F248799
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 166 | 108 | 332 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0174444|Ga0373937_0174444_846_1550 |
| Length | 234 |
| Sequence | MRLPLSGRLPAVVTMPPDAANPSAPRRLLIATTNPHKIQELREILVGLPFALVSPGDLGLSLAVEETGTTFAENAVLKATAWADASGMLALADDSGLEIDALGGEPGIYSARWAGADVSYEERFRLLLARLADAPAERRTARYRAAIAVAEPAPSGLYGVVEGTLEGQIAFAPAGSGGFGYDPIFYVPEQRRTVGQMSAEEKHRISHRARAATAARMLLQQLATKQDTSDVGQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 2 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 9 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 10 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 11 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 12 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 13 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 14 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 15 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 16 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 17 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 18 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 19 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 20 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 21 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 27 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 28 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 29 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 30 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 31 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 32 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 33 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 34 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 35 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 36 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 37 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 38 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 39 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 40 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 41 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 42 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 43 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 44 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 45 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 46 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 47 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 48 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 49 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 50 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 51 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 52 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 53 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 54 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 55 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 56 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 57 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 58 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 59 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 60 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 61 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 62 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 63 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 64 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 65 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 66 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 67 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 68 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 69 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 70 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 71 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 72 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 77 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 78 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 79 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 80 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 81 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 82 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 83 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 84 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 85 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 86 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 87 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 88 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 89 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 90 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 91 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 92 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 93 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 94 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 95 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 96 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 97 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 98 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 99 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 100 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 101 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 103 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 104 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 105 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 106 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 107 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 108 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.39 |
| Metatranscriptomes | 1.81 |
| Isolates | 1.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 79.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373937_0174444 | 3300036401 | Bacteria | 2018 |
| 2 | Ga0058860_10901835 | 3300004801 | Unclassified | 1188 |
| 3 | Ga0065707_10419084 | 3300005295 | Bacteria | 811 |
| 4 | Ga0070683_100031081 | 3300005329 | Bacteria | 4852 |
| 5 | Ga0070660_100703399 | 3300005339 | Bacteria | 847 |
| 6 | Ga0070706_100152163 | 3300005467 | Bacteria | 2160 |
| 7 | Ga0070684_100146138 | 3300005535 | Bacteria | 2140 |
| 8 | Ga0068855_100600437 | 3300005563 | Bacteria | 1187 |
| 9 | Ga0068857_100366978 | 3300005577 | Bacteria | 1335 |
| 10 | Ga0068854_100427718 | 3300005578 | Bacteria | 1101 |
| 11 | Ga0075431_100069633 | 3300006847 | Bacteria | 3630 |
| 12 | Ga0075431_100517592 | 3300006847 | Bacteria | 1183 |
