F241640

General Info

Members Datasets Scaffolds Average Seq Length
163 137 138 328

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10264371|Ga0157370_102643712
Length 363
Sequence MATFHGYDCMMLPPANAKAPITEGASASSAPVPATEPRVAAPLTLSIVVPCHNEEKVLPETARRLCATLGTLVTKGLIVTPRIIFIEDGSIVDTSLTIENLAAEEPRIHGLKLSRNFGQPNAILAGLLTAQGDILISIDADLQDDVNAVEEMVRAHSAGAEVVYGVRSDRSTDGFLKRTTAEAYYRLLKAMGVQLVFNHADFRLLSRRVVEHLRGCNESNLLLRGLIPQLGFRSAQVLYDRRLRLAGETKYPLRRMVGLGIDGITSFSAVPLRLIAATGAILFVLSSMVALWVIAIRVFTDRAVPGWASITLPIYALGGVQLLSLGVVGEYVAKIYLEVKRRPRYIIERTTRDRTVDQARNNS

Samples

Sample ID Description Type Environment
1 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
2 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
3 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
4 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
5 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
6 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
7 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
8 2858868258 Micromonospora sp. MH33 Isolate Unclassified
9 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
10 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
11 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
12 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
13 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
14 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
15 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
16 2902582711 Micromonospora sp. AP08 Isolate Unclassified
17 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
18 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
19 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
20 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
21 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
96 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
105 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
106 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
107 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
108 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
115 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
124 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
134 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
135 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
136 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
137 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.44
Metatranscriptomes 1.23
Isolates 15.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.84
Nodule 0.61
Rhizoplane 5.52
Rhizosphere 73.62
Stem 0
Stem Tuber 0
Unclassified 18.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10050501 3300003203 Bacteria 1396
2 rootH1_10004061 3300003323 Bacteria 5806
3 rootH1_10022811 3300003323 Bacteria 10396
4 rootH1_10025349 3300003323 Bacteria 30755
5 Ga0070658_10090990 3300005327 Bacteria 2514
6 Ga0070676_10009286 3300005328 Bacteria 5318
7 Ga0070683_100004461 3300005329 Bacteria 11548
8 Ga0070666_10123917 3300005335 Unclassified 1793
9 Ga0070680_100027029 3300005336 Unclassified 4594
10 Ga0070661_100003867 3300005344 Bacteria 10306
11 Ga0070668_100079149 3300005347 Bacteria 2573
12 Ga0070669_100060080 3300005353 Unclassified 2792
13 Ga0070671_100016618 3300005355 Bacteria 5948
14 Ga0070714_100511224 3300005435 Bacteria 1146
15 Ga0070710_10000213 3300005437 Bacteria 27098
16 Ga0070662_100034818 3300005457 Plasmid 3553
