F237169

General Info

Members Datasets Scaffolds Average Seq Length
161 129 148 184

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10175782|Ga0207665_101757822
Length 206
Sequence MSAEKPTDDKPALPVSVAVEKIDSLSASDLADLCEATEAAVEEGGGFGWVKRPQRETLEKYWRGFLLVPGRALFVARLDGVIAGSAQLIRPPRNNEAQAFSAQLTSTFVAPWARGHGLARGLLAAVEHSARRAGVAILNLDVRDTQQAAIRLYESAGYTRWGTHPAYARVAGKIVPGHFYFKRLTPEEPGGGSDAGPELDPGRDRA

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
3 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
4 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
5 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
6 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
7 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
8 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
9 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
10 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
11 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
12 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
65 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
78 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
79 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
80 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
88 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
92 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
105 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
123 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
126 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
129 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.3
Metatranscriptomes 0.62
Isolates 8.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.07
Nodule 0.62
Rhizoplane 3.73
Rhizosphere 80.12
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000240 3300003187 Bacteria 64258
2 Ga0070680_100003831 3300005336 Bacteria 11249
3 Ga0070680_100117109 3300005336 Bacteria 2221
4 Ga0070659_100132388 3300005366 Bacteria 2026
5 Ga0070708_100571348 3300005445 Bacteria 1066
6 Ga0070681_10000290 3300005458 Bacteria 40569
7 Ga0070681_10236528 3300005458 Bacteria 1740
8 Ga0070679_100006551 3300005530 Bacteria 10853
9 Ga0070679_100106712 3300005530 Bacteria 2786
10 Ga0070679_100717240 3300005530 Bacteria 943
11 Ga0068853_100051936 3300005539 Bacteria 3530
12 Ga0070686_100548721 3300005544 Bacteria 904
13 Ga0070695_100131053 3300005545 Bacteria 1728
14 Ga0070696_100208175 3300005546 Bacteria 1463
15 Ga0070696_100436410 3300005546 Bacteria 1031
16 Ga0068854_100360857 3300005578 Bacteria 1192
17 Ga0068859_100431424 3300005617 Bacteria 1414
18 Ga0068864_100749217 3300005618 Bacteria 957
19 Ga0081540_1045900 3300005983 Bacteria 2212
20 Ga0070712_100433140 3300006175 Bacteria 1092
21 Ga0075430_100171927 3300006846 Bacteria 1803
22 Ga0075433_10225900 3300006852 Bacteria 1663
23 Ga0075434_100396206 3300006871 Bacteria 1402
24 Ga0097620_100431434 3300006931 Bacteria 1414
25 Ga0105240_10033685 3300009093 Bacteria 6615
26 Ga0114129_10341683 3300009147 Bacteria 1985
27 Ga0105241_10567545 3300009174 Bacteria 1021
28 Ga0105249_10481787 3300009553 Bacteria 1284
29 Ga0157370_10002708 3300013104 Bacteria 21192
30 Ga0157370_10101790 3300013104 Bacteria 2690
31 Ga0182008_10293115 3300014497 Bacteria 849
32 Ga0182008_10306927 3300014497 Bacteria 832
