified 1350
101 Ga0453684_0560975 3300044712 Bacteria 1257
102 Ga0453684_1494155 3300044712 Bacteria 697
103 Ga0466968_0000839 3300044735 Bacteria 10734
104 Ga0466970_0006282 3300044765 Bacteria 5934
105 Ga0466970_0073651 3300044765 Unclassified 1838
106 Ga0466970_0434007 3300044765 Bacteria 752
107 Ga0466957_0077802 3300044842 Unclassified 2061
108 Ga0466959_0006376 3300045049 Bacteria 8168
109 Ga0466959_0099238 3300045049 Unclassified 2085
110 Ga0451576_0000853 3300045051 Bacteria 59154
111 Ga0451576_0023756 3300045051 Bacteria 6633
112 Ga0495622_0011038 3300046557 Bacteria 4169
113 Ga0495599_0237164 3300046678 Bacteria 1113
114 Ga0495649_0091697 3300046694 Bacteria 1619
115 Ga0495674_0304804 3300047319 Bacteria 1300
116 Ga0501031_0129468 3300049568 Bacteria 1649
117 Ga0501032_0188688 3300049569 Bacteria 1348
118 Ga0501033_0009457 3300049570 Bacteria 7505
119 Ga0501036_0041140 3300049572 Bacteria 3911
120 Ga0501037_0139115 3300049573 Bacteria 1738
121 Ga0501038_0348679 3300049574 Bacteria 1153
122 Ga0501039_0089174 3300049575 Bacteria 2403
123 Ga0501039_0328102 3300049575 Bacteria 1203
124 Ga0501040_0010536 3300049576 Bacteria 6047
125 Ga0501041_0020840 3300049577 Bacteria 3923
126 Ga0501042_0012811 3300049578 Bacteria 5693
127 Ga0501043_0353126 3300049579 Bacteria 1117
128 Ga0501068_0253063 3300049584 Bacteria 1123
129 Ga0501071_0163943 3300049587 Bacteria 1662
130 Ga0501071_0166325 3300049587 Bacteria 1650
131 Ga0501072_0320371 3300049588 Bacteria 1232
132 Ga0501075_0000059 3300049591 Bacteria 46955
133 Ga0501075_0017220 3300049591 Bacteria 5218
134 Ga0501075_0065699 3300049591 Bacteria 2737
135 Ga0501076_0025769 3300049592 Bacteria 4552
136 Ga0501076_0060756 3300049592 Bacteria 3007
137 Ga0501077_0018491 3300049593 Bacteria 4408
138 Ga0501077_0183221 3300049593 Bacteria 1331
139 Ga0501077_0650488 3300049593 Bacteria 677
140 Ga0501080_0051100 3300049742 Bacteria 3846
141 Ga0501081_0002853 3300049743 Bacteria 10969
142 Ga0501081_0029784 3300049743 Bacteria 3691
143 Ga0501035_0100150 3300049822 Bacteria 2544
144 Ga0501045_0039145 3300049824 Bacteria 3450
145 nmdc:mga05p37_192116_c1 3300050507 Bacteria 2478
146 nmdc:mga05p37_483810_c1 3300050507 Unclassified 1425
147 nmdc:mga05p37_572069_c1 3300050507 Bacteria 1282
148 nmdc:mga05p37_852708_c1 3300050507 Bacteria 989
149 nmdc:mga09592_15008_c1 3300050508 Bacteria 6328
150 nmdc:mga09592_77983_c1 3300050508 Bacteria 2819
151 nmdc:mga06r32_222832_c1 3300050510 Bacteria 1874
152 nmdc:mga06r32_34677_c1 3300050510 Bacteria 4760
153 nmdc:mga0n895_703300_c1 3300050512 Bacteria 1006
154 Ga0495601_0055384 3300053077 Bacteria 2511
155 Ga0495601_0119728 3300053077 Bacteria 1709
156 Ga0501084_0080900 3300054114 Bacteria 2724
157 Ga0501084_0300241 3300054114 Bacteria 1356
158 Ga0501082_0031008 3300060353 Bacteria 4608
159 Ga0501082_0037491 3300060353 Bacteria 4179
160 Ga0501082_0138880 3300060353 Bacteria 2109
161 Ga0466962_0020438 3300061719 Unclassified 3181
162 Ga0530510_0000001 3300061734 Bacteria 285623
163 Ga0530510_0053352 3300061734 Bacteria 2922
164 2831428752 2831426010 Bacteria 8662725
165 2848702187 2848694841 Bacteria 9205737
166 2849667948 2849660919 Bacteria 8251853
167 Ga0373937_0174444
168 Ga0058860_10901835
169 Ga0065707_10419084
170 Ga0070683_100031081
171 Ga0070660_100703399
172 Ga0070706_100152163
173 Ga0070684_100146138
174 Ga0068855_100600437
175 Ga0068857_100366978
176 Ga0068854_100427718
177 Ga0075431_100069633