| 13 | Ga0075429_100025741 | 3300006880 | Bacteria | 5109 |
| 14 | Ga0105250_10000030 | 3300009092 | Bacteria | 177339 |
| 15 | Ga0111539_10536984 | 3300009094 | Bacteria | 1362 |
| 16 | Ga0114129_10108032 | 3300009147 | Bacteria | 3842 |
| 17 | Ga0114129_10128116 | 3300009147 | Bacteria | 3488 |
| 18 | Ga0114129_10323510 | 3300009147 | Bacteria | 2050 |
| 19 | Ga0114129_10689220 | 3300009147 | Bacteria | 1314 |
| 20 | Ga0157379_10000378 | 3300014968 | Bacteria | 35917 |
| 21 | Ga0206350_10643555 | 3300020080 | Bacteria | 1244 |
| 22 | Ga0213876_10013687 | 3300021384 | Bacteria | 4301 |
| 23 | Ga0213876_10044277 | 3300021384 | Unclassified | 2352 |
| 24 | Ga0213876_10162572 | 3300021384 | Bacteria | 1188 |
| 25 | Ga0213875_10031882 | 3300021388 | Unclassified | 2492 |
| 26 | Ga0224712_10232862 | 3300022467 | Bacteria | 846 |
| 27 | Ga0207696_1000224 | 3300025711 | Bacteria | 81312 |
| 28 | Ga0207684_10418236 | 3300025910 | Bacteria | 1152 |
| 29 | Ga0207661_10179710 | 3300025944 | Bacteria | 1847 |
| 30 | Ga0207640_10289394 | 3300025981 | Bacteria | 1291 |
| 31 | Ga0207674_10389144 | 3300026116 | Bacteria | 1348 |
| 32 | Ga0265326_10061920 | 3300028558 | Unclassified | 1058 |
| 33 | Ga0265334_10052448 | 3300028573 | Bacteria | 1561 |
| 34 | Ga0265318_10053891 | 3300028577 | Bacteria | 1507 |
| 35 | Ga0265323_10023206 | 3300028653 | Bacteria | 2367 |
| 36 | Ga0265338_10112649 | 3300028800 | Bacteria | 2187 |
| 37 | Ga0265328_10086979 | 3300031239 | Bacteria | 1154 |
| 38 | Ga0265320_10023845 | 3300031240 | Unclassified | 3248 |
| 39 | Ga0265325_10137357 | 3300031241 | Bacteria | 1165 |
| 40 | Ga0265316_10157196 | 3300031344 | Bacteria | 1701 |
| 41 | Ga0265316_10193247 | 3300031344 | Bacteria | 1511 |
| 42 | Ga0265313_10124207 | 3300031595 | Bacteria | 1123 |
| 43 | Ga0316575_10046268 | 3300031665 | Bacteria | 1728 |
| 44 | Ga0316575_10094788 | 3300031665 | Bacteria | 1211 |
| 45 | Ga0316577_10092740 | 3300031733 | Bacteria | 1691 |
| 46 | Ga0316577_10189801 | 3300031733 | Bacteria | 1161 |
| 47 | Ga0316577_10247884 | 3300031733 | Bacteria | 1008 |
| 48 | Ga0316583_10002885 | 3300032133 | Bacteria | 6036 |
| 49 | Ga0316574_0122721 | 3300035398 | Bacteria | 1669 |
| 50 | Ga0316574_0558197 | 3300035398 | Bacteria | 710 |
| 51 | Ga0373933_0609141 | 3300035724 | Bacteria | 717 |
| 52 | Ga0316582_0071907 | 3300036647 | Unclassified | 2241 |
| 53 | Ga0316582_0436973 | 3300036647 | Bacteria | 902 |
| 54 | Ga0316584_0196842 | 3300036712 | Bacteria | 1488 |
| 55 | Ga0395900_0005686 | 3300037418 | Bacteria | 13035 |
| 56 | Ga0395900_0040583 | 3300037418 | Bacteria | 4796 |
| 57 | Ga0395898_0024587 | 3300037466 | Bacteria | 6075 |
| 58 | Ga0436364_0154272 | 3300037853 | Unclassified | 2060 |
| 59 | Ga0237819_03189 | 3300038705 | Bacteria | 2978 |
| 60 | Ga0400484_11675 | 3300038725 | Bacteria | 1070 |
| 61 | Ga0400484_16228 | 3300038725 | Bacteria | 13154 |
| 62 | Ga0400490_51969 | 3300038726 | Bacteria | 2761 |
| 63 | Ga0400485_05963 | 3300038735 | Bacteria | 1363 |
| 64 | Ga0400485_06371 | 3300038735 | Bacteria | 2098 |
| 65 | Ga0400485_13606 | 3300038735 | Bacteria | 1508 |
| 66 | Ga0400488_62599 | 3300038741 | Bacteria | 1050 |
| 67 | Ga0400486_02699 | 3300038742 | Bacteria | 2079 |
| 68 | Ga0400486_07851 | 3300038742 | Bacteria | 8775 |