33 Ga0206356_10337032 3300020070 Bacteria 1020
34 Ga0209130_1000282 3300025284 Bacteria 62561
35 Ga0209675_1004204 3300025291 Bacteria 6504
36 Ga0209675_1032325 3300025291 Bacteria 1226
37 Ga0209025_1000179 3300025294 Bacteria 157965
38 Ga0209564_1037326 3300025295 Bacteria 1371
39 Ga0209758_1002547 3300025297 Bacteria 18378
40 Ga0207426_1000191 3300025302 Bacteria 151850
41 Ga0207707_10005011 3300025912 Bacteria 11631
42 Ga0207707_10121246 3300025912 Bacteria 2286
43 Ga0207707_10850054 3300025912 Bacteria 757
44 Ga0207695_10234964 3300025913 Bacteria 1736
45 Ga0207693_10107031 3300025915 Bacteria 2193
46 Ga0207660_10086158 3300025917 Bacteria 2319
47 Ga0207652_10198360 3300025921 Bacteria 1806
48 Ga0207652_10380928 3300025921 Bacteria 1273
49 Ga0207665_10175782 3300025939 Bacteria 1548
50 Ga0207661_10149981 3300025944 Bacteria 2015
51 Ga0207703_10555424 3300026035 Bacteria 1083
52 Ga0207639_10033961 3300026041 Bacteria 3767
53 Ga0307515_10131748 3300028794 Bacteria 2748
54 Ga0265316_10018469 3300031344 Bacteria 5991
55 Ga0307408_100848004 3300031548 Bacteria 833
56 Ga0265313_10047233 3300031595 Bacteria 2085
57 Ga0307405_10676670 3300031731 Bacteria 852
58 Ga0307406_10062805 3300031901 Bacteria 2404
59 Ga0307407_10043185 3300031903 Bacteria 2533
60 Ga0307409_101353056 3300031995 Bacteria 738
61 Ga0307416_100114817 3300032002 Bacteria 2383
62 Ga0307414_10096207 3300032004 Bacteria 2215
63 Ga0307414_10561935 3300032004 Bacteria 1018
64 Ga0373956_0050227 3300035119 Bacteria 1872
65 Ga0373943_0174163 3300035170 Bacteria 1179
66 Ga0373931_0623152 3300035691 Unclassified 707
67 Ga0373947_0078688 3300035725 Bacteria 2036
68 Ga0373947_0290692 3300035725 Bacteria 1088
69 Ga0373937_0029452 3300036401 Bacteria 4972
70 Ga0395900_0202579 3300037418 Bacteria 2007
71 Ga0395905_0203317 3300037471 Bacteria 1857
72 Ga0395905_0299911 3300037471 Bacteria 1494
73 Ga0395905_0301505 3300037471 Bacteria 1490
74 Ga0395901_0000384 3300038443 Bacteria 52947
75 Ga0395901_0335736 3300038443 Bacteria 1562
76 Ga0436365_1414992 3300039437 Bacteria 1663
77 Ga0436360_0199305 3300039438 Bacteria 1305
78 Ga0436361_0117502 3300039447 Bacteria 1996
79 Ga0436361_0853495 3300039447 Bacteria 6292
80 Ga0436363_1338364 3300039450 Bacteria 873
81 Ga0436362_0873228 3300039453 Bacteria 1280
82 Ga0439447_036302 3300041407 Bacteria 1218
83 Ga0439465_0127942 3300041413 Bacteria 895
84 Ga0450920_053297 3300042122 Bacteria 813
85 Ga0450907_025709 3300042146 Bacteria 996
86 Ga0453684_0419357 3300044712 Bacteria 1495
87 Ga0466967_0360749 3300045976 Bacteria 1408
88 Ga0495592_0086884 3300046454 Bacteria 2251
89 Ga0495639_0298559 3300046475 Bacteria 803
90 Ga0495610_0027427 3300046512 Bacteria 3026
91 Ga0495610_0042099 3300046512 Bacteria 2287
92 Ga0495628_0156556 3300046516 Bacteria 1733
93 Ga0495586_0015004 3300046535 Bacteria 4118
94 Ga0495667_0020624 3300046559 Bacteria 4446
95 Ga0495635_0031844 3300046663 Bacteria 3659
96 Ga0495649_0068110 3300046694 Bacteria 1910
97 Ga0495680_0103794 3300047322 Bacteria 2115
98 Ga0495684_0468764 3300047471 Bacteria 872
99 Ga0496102_0116510 3300048905 Bacteria 2493
100 Ga0496103_0275153 3300048906 Bacteria 1083
101 Ga0496110_0291881 3300048913 Bacteria 1485
102 Ga0496111_0257419 3300048914 Bacteria 1295