17 Ga0070681_10108311 3300005458 Unclassified 2719
18 Ga0070681_10218230 3300005458 Bacteria 1823
19 Ga0068867_100000458 3300005459 Bacteria 27054
20 Ga0068867_100267083 3300005459 Bacteria 1397
21 Ga0070684_100020022 3300005535 Bacteria 5546
22 Ga0068853_100029128 3300005539 Bacteria 4652
23 Ga0070693_100087083 3300005547 Unclassified 1875
24 Ga0070665_100169501 3300005548 Bacteria 2185
25 Ga0070702_100048243 3300005615 Unclassified 2423
26 Ga0068861_100022983 3300005719 Bacteria 4496
27 Ga0068851_10066660 3300005834 Bacteria 1855
28 Ga0068870_10011708 3300005840 Unclassified 4078
29 Ga0068863_100090212 3300005841 Bacteria 2906
30 Ga0068863_100169121 3300005841 Bacteria 2096
31 Ga0068862_100076237 3300005844 Bacteria 2902
32 Ga0068862_100325472 3300005844 Bacteria 1420
33 Ga0081539_10000667 3300005985 Bacteria 68763
34 Ga0081539_10001076 3300005985 Bacteria 49708
35 Ga0097621_100179147 3300006237 Bacteria 1830
36 Ga0075428_100235098 3300006844 Bacteria 1977
37 Ga0075430_100002642 3300006846 Bacteria 14965
38 Ga0075430_100007307 3300006846 Bacteria 9329
39 Ga0075431_100027250 3300006847 Bacteria 5862
40 Ga0075431_100199791 3300006847 Bacteria 2046
41 Ga0075434_100029945 3300006871 Bacteria 5359
42 Ga0075429_100004696 3300006880 Bacteria 11757
43 Ga0105245_10100137 3300009098 Bacteria 2680
44 Ga0105245_10301454 3300009098 Unclassified 1572
45 Ga0114129_10018805 3300009147 Bacteria 9839
46 Ga0114129_10344596 3300009147 Bacteria 1975
47 Ga0105243_10196342 3300009148 Bacteria 1767
48 Ga0105248_10001328 3300009177 Bacteria 27521
49 Ga0105249_10074799 3300009553 Unclassified 3136
50 Ga0157370_10264371 3300013104 Bacteria 1590
51 Ga0157369_10178822 3300013105 Bacteria 2233
52 Ga0157372_10211308 3300013307 Bacteria 2249
53 Ga0157372_10298359 3300013307 Bacteria 1874
54 Ga0157375_10018453 3300013308 Bacteria 6328
55 Ga0163161_10011488 3300017792 Bacteria 6145
56 Ga0209784_101109 3300025224 Bacteria 4439
57 Ga0207692_10000674 3300025898 Bacteria 12040
58 Ga0207657_10110824 3300025919 Bacteria 2267
59 Ga0207687_10260225 3300025927 Unclassified 1383
60 Ga0207711_10021078 3300025941 Bacteria 5443
61 Ga0207661_10307732 3300025944 Bacteria 1422
62 Ga0207667_10061552 3300025949 Bacteria 3926
63 Ga0207712_10160650 3300025961 Unclassified 1746
64 Ga0207668_10004794 3300025972 Bacteria 7961
65 Ga0207639_10227576 3300026041 Bacteria 1614
66 Ga0207678_10345295 3300026067 Unclassified 1283
67 Ga0207648_10000475 3300026089 Bacteria 44817
68 Ga0268266_10040966 3300028379 Unclassified 3949
69 Ga0268266_10073381 3300028379 Bacteria 2970
70 Ga0268265_10301897 3300028380 Bacteria 1442
71 Ga0307512_10003327 3300030522 Bacteria 18860
72 Ga0307512_10015714 3300030522 Bacteria 7005
73 Ga0265332_10083065 3300031238 Bacteria 1358
74 Ga0265320_10052202 3300031240 Bacteria 1981
75 Ga0265340_10006469 3300031247 Bacteria 6448
76 Ga0307513_10001102 3300031456 Bacteria 39071
77 Ga0307513_10007109 3300031456 Bacteria 14552
78 Ga0307408_100000169 3300031548 Bacteria 73417
79 Ga0307408_100000745 3300031548 Bacteria 26314
80 Ga0307508_10000877 3300031616 Bacteria 35003
81 Ga0307508_10015316 3300031616 Bacteria 6986
82 Ga0316579_10021819 3300031691 Bacteria 2857
83 Ga0316576_10115790 3300031727 Bacteria 2011
84 Ga0307516_10073252 3300031730 Bacteria 3282
85 Ga0307516_10123271 3300031730 Bacteria 2379
86 Ga0307406_10003570 3300031901 Bacteria 8481
87 Ga0307406_10040515 3300031901 Bacteria 2897
88 Ga0307407_10009691 3300031903 Bacteria 4500