| 69 | Ga0400483_020588 | 3300039062 | Bacteria | 6200 |
| 70 | Ga0400483_045759 | 3300039062 | Bacteria | 1669 |
| 71 | Ga0400483_053567 | 3300039062 | Unclassified | 1858 |
| 72 | Ga0400483_209525 | 3300039062 | Bacteria | 7710 |
| 73 | Ga0400483_288022 | 3300039062 | Bacteria | 1860 |
| 74 | Ga0400489_43383 | 3300039093 | Bacteria | 22865 |
| 75 | Ga0400489_65044 | 3300039093 | Bacteria | 1550 |
| 76 | Ga0400489_92858 | 3300039093 | Bacteria | 8978 |
| 77 | Ga0400487_42363 | 3300039110 | Bacteria | 2154 |
| 78 | Ga0436365_0645207 | 3300039437 | Bacteria | 2948 |
| 79 | Ga0436365_1085262 | 3300039437 | Bacteria | 31252 |
| 80 | Ga0436365_1855865 | 3300039437 | Bacteria | 1081 |
| 81 | Ga0436365_1857975 | 3300039437 | Bacteria | 6886 |
| 82 | Ga0436360_0631666 | 3300039438 | Bacteria | 1006 |
| 83 | Ga0436360_0810211 | 3300039438 | Bacteria | 1047 |
| 84 | Ga0436362_0789444 | 3300039453 | Unclassified | 1366 |
| 85 | Ga0436362_0820081 | 3300039453 | Bacteria | 1271 |
| 86 | Ga0451841_1386344 | 3300041498 | Bacteria | 8822 |
| 87 | Ga0451853_2932710 | 3300041512 | Bacteria | 2397 |
| 88 | Ga0451577_0128341 | 3300042876 | Bacteria | 2273 |
| 89 | Ga0466972_0039933 | 3300044658 | Unclassified | 2289 |
| 90 | Ga0453683_0062983 | 3300044673 | Bacteria | 2319 |
| 91 | Ga0453683_0346723 | 3300044673 | Unclassified | 954 |
| 92 | Ga0466966_0007122 | 3300044684 | Bacteria | 7412 |
| 93 | Ga0466966_0020532 | 3300044684 | Bacteria | 4341 |
| 94 | Ga0466961_0045450 | 3300044693 | Bacteria | 2809 |
| 95 | Ga0466964_0005872 | 3300044706 | Unclassified | 4568 |
| 96 | Ga0453684_0015564 | 3300044712 | Bacteria | 12007 |
| 97 | Ga0453684_0106972 | 3300044712 | Bacteria | 3407 |
| 98 | Ga0453684_0407731 | 3300044712 | Bacteria | 1521 |
| 99 | Ga0453684_0462811 | 3300044712 | Unclassified | 1410 |
| 100 | Ga0453684_0497874 | 3300044712 | Unclassified | 1350 |
| 101 | Ga0453684_0560975 | 3300044712 | Bacteria | 1257 |
| 102 | Ga0453684_1494155 | 3300044712 | Bacteria | 697 |
| 103 | Ga0466968_0000839 | 3300044735 | Bacteria | 10734 |
| 104 | Ga0466970_0006282 | 3300044765 | Bacteria | 5934 |
| 105 | Ga0466970_0073651 | 3300044765 | Unclassified | 1838 |
| 106 | Ga0466970_0434007 | 3300044765 | Bacteria | 752 |
| 107 | Ga0466957_0077802 | 3300044842 | Unclassified | 2061 |
| 108 | Ga0466959_0006376 | 3300045049 | Bacteria | 8168 |
| 109 | Ga0466959_0099238 | 3300045049 | Unclassified | 2085 |
| 110 | Ga0451576_0000853 | 3300045051 | Bacteria | 59154 |
| 111 | Ga0451576_0023756 | 3300045051 | Bacteria | 6633 |
| 112 | Ga0495622_0011038 | 3300046557 | Bacteria | 4169 |
| 113 | Ga0495599_0237164 | 3300046678 | Bacteria | 1113 |
| 114 | Ga0495649_0091697 | 3300046694 | Bacteria | 1619 |
| 115 | Ga0495674_0304804 | 3300047319 | Bacteria | 1300 |
| 116 | Ga0501031_0129468 | 3300049568 | Bacteria | 1649 |
| 117 | Ga0501032_0188688 | 3300049569 | Bacteria | 1348 |
| 118 | Ga0501033_0009457 | 3300049570 | Bacteria | 7505 |
| 119 | Ga0501036_0041140 | 3300049572 | Bacteria | 3911 |
| 120 | Ga0501037_0139115 | 3300049573 | Bacteria | 1738 |
| 121 | Ga0501038_0348679 | 3300049574 | Bacteria | 1153 |
| 122 | Ga0501039_0089174 | 3300049575 | Bacteria | 2403 |
| 123 | Ga0501039_0328102 | 3300049575 | Bacteria | 1203 |
| 124 | Ga0501040_0010536 | 3300049576 | Bacteria | 6047 |