103 Ga0496112_0153016 3300048915 Bacteria 2274
104 Ga0496113_0119763 3300048916 Bacteria 2057
105 Ga0501034_0000001 3300049571 Bacteria 2184493
106 Ga0501034_0133821 3300049571 Bacteria 2461
107 Ga0501034_0627348 3300049571 Bacteria 978
108 Ga0501034_0660178 3300049571 Bacteria 947
109 Ga0501036_0010669 3300049572 Bacteria 7593
110 Ga0501037_0006269 3300049573 Bacteria 8696
111 Ga0501037_0637275 3300049573 Unclassified 713
112 Ga0501039_0000001 3300049575 Bacteria 449008
113 Ga0501048_0551780 3300049582 Bacteria 827
114 Ga0501067_0407573 3300049583 Bacteria 758
115 Ga0501069_0230754 3300049585 Bacteria 1077
116 Ga0501070_0220809 3300049586 Bacteria 1554
117 Ga0501070_0642201 3300049586 Bacteria 843
118 Ga0501072_0202716 3300049588 Bacteria 1582
119 Ga0501073_0052785 3300049589 Bacteria 2846
120 Ga0501073_0076332 3300049589 Bacteria 2332
121 Ga0501075_0421990 3300049591 Bacteria 1017
122 Ga0501076_0654576 3300049592 Bacteria 867
123 Ga0501080_0114963 3300049742 Bacteria 2495
124 Ga0501080_0588343 3300049742 Bacteria 989
125 Ga0501081_0605448 3300049743 Bacteria 820
126 Ga0501083_0024164 3300049744 Bacteria 4213
127 Ga0501083_0039769 3300049744 Bacteria 3194
128 Ga0501035_0051053 3300049822 Bacteria 3704
129 Ga0501035_0157314 3300049822 Unclassified 1969
130 Ga0501035_0383637 3300049822 Bacteria 1172
131 Ga0501044_0040362 3300049823 Bacteria 4864
132 Ga0501044_0116188 3300049823 Bacteria 2681
133 nmdc:mga05p37_1134553_c1 3300050507 Bacteria 815
134 nmdc:mga06r32_399023_c1 3300050510 Bacteria 1357
135 nmdc:mga0n895_1095293_c1 3300050512 Bacteria 774
136 nmdc:mga0n895_211124_c1 3300050512 Bacteria 1971
137 nmdc:mga0a205_371871_c1 3300050515 Bacteria 1295
138 Ga0495601_0000984 3300053077 Bacteria 15569
139 Ga0495619_0014962 3300053085 Bacteria 4901
140 Ga0500644_0053468 3300053088 Bacteria 1394
141 Ga0500595_011768 3300053119 Bacteria 3408
142 Ga0500568_0057395 3300053139 Bacteria 1515
143 Ga0500616_0108007 3300053153 Bacteria 1349
144 Ga0500636_0011171 3300053177 Bacteria 5254
145 Ga0501084_0522066 3300054114 Bacteria 1004
146 Ga0501082_0106297 3300060353 Bacteria 2428
147 Ga0501082_0127708 3300060353 Bacteria 2205
148 Ga0501082_0499567 3300060353 Bacteria 1063

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0301505 Ga0395905_0301505_661_1209 153
2 iso_pu_bacteria 2883291878 2883297097 157
3 iso_pu_bacteria 2883354860 2883359877 157
4 3300044712 Ga0453684_0419357 Ga0453684_0419357_189_731 160
5 3300005544 Ga0070686_100548721 Ga0070686_1005487212 161
6 3300005618 Ga0068864_100749217 Ga0068864_1007492172 161
7 3300025912 Ga0207707_10850054 Ga0207707_108500542 161
8 3300026035 Ga0207703_10555424 Ga0207703_105554242 161
9 3300049571 Ga0501034_0627348 Ga0501034_0627348_75_593 161
10 3300049589 Ga0501073_0052785 Ga0501073_0052785_66_584 161
11 3300049742 Ga0501080_0114963 Ga0501080_0114963_761_1279 161
12 3300049744 Ga0501083_0039769 Ga0501083_0039769_1724_2242 161
13 3300060353 Ga0501082_0106297 Ga0501082_0106297_894_1412 161
14 3300025291 Ga0209675_1032325 Ga0209675_10323252 162
15 3300025295 Ga0209564_1037326 Ga0209564_10373262 162
16 3300053177 Ga0500636_0011171 Ga0500636_0011171_2719_3282 163
17 3300020070 Ga0206356_10337032 Ga0206356_103370322 164
18 3300028794 Ga0307515_10131748 Ga0307515_101317485 164