89 Ga0307409_100033062 3300031995 Bacteria 3759
90 Ga0307411_10051041 3300032005 Bacteria 2697
91 Ga0307415_100023338 3300032126 Bacteria 3838
92 Ga0307415_100296115 3300032126 Bacteria 1338
93 Ga0316593_10010104 3300032168 Bacteria 2693
94 Ga0316592_1019528 3300033524 Bacteria 1434
95 Ga0373938_0026968 3300034957 Bacteria 1206
96 Ga0373940_0001420 3300035088 Bacteria 4324
97 Ga0373955_0112832 3300035172 Bacteria 1573
98 Ga0373942_0000058 3300035207 Bacteria 22888
99 Ga0395899_0002256 3300037312 Bacteria 15761
100 Ga0395899_0069780 3300037312 Bacteria 2573
101 Ga0395900_0007390 3300037418 Bacteria 11358
102 Ga0395898_0145826 3300037466 Bacteria 2265
103 Ga0395898_0269690 3300037466 Bacteria 1623
104 Ga0395905_0039744 3300037471 Bacteria 4414
105 Ga0395901_0113916 3300038443 Bacteria 2840
106 Ga0400488_12202 3300038741 Bacteria 4680
107 Ga0242420_012528 3300038996 Bacteria 1437
108 Ga0451797_0325692 3300041453 Bacteria 1361
109 Ga0451807_0102354 3300041486 Bacteria 1645
110 Ga0451843_0416821 3300041509 Bacteria 1262
111 Ga0451853_0207135 3300041512 Bacteria 1919
112 Ga0495638_0026702 3300046460 Bacteria 3741
113 Ga0495594_0108695 3300046499 Bacteria 1563
114 Ga0495611_0201272 3300046648 Bacteria 929
115 Ga0495660_0004093 3300046810 Bacteria 8900
116 Ga0495636_0029267 3300047318 Bacteria 2248
117 Ga0495614_0127464 3300048089 Bacteria 1125
118 Ga0496100_0071248 3300048903 Bacteria 2320
119 Ga0496101_0129343 3300048904 Bacteria 1916
120 Ga0496102_0323575 3300048905 Bacteria 1452
121 Ga0496106_0124981 3300048909 Bacteria 2013
122 Ga0496108_0152493 3300048911 Bacteria 1994
123 Ga0496113_0188830 3300048916 Bacteria 1635
124 Ga0496114_0153093 3300048917 Bacteria 2001
125 Ga0501290_006906 3300049513 Bacteria 1421
126 Ga0501259_013832 3300049688 Bacteria 1361
127 nmdc:mga05p37_174608_c1 3300050507 Bacteria 2619
128 nmdc:mga05p37_291008_c1 3300050507 Bacteria 1944
129 nmdc:mga05p37_544131_c1 3300050507 Bacteria 1323
130 nmdc:mga09592_7028_c1 3300050508 Bacteria 9149
131 nmdc:mga0qj67_12495_c1 3300050509 Bacteria 6397
132 nmdc:mga0qj67_599_c1 3300050509 Bacteria 24586
133 nmdc:mga06r32_55331_c1 3300050510 Bacteria 3806
134 nmdc:mga0n895_18221_c1 3300050512 Bacteria 6492
135 nmdc:mga0a205_131352_c1 3300050515 Bacteria 2404
136 Ga0495601_0248062 3300053077 Bacteria 1163
137 Ga0500616_0000097 3300053153 Bacteria 178988
138 Ga0500616_0000476 3300053153 Bacteria 51947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046648 Ga0495611_0201272 Ga0495611_0201272_25_909 285
2 iso_pu_bacteria 8003830390 8003832207 288
3 3300049688 Ga0501259_013832 Ga0501259_013832_27_929 293
4 3300031901 Ga0307406_10040515 Ga0307406_100405152 300
5 3300041509 Ga0451843_0416821 Ga0451843_0416821_19_921 300
6 3300031247 Ga0265340_10006469 Ga0265340_100064695 301
7 3300006871 Ga0075434_100029945 Ga0075434_1000299454 303
8 3300031727 Ga0316576_10115790 Ga0316576_101157901 303
9 3300032168 Ga0316593_10010104 Ga0316593_100101043 303
10 3300033524 Ga0316592_1019528 Ga0316592_10195282 303
11 3300048089 Ga0495614_0127464 Ga0495614_0127464_160_1113 303
12 3300050512 nmdc:mga0n895_18221_c1 nmdc:mga0n895_18221_c1_2453_3385 303
13 3300050515 nmdc:mga0a205_131352_c1 nmdc:mga0a205_131352_c1_1208_2140 303
14 3300053153 Ga0500616_0000476 Ga0500616_0000476_43655_44566 303
15 3300017792 Ga0163161_10011488 Ga0163161_100114885 304
16 iso_pu_bacteria 2772190715 2772646794 304
17 iso_pu_bacteria 2869048445 2869049778 304