178 Ga0075431_100517592
179 Ga0075429_100025741
180 Ga0105250_10000030
181 Ga0111539_10536984
182 Ga0114129_10108032
183 Ga0114129_10128116
184 Ga0114129_10323510
185 Ga0114129_10689220
186 Ga0157379_10000378
187 Ga0206350_10643555
188 Ga0213876_10013687
189 Ga0213876_10044277
190 Ga0213876_10162572
191 Ga0213875_10031882
192 Ga0224712_10232862
193 Ga0207696_1000224
194 Ga0207684_10418236
195 Ga0207661_10179710
196 Ga0207640_10289394
197 Ga0207674_10389144
198 Ga0265326_10061920
199 Ga0265334_10052448
200 Ga0265318_10053891
201 Ga0265323_10023206
202 Ga0265338_10112649
203 Ga0265328_10086979
204 Ga0265320_10023845
205 Ga0265325_10137357
206 Ga0265316_10157196
207 Ga0265316_10193247
208 Ga0265313_10124207
209 Ga0316575_10046268
210 Ga0316575_10094788
211 Ga0316577_10092740
212 Ga0316577_10189801
213 Ga0316577_10247884
214 Ga0316583_10002885
215 Ga0316574_0122721
216 Ga0316574_0558197
217 Ga0373933_0609141
218 Ga0316582_0071907
219 Ga0316582_0436973
220 Ga0316584_0196842
221 Ga0395900_0005686
222 Ga0395900_0040583
223 Ga0395898_0024587
224 Ga0436364_0154272
225 Ga0237819_03189
226 Ga0400484_11675
227 Ga0400484_16228
228 Ga0400490_51969
229 Ga0400485_05963
230 Ga0400485_06371
231 Ga0400485_13606
232 Ga0400488_62599
233 Ga0400486_02699
234 Ga0400486_07851
235 Ga0400483_020588
236 Ga0400483_045759
237 Ga0400483_053567
238 Ga0400483_209525
239 Ga0400483_288022
240 Ga0400489_43383
241 Ga0400489_65044
242 Ga0400489_92858
243 Ga0400487_42363
244 Ga0436365_0645207
245 Ga0436365_1085262
246 Ga0436365_1855865
247 Ga0436365_1857975
248 Ga0436360_0631666
249 Ga0436360_0810211
250 Ga0436362_0789444
251 Ga0436362_0820081
252 Ga0451841_1386344
253 Ga0451853_2932710
254 Ga0451577_0128341
255 Ga0466972_0039933
256 Ga0453683_0062983
257 Ga0453683_0346723
258 Ga0466966_0007122
259 Ga0466966_0020532
260 Ga0466961_0045450
261 Ga0466964_0005872
262 Ga0453684_0015564
263 Ga0453684_0106972
264 Ga0453684_0407731
265 Ga0453684_0462811
266 Ga0453684_0497874
267 Ga0453684_0560975
268 Ga0453684_1494155
269 Ga0466968_0000839
270 Ga0466970_0006282
271 Ga0466970_0073651
272 Ga0466970_0434007
273 Ga0466957_0077802
274 Ga0466959_0006376
275 Ga0466959_0099238
276 Ga0451576_0000853
277 Ga0451576_0023756
278 Ga0495622_0011038
279 Ga0495599_0237164
280 Ga0495649_0091697
281 Ga0495674_0304804
282 Ga0501031_0129468
283 Ga0501032_0188688
284 Ga0501033_0009457
285 Ga0501036_0041140
286 Ga0501037_0139115
287 Ga0501038_0348679
288 Ga0501039_0089174
289 Ga0501039_0328102
290 Ga0501040_0010536
291 Ga0501041_0020840
292 Ga0501042_0012811
293 Ga0501043_0353126
294 Ga0501068_0253063
295 Ga0501071_0163943
296 Ga0501071_0166325
297 Ga0501072_0320371
298 Ga0501075_0000059
299 Ga0501075_0017220
300 Ga0501075_0065699
301 Ga0501076_0025769
302 Ga0501076_0060756
303 Ga0501077_0018491
304 Ga0501077_0183221
305 Ga0501077_0650488
306 Ga0501080_0051100
307 Ga0501081_0002853
308 Ga0501081_0029784
309 Ga0501035_0100150
310 Ga0501045_0039145
311 nmdc:mga05p37_192116_c1
312 nmdc:mga05p37_483810_c1
313 nmdc:mga05p37_572069_c1
314 nmdc:mga05p37_852708_c1
315 nmdc:mga09592_15008_c1
316 nmdc:mga09592_77983_c1
317 nmdc:mga06r32_222832_c1
318 nmdc:mga06r32_34677_c1
319 nmdc:mga0n895_703300_c1
320 Ga0495601_0055384
321 Ga0495601_0119728
322 Ga0501084_0080900
323 Ga0501084_0300241
324 Ga0501082_0031008
325 Ga0501082_0037491
326 Ga0501082_0138880
327 Ga0466962_0020438
328 Ga0530510_0000001
329 Ga0530510_0053352
330 2831428752
331 2848702187
332 2849667948