| 125 | Ga0501041_0020840 | 3300049577 | Bacteria | 3923 |
| 126 | Ga0501042_0012811 | 3300049578 | Bacteria | 5693 |
| 127 | Ga0501043_0353126 | 3300049579 | Bacteria | 1117 |
| 128 | Ga0501068_0253063 | 3300049584 | Bacteria | 1123 |
| 129 | Ga0501071_0163943 | 3300049587 | Bacteria | 1662 |
| 130 | Ga0501071_0166325 | 3300049587 | Bacteria | 1650 |
| 131 | Ga0501072_0320371 | 3300049588 | Bacteria | 1232 |
| 132 | Ga0501075_0000059 | 3300049591 | Bacteria | 46955 |
| 133 | Ga0501075_0017220 | 3300049591 | Bacteria | 5218 |
| 134 | Ga0501075_0065699 | 3300049591 | Bacteria | 2737 |
| 135 | Ga0501076_0025769 | 3300049592 | Bacteria | 4552 |
| 136 | Ga0501076_0060756 | 3300049592 | Bacteria | 3007 |
| 137 | Ga0501077_0018491 | 3300049593 | Bacteria | 4408 |
| 138 | Ga0501077_0183221 | 3300049593 | Bacteria | 1331 |
| 139 | Ga0501077_0650488 | 3300049593 | Bacteria | 677 |
| 140 | Ga0501080_0051100 | 3300049742 | Bacteria | 3846 |
| 141 | Ga0501081_0002853 | 3300049743 | Bacteria | 10969 |
| 142 | Ga0501081_0029784 | 3300049743 | Bacteria | 3691 |
| 143 | Ga0501035_0100150 | 3300049822 | Bacteria | 2544 |
| 144 | Ga0501045_0039145 | 3300049824 | Bacteria | 3450 |
| 145 | nmdc:mga05p37_192116_c1 | 3300050507 | Bacteria | 2478 |
| 146 | nmdc:mga05p37_483810_c1 | 3300050507 | Unclassified | 1425 |
| 147 | nmdc:mga05p37_572069_c1 | 3300050507 | Bacteria | 1282 |
| 148 | nmdc:mga05p37_852708_c1 | 3300050507 | Bacteria | 989 |
| 149 | nmdc:mga09592_15008_c1 | 3300050508 | Bacteria | 6328 |
| 150 | nmdc:mga09592_77983_c1 | 3300050508 | Bacteria | 2819 |
| 151 | nmdc:mga06r32_222832_c1 | 3300050510 | Bacteria | 1874 |
| 152 | nmdc:mga06r32_34677_c1 | 3300050510 | Bacteria | 4760 |
| 153 | nmdc:mga0n895_703300_c1 | 3300050512 | Bacteria | 1006 |
| 154 | Ga0495601_0055384 | 3300053077 | Bacteria | 2511 |
| 155 | Ga0495601_0119728 | 3300053077 | Bacteria | 1709 |
| 156 | Ga0501084_0080900 | 3300054114 | Bacteria | 2724 |
| 157 | Ga0501084_0300241 | 3300054114 | Bacteria | 1356 |
| 158 | Ga0501082_0031008 | 3300060353 | Bacteria | 4608 |
| 159 | Ga0501082_0037491 | 3300060353 | Bacteria | 4179 |
| 160 | Ga0501082_0138880 | 3300060353 | Bacteria | 2109 |
| 161 | Ga0466962_0020438 | 3300061719 | Unclassified | 3181 |
| 162 | Ga0530510_0000001 | 3300061734 | Bacteria | 285623 |
| 163 | Ga0530510_0053352 | 3300061734 | Bacteria | 2922 |
| 164 | 2831428752 | 2831426010 | Bacteria | 8662725 |
| 165 | 2848702187 | 2848694841 | Bacteria | 9205737 |
| 166 | 2849667948 | 2849660919 | Bacteria | 8251853 |
| 167 | Ga0373937_0174444 | |||
| 168 | Ga0058860_10901835 | |||
| 169 | Ga0065707_10419084 | |||
| 170 | Ga0070683_100031081 | |||
| 171 | Ga0070660_100703399 | |||
| 172 | Ga0070706_100152163 | |||
| 173 | Ga0070684_100146138 | |||
| 174 | Ga0068855_100600437 | |||
| 175 | Ga0068857_100366978 | |||
| 176 | Ga0068854_100427718 | |||
| 177 | Ga0075431_100069633 | |||
| 178 | Ga0075431_100517592 | |||
| 179 | Ga0075429_100025741 | |||
| 180 | Ga0105250_10000030 | |||
| 181 | Ga0111539_10536984 | |||
| 182 | Ga0114129_10108032 | |||
| 183 | Ga0114129_10128116 | |||
| 184 | Ga0114129_10323510 | |||
| 185 | Ga0114129_10689220 | |||
| 186 | Ga0157379_10000378 | |||
| 187 | Ga0206350_10643555 | |||
| 188 | Ga0213876_10013687 | |||
| 189 | Ga0213876_10044277 | |||