18 iso_pu_bacteria 2880489317 2880494281 304
19 3300013105 Ga0157369_10178822 Ga0157369_101788222 307
20 3300013307 Ga0157372_10211308 Ga0157372_102113082 307
21 3300025949 Ga0207667_10061552 Ga0207667_100615522 307
22 3300031238 Ga0265332_10083065 Ga0265332_100830651 307
23 3300031240 Ga0265320_10052202 Ga0265320_100522022 307
24 3300005336 Ga0070680_100027029 Ga0070680_1000270293 308
25 3300005353 Ga0070669_100060080 Ga0070669_1000600803 308
26 3300005355 Ga0070671_100016618 Ga0070671_1000166184 308
27 3300005458 Ga0070681_10108311 Ga0070681_101083113 308
28 3300009148 Ga0105243_10196342 Ga0105243_101963421 308
29 3300026067 Ga0207678_10345295 Ga0207678_103452952 308
30 3300037466 Ga0395898_0269690 Ga0395898_0269690_421_1371 308
31 3300038741 Ga0400488_12202 Ga0400488_12202_3221_4228 308
32 3300053077 Ga0495601_0248062 Ga0495601_0248062_41_1000 308
33 3300005535 Ga0070684_100020022 Ga0070684_1000200222 309
34 3300037312 Ga0395899_0069780 Ga0395899_0069780_514_1467 309
35 3300037418 Ga0395900_0007390 Ga0395900_0007390_1175_2128 309
36 3300037466 Ga0395898_0145826 Ga0395898_0145826_861_1814 309
37 3300037471 Ga0395905_0039744 Ga0395905_0039744_822_1775 309
38 3300046499 Ga0495594_0108695 Ga0495594_0108695_421_1374 309
39 3300048911 Ga0496108_0152493 Ga0496108_0152493_10_969 309
40 3300053153 Ga0500616_0000097 Ga0500616_0000097_35351_36280 309
41 3300031548 Ga0307408_100000169 Ga0307408_10000016956 310
42 3300031901 Ga0307406_10003570 Ga0307406_100035707 310
43 3300037312 Ga0395899_0002256 Ga0395899_0002256_237_1178 310
44 3300005719 Ga0068861_100022983 Ga0068861_1000229832 311
45 3300006847 Ga0075431_100199791 Ga0075431_1001997912 311
46 3300009147 Ga0114129_10344596 Ga0114129_103445962 311
47 3300031995 Ga0307409_100033062 Ga0307409_1000330622 311
48 3300050507 nmdc:mga05p37_291008_c1 nmdc:mga05p37_291008_c1_429_1442 311
49 3300005547 Ga0070693_100087083 Ga0070693_1000870833 312
50 3300031548 Ga0307408_100000745 Ga0307408_1000007459 312
51 3300031730 Ga0307516_10073252 Ga0307516_100732522 312
52 3300049513 Ga0501290_006906 Ga0501290_006906_366_1337 312
53 iso_pu_bacteria 2996221748 2996223539 312
54 3300003323 rootH1_10022811 rootH1_100228117 313
55 3300003323 rootH1_10025349 rootH1_1002534919 313
56 3300025944 Ga0207661_10307732 Ga0207661_103077321 313
57 3300028379 Ga0268266_10073381 Ga0268266_100733812 313
58 3300041486 Ga0451807_0102354 Ga0451807_0102354_137_1207 313
59 3300046810 Ga0495660_0004093 Ga0495660_0004093_1026_1976 313
60 iso_pu_bacteria 2929206907 2929207591 313
61 3300005459 Ga0068867_100267083 Ga0068867_1002670831 314
62 3300005841 Ga0068863_100169121 Ga0068863_1001691213 314
63 3300013308 Ga0157375_10018453 Ga0157375_100184533 314
64 3300035172 Ga0373955_0112832 Ga0373955_0112832_524_1480 314
65 iso_pu_bacteria 2904755435 2904755618 314
66 iso_pu_bacteria 2919425241 2919425588 314
67 3300003323 rootH1_10004061 rootH1_100040613 315
68 3300005335 Ga0070666_10123917 Ga0070666_101239171 315
69 3300013104 Ga0157370_10264371 Ga0157370_102643712 315
70 3300028379 Ga0268266_10040966 Ga0268266_100409663 315
71 3300041512 Ga0451853_0207135 Ga0451853_0207135_632_1651 315
72 iso_pu_bacteria 2622736626 2623591049 315
73 iso_pu_bacteria 2858868258 2858869267 315
74 iso_pu_bacteria 2863067949 2863069681 315
75 iso_pu_bacteria 2866552031 2866553421 315
76 iso_pu_bacteria 2902582711 2902588228 315
77 iso_pu_bacteria 8056207758 8056215169 315