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

28

218

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.9411 4 193
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.9401 1 194
3s86-assembly1.cif.gz_D crystal structure of tm0159 with bound imp 0.9339 1 197
4bnq-assembly1.cif.gz_B the structure of the staphylococcus aureus ham1 protein 0.9332 2 194
3s86-assembly1.cif.gz_D crystal structure of tm0159 with bound imp 0.9292 1 197
ID Description Score Start End Superfamily
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.952 1 194 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9379 1 199 3.90.950.10
3s86D00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9339 1 197 3.90.950.10
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9334 1 194 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9333 1 199 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A402ANI3-F1-model_v4 Non-canonical purine NTP pyrophosphatase 0.9942 1 146 GO:0005829
GO:0009143
GO:0047429
AF-A0A5N9CLL5-F1-model_v4 RdgB/HAM1 family non-canonical purine NTP pyrophosphatase 0.986 26 195 GO:0000166
GO:0005829
GO:0009117
GO:0009143
GO:0017111
GO:0046872
GO:0047429
AF-A0A536IJM3-F1-model_v4 RdgB/HAM1 family non-canonical purine NTP pyrophosphatase 0.9824 34 194 GO:0000166
GO:0005829
GO:0009117
GO:0009143
GO:0017111
GO:0046872
GO:0047429
AF-H5SL56-F1-model_v4 Nucleoside-triphosphatase 0.9815 2 196 GO:0000166
GO:0009117
GO:0009143
GO:0017111
GO:0046872
GO:0047429
AF-A0A5N9CLL5-F1-model_v4 RdgB/HAM1 family non-canonical purine NTP pyrophosphatase 0.9803 26 195 GO:0000166
GO:0005829
GO:0009117
GO:0009143
GO:0017111
GO:0046872
GO:0047429

Map