| 190 | Ga0213876_10162572 | |||
| 191 | Ga0213875_10031882 | |||
| 192 | Ga0224712_10232862 | |||
| 193 | Ga0207696_1000224 | |||
| 194 | Ga0207684_10418236 | |||
| 195 | Ga0207661_10179710 | |||
| 196 | Ga0207640_10289394 | |||
| 197 | Ga0207674_10389144 | |||
| 198 | Ga0265326_10061920 | |||
| 199 | Ga0265334_10052448 | |||
| 200 | Ga0265318_10053891 | |||
| 201 | Ga0265323_10023206 | |||
| 202 | Ga0265338_10112649 | |||
| 203 | Ga0265328_10086979 | |||
| 204 | Ga0265320_10023845 | |||
| 205 | Ga0265325_10137357 | |||
| 206 | Ga0265316_10157196 | |||
| 207 | Ga0265316_10193247 | |||
| 208 | Ga0265313_10124207 | |||
| 209 | Ga0316575_10046268 | |||
| 210 | Ga0316575_10094788 | |||
| 211 | Ga0316577_10092740 | |||
| 212 | Ga0316577_10189801 | |||
| 213 | Ga0316577_10247884 | |||
| 214 | Ga0316583_10002885 | |||
| 215 | Ga0316574_0122721 | |||
| 216 | Ga0316574_0558197 | |||
| 217 | Ga0373933_0609141 | |||
| 218 | Ga0316582_0071907 | |||
| 219 | Ga0316582_0436973 | |||
| 220 | Ga0316584_0196842 | |||
| 221 | Ga0395900_0005686 | |||
| 222 | Ga0395900_0040583 | |||
| 223 | Ga0395898_0024587 | |||
| 224 | Ga0436364_0154272 | |||
| 225 | Ga0237819_03189 | |||
| 226 | Ga0400484_11675 | |||
| 227 | Ga0400484_16228 | |||
| 228 | Ga0400490_51969 | |||
| 229 | Ga0400485_05963 | |||
| 230 | Ga0400485_06371 | |||
| 231 | Ga0400485_13606 | |||
| 232 | Ga0400488_62599 | |||
| 233 | Ga0400486_02699 | |||
| 234 | Ga0400486_07851 | |||
| 235 | Ga0400483_020588 | |||
| 236 | Ga0400483_045759 | |||
| 237 | Ga0400483_053567 | |||
| 238 | Ga0400483_209525 | |||
| 239 | Ga0400483_288022 | |||
| 240 | Ga0400489_43383 | |||
| 241 | Ga0400489_65044 | |||
| 242 | Ga0400489_92858 | |||
| 243 | Ga0400487_42363 | |||
| 244 | Ga0436365_0645207 | |||
| 245 | Ga0436365_1085262 | |||
| 246 | Ga0436365_1855865 | |||
| 247 | Ga0436365_1857975 | |||
| 248 | Ga0436360_0631666 | |||
| 249 | Ga0436360_0810211 | |||
| 250 | Ga0436362_0789444 | |||
| 251 | Ga0436362_0820081 | |||
| 252 | Ga0451841_1386344 | |||
| 253 | Ga0451853_2932710 | |||
| 254 | Ga0451577_0128341 | |||
| 255 | Ga0466972_0039933 | |||
| 256 | Ga0453683_0062983 | |||
| 257 | Ga0453683_0346723 | |||
| 258 | Ga0466966_0007122 | |||
| 259 | Ga0466966_0020532 | |||
| 260 | Ga0466961_0045450 | |||
| 261 | Ga0466964_0005872 | |||
| 262 | Ga0453684_0015564 | |||
| 263 | Ga0453684_0106972 | |||
| 264 | Ga0453684_0407731 | |||
| 265 | Ga0453684_0462811 | |||
| 266 | Ga0453684_0497874 | |||
| 267 | Ga0453684_0560975 | |||
| 268 | Ga0453684_1494155 | |||
| 269 | Ga0466968_0000839 | |||
| 270 | Ga0466970_0006282 | |||
| 271 | Ga0466970_0073651 | |||
| 272 | Ga0466970_0434007 | |||
| 273 | Ga0466957_0077802 | |||
| 274 | Ga0466959_0006376 | |||
| 275 | Ga0466959_0099238 | |||
| 276 | Ga0451576_0000853 | |||
| 277 | Ga0451576_0023756 | |||
| 278 | Ga0495622_0011038 | |||
| 279 | Ga0495599_0237164 | |||
| 280 | Ga0495649_0091697 | |||
| 281 | Ga0495674_0304804 | |||
| 282 | Ga0501031_0129468 | |||
| 283 | Ga0501032_0188688 | |||
| 284 | Ga0501033_0009457 | |||
| 285 | Ga0501036_0041140 | |||
| 286 | Ga0501037_0139115 | |||
| 287 | Ga0501038_0348679 | |||
| 288 | Ga0501039_0089174 | |||
| 289 | Ga0501039_0328102 | |||
| 290 | Ga0501040_0010536 | |||
| 291 | Ga0501041_0020840 | |||