78 3300005844 Ga0068862_100325472 Ga0068862_1003254722 316
79 3300005985 Ga0081539_10000667 Ga0081539_1000066764 316
80 3300028380 Ga0268265_10301897 Ga0268265_103018972 316
81 3300050507 nmdc:mga05p37_544131_c1 nmdc:mga05p37_544131_c1_172_1143 316
82 3300005435 Ga0070714_100511224 Ga0070714_1005112241 317
83 3300025224 Ga0209784_101109 Ga0209784_1011093 317
84 3300046460 Ga0495638_0026702 Ga0495638_0026702_95_1171 317
85 iso_pu_bacteria 8023623736 8023629406 317
86 3300031456 Ga0307513_10001102 Ga0307513_1000110231 318
87 3300031691 Ga0316579_10021819 Ga0316579_100218192 318
88 3300041453 Ga0451797_0325692 Ga0451797_0325692_280_1248 318
89 iso_pu_bacteria 2675903059 2676482132 318
90 iso_pu_bacteria 2751185782 2753265704 318
91 iso_pu_bacteria 8003856774 8003860384 318
92 3300005437 Ga0070710_10000213 Ga0070710_1000021320 319
93 3300005841 Ga0068863_100090212 Ga0068863_1000902124 319
94 3300009098 Ga0105245_10100137 Ga0105245_101001372 319
95 3300013307 Ga0157372_10298359 Ga0157372_102983592 319
96 3300025898 Ga0207692_10000674 Ga0207692_100006745 319
97 3300030522 Ga0307512_10003327 Ga0307512_100033274 319
98 3300030522 Ga0307512_10015714 Ga0307512_100157143 319
99 3300031616 Ga0307508_10015316 Ga0307508_100153167 319
100 3300031730 Ga0307516_10123271 Ga0307516_101232711 319
101 3300038996 Ga0242420_012528 Ga0242420_012528_161_1150 319
102 3300048903 Ga0496100_0071248 Ga0496100_0071248_626_1615 319
103 3300048904 Ga0496101_0129343 Ga0496101_0129343_238_1227 319
104 3300048905 Ga0496102_0323575 Ga0496102_0323575_377_1366 319
105 3300048909 Ga0496106_0124981 Ga0496106_0124981_843_1832 319
106 3300048916 Ga0496113_0188830 Ga0496113_0188830_332_1321 319
107 3300048917 Ga0496114_0153093 Ga0496114_0153093_705_1694 319
108 3300005327 Ga0070658_10090990 Ga0070658_100909902 320
109 3300005329 Ga0070683_100004461 Ga0070683_1000044616 320
110 3300005344 Ga0070661_100003867 Ga0070661_1000038673 320
111 3300005539 Ga0068853_100029128 Ga0068853_1000291283 320
112 3300005834 Ga0068851_10066660 Ga0068851_100666602 320
113 3300025919 Ga0207657_10110824 Ga0207657_101108241 320
114 3300026041 Ga0207639_10227576 Ga0207639_102275762 320
115 3300031456 Ga0307513_10007109 Ga0307513_100071092 320
116 3300031903 Ga0307407_10009691 Ga0307407_100096914 320
117 3300032005 Ga0307411_10051041 Ga0307411_100510412 320
118 3300032126 Ga0307415_100023338 Ga0307415_1000233384 320
119 iso_pu_bacteria 2858895516 2858898761 320
120 iso_pu_bacteria 2880495981 2880498046 320
121 iso_pu_bacteria 8054704163 8054705560 320
122 3300005328 Ga0070676_10009286 Ga0070676_100092866 321
123 3300005457 Ga0070662_100034818 Ga0070662_1000348184 321
124 3300005459 Ga0068867_100000458 Ga0068867_10000045814 321
125 3300005615 Ga0070702_100048243 Ga0070702_1000482432 321
126 3300005840 Ga0068870_10011708 Ga0068870_100117082 321
127 3300009098 Ga0105245_10301454 Ga0105245_103014541 321
128 3300009177 Ga0105248_10001328 Ga0105248_1000132817 321
129 3300009553 Ga0105249_10074799 Ga0105249_100747993 321
130 3300025927 Ga0207687_10260225 Ga0207687_102602251 321
131 3300025941 Ga0207711_10021078 Ga0207711_100210782 321
132 3300025961 Ga0207712_10160650 Ga0207712_101606502 321
133 3300026089 Ga0207648_10000475 Ga0207648_1000047511 321
134 3300032126 Ga0307415_100296115 Ga0307415_1002961151 321
135 iso_pu_bacteria 2858848962 2858852466 321
136 iso_pu_bacteria 2858888857 2858895243 321
137 3300006237 Ga0097621_100179147 Ga0097621_1001791472 322
138 3300006844 Ga0075428_100235098 Ga0075428_1002350982 322
139 3300006846 Ga0075430_100002642 Ga0075430_1000026426 322
140 3300006847 Ga0075431_100027250 Ga0075431_1000272503 322
141 3300006880 Ga0075429_100004696 Ga0075429_1000046965 322
142 3300009147 Ga0114129_10018805 Ga0114129_100188056 322
143 3300050507 nmdc:mga05p37_174608_c1 nmdc:mga05p37_174608_c1_664_1659 322
144 3300050508 nmdc:mga09592_7028_c1 nmdc:mga09592_7028_c1_5423_6418 322
145 3300050509 nmdc:mga0qj67_12495_c1 nmdc:mga0qj67_12495_c1_5371_6366 322
146 3300050510 nmdc:mga06r32_55331_c1 nmdc:mga06r32_55331_c1_860_1855 322
147 iso_pu_bacteria 2784132148 2784589711 322
148 3300005548 Ga0070665_100169501 Ga0070665_1001695012 323
149 3300006846 Ga0075430_100007307 Ga0075430_1000073076 324
150 3300050509 nmdc:mga0qj67_599_c1 nmdc:mga0qj67_599_c1_6744_7850 324
151 iso_pu_bacteria 2808606359 2808843333 324
152 3300005347 Ga0070668_100079149 Ga0070668_1000791493 325
153 3300005458 Ga0070681_10218230 Ga0070681_102182302 325
154 3300005844 Ga0068862_100076237 Ga0068862_1000762373 325
155 3300025972 Ga0207668_10004794 Ga0207668_100047942 325
156 3300031616 Ga0307508_10000877 Ga0307508_1000087719 325
157 3300034957 Ga0373938_0026968 Ga0373938_0026968_134_1126 325
158 3300035088 Ga0373940_0001420 Ga0373940_0001420_2048_3040 325
159 3300035207 Ga0373942_0000058 Ga0373942_0000058_2293_3285 325
160 3300047318 Ga0495636_0029267 Ga0495636_0029267_839_1912 325
161 3300038443 Ga0395901_0113916 Ga0395901_0113916_227_1378 326
162 3300003203 JGI25406J46586_10050501 JGI25406J46586_100505011 327
163 3300005985 Ga0081539_10001076 Ga0081539_1000107626 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

46

214

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m4k-assembly1.cif.gz_A crystal structure of the drosphila beta,14galactosyltransferase 7 mutant d211n complex with manganese, udp-gal and xylobiose 0.7923 10 102
6db1-assembly1.cif.gz_A 2.0 angstrom resolution crystal structure of n-terminal ligand-binding domain of putative methyl-accepting chemotaxis protein from salmonella enterica 0.7667 232 288
6e4r-assembly1.cif.gz_A crystal structure of the drosophila melanogaster polypeptide n-acetylgalactosaminyl transferase pgant9b 0.7538 2 129
2d7i-assembly1.cif.gz_A crystal structure of pp-galnac-t10 with udp, galnac and mn2+ 0.7382 10 129
2y4l-assembly2.cif.gz_B mannosylglycerate synthase in complex with manganese and gdp 0.7317 12 229
ID Description Score Start End Superfamily
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9283 10 196 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9141 10 196 3.90.550.10
af_P9WMX5_1_216_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8716 10 225 3.90.550.10
af_Q2G2T7_1_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8598 10 212 3.90.550.10
af_P9WMX5_1_216_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8568 10 225 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7C5FNM4-F1-model_v4 Glycosyltransferase 0.9804 10 116 GO:0005886
GO:0016757
AF-A0A2G2I022-F1-model_v4 Dolichol-phosphate mannosyltransferase 0.9745 6 116 GO:0005886
GO:0099621
AF-A0A4V1ZS11-F1-model_v4 Glycosyltransferase family 2 protein 0.9689 7 110 GO:0005886
GO:0099621
AF-A0A7C4KIH1-F1-model_v4 Glycosyltransferase 0.9547 8 120 GO:0005886
GO:0016757
AF-A0A1X7MIX0-F1-model_v4 deleted 0.9545 6 110

Feature Viewer

pLDDT pTM Quality
80.49 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map