| 292 | Ga0501042_0012811 | |||
| 293 | Ga0501043_0353126 | |||
| 294 | Ga0501068_0253063 | |||
| 295 | Ga0501071_0163943 | |||
| 296 | Ga0501071_0166325 | |||
| 297 | Ga0501072_0320371 | |||
| 298 | Ga0501075_0000059 | |||
| 299 | Ga0501075_0017220 | |||
| 300 | Ga0501075_0065699 | |||
| 301 | Ga0501076_0025769 | |||
| 302 | Ga0501076_0060756 | |||
| 303 | Ga0501077_0018491 | |||
| 304 | Ga0501077_0183221 | |||
| 305 | Ga0501077_0650488 | |||
| 306 | Ga0501080_0051100 | |||
| 307 | Ga0501081_0002853 | |||
| 308 | Ga0501081_0029784 | |||
| 309 | Ga0501035_0100150 | |||
| 310 | Ga0501045_0039145 | |||
| 311 | nmdc:mga05p37_192116_c1 | |||
| 312 | nmdc:mga05p37_483810_c1 | |||
| 313 | nmdc:mga05p37_572069_c1 | |||
| 314 | nmdc:mga05p37_852708_c1 | |||
| 315 | nmdc:mga09592_15008_c1 | |||
| 316 | nmdc:mga09592_77983_c1 | |||
| 317 | nmdc:mga06r32_222832_c1 | |||
| 318 | nmdc:mga06r32_34677_c1 | |||
| 319 | nmdc:mga0n895_703300_c1 | |||
| 320 | Ga0495601_0055384 | |||
| 321 | Ga0495601_0119728 | |||
| 322 | Ga0501084_0080900 | |||
| 323 | Ga0501084_0300241 | |||
| 324 | Ga0501082_0031008 | |||
| 325 | Ga0501082_0037491 | |||
| 326 | Ga0501082_0138880 | |||
| 327 | Ga0466962_0020438 | |||
| 328 | Ga0530510_0000001 | |||
| 329 | Ga0530510_0053352 | |||
| 330 | 2831428752 | |||
| 331 | 2848702187 | |||
| 332 | 2849667948 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2q16-assembly1.cif.gz_B | structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp | 0.9411 | 4 | 193 |
| 3tqu-assembly2.cif.gz_D | structure of a ham1 protein from coxiella burnetii | 0.9401 | 1 | 194 |
| 3s86-assembly1.cif.gz_D | crystal structure of tm0159 with bound imp | 0.9339 | 1 | 197 |
| 4bnq-assembly1.cif.gz_B | the structure of the staphylococcus aureus ham1 protein | 0.9332 | 2 | 194 |
| 3s86-assembly1.cif.gz_D | crystal structure of tm0159 with bound imp | 0.9292 | 1 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P52061_1_197_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.952 | 1 | 194 | 3.90.950.10 |
| af_Q2FZC5_1_195_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9379 | 1 | 199 | 3.90.950.10 |
| 3s86D00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9339 | 1 | 197 | 3.90.950.10 |
| af_P52061_1_197_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9334 | 1 | 194 | 3.90.950.10 |
| af_Q2FZC5_1_195_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9333 | 1 | 199 | 3.90.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A402ANI3-F1-model_v4 | Non-canonical purine NTP pyrophosphatase | 0.9942 | 1 | 146 |
GO:0005829
GO:0009143 GO:0047429 |
| AF-A0A5N9CLL5-F1-model_v4 | RdgB/HAM1 family non-canonical purine NTP pyrophosphatase | 0.986 | 26 | 195 |
GO:0000166
GO:0005829 GO:0009117 GO:0009143 GO:0017111 GO:0046872 GO:0047429 |
| AF-A0A536IJM3-F1-model_v4 | RdgB/HAM1 family non-canonical purine NTP pyrophosphatase | 0.9824 | 34 | 194 |
GO:0000166
GO:0005829 GO:0009117 GO:0009143 GO:0017111 GO:0046872 GO:0047429 |
| AF-H5SL56-F1-model_v4 | Nucleoside-triphosphatase | 0.9815 | 2 | 196 |
GO:0000166
GO:0009117 GO:0009143 GO:0017111 GO:0046872 GO:0047429 |
| AF-A0A5N9CLL5-F1-model_v4 | RdgB/HAM1 family non-canonical purine NTP pyrophosphatase | 0.9803 | 26 | 195 |
GO:0000166
GO:0005829 GO:0009117 GO:0009143 GO:0017111 GO:0046872 GO:0047429 |