19 3300038443 Ga0395901_0000384 Ga0395901_0000384_34632_35171 164
20 3300053088 Ga0500644_0053468 Ga0500644_0053468_856_1383 164
21 3300005336 Ga0070680_100117109 Ga0070680_1001171093 165
22 3300005458 Ga0070681_10236528 Ga0070681_102365282 165
23 3300005530 Ga0070679_100106712 Ga0070679_1001067122 165
24 3300005546 Ga0070696_100436410 Ga0070696_1004364101 165
25 3300005578 Ga0068854_100360857 Ga0068854_1003608572 165
26 3300013104 Ga0157370_10101790 Ga0157370_101017902 165
27 3300025912 Ga0207707_10121246 Ga0207707_101212462 165
28 3300025917 Ga0207660_10086158 Ga0207660_100861582 165
29 3300025921 Ga0207652_10380928 Ga0207652_103809281 165
30 3300035691 Ga0373931_0623152 Ga0373931_0623152_154_684 165
31 iso_pu_bacteria 2511231221 2512034784 165
32 iso_pu_bacteria 2597490356 2599102804 165
33 iso_pu_bacteria 2846952575 2846952678 165
34 iso_pu_bacteria 2848858292 2848861167 165
35 iso_pu_bacteria 8054002106 8054003772 165
36 iso_pu_bacteria 2897803580 2897808732 166
37 3300031548 Ga0307408_100848004 Ga0307408_1008480042 167
38 3300035119 Ga0373956_0050227 Ga0373956_0050227_903_1499 167
39 3300036401 Ga0373937_0029452 Ga0373937_0029452_3165_3761 167
40 3300039438 Ga0436360_0199305 Ga0436360_0199305_587_1135 167
41 3300046454 Ga0495592_0086884 Ga0495592_0086884_650_1246 167
42 3300046475 Ga0495639_0298559 Ga0495639_0298559_181_744 167
43 3300046516 Ga0495628_0156556 Ga0495628_0156556_860_1456 167
44 3300046535 Ga0495586_0015004 Ga0495586_0015004_2700_3296 167
45 3300046559 Ga0495667_0020624 Ga0495667_0020624_352_948 167
46 3300046663 Ga0495635_0031844 Ga0495635_0031844_1976_2572 167
47 3300047322 Ga0495680_0103794 Ga0495680_0103794_366_962 167
48 3300047471 Ga0495684_0468764 Ga0495684_0468764_137_724 167
49 3300053077 Ga0495601_0000984 Ga0495601_0000984_13895_14491 167
50 3300053085 Ga0495619_0014962 Ga0495619_0014962_1657_2253 167
51 3300053119 Ga0500595_011768 Ga0500595_011768_1850_2386 167
52 3300053153 Ga0500616_0108007 Ga0500616_0108007_40_576 167
53 3300031595 Ga0265313_10047233 Ga0265313_100472332 168
54 3300035725 Ga0373947_0290692 Ga0373947_0290692_171_782 168
55 3300039447 Ga0436361_0117502 Ga0436361_0117502_822_1421 168
56 3300049571 Ga0501034_0000001 Ga0501034_0000001_470820_471368 168
57 3300049572 Ga0501036_0010669 Ga0501036_0010669_3196_3744 168
58 3300049575 Ga0501039_0000001 Ga0501039_0000001_361972_362520 168
59 3300025291 Ga0209675_1004204 Ga0209675_10042046 170
60 3300037418 Ga0395900_0202579 Ga0395900_0202579_1063_1617 170
61 3300037471 Ga0395905_0299911 Ga0395905_0299911_592_1146 170
62 3300038443 Ga0395901_0335736 Ga0395901_0335736_18_572 170
63 3300039437 Ga0436365_1414992 Ga0436365_1414992_928_1503 170
64 3300049583 Ga0501067_0407573 Ga0501067_0407573_80_634 170
65 3300049586 Ga0501070_0220809 Ga0501070_0220809_935_1489 170
66 3300049589 Ga0501073_0076332 Ga0501073_0076332_85_639 170
67 3300049744 Ga0501083_0024164 Ga0501083_0024164_2026_2580 170
68 3300060353 Ga0501082_0127708 Ga0501082_0127708_517_1071 170
69 iso_pu_bacteria 2522572158 2523103421 170
70 3300006846 Ga0075430_100171927 Ga0075430_1001719271 171
71 iso_pu_bacteria 2821443989 2821450261 171
72 3300005336 Ga0070680_100003831 Ga0070680_1000038317 172
73 3300005458 Ga0070681_10000290 Ga0070681_1000029012 172
74 3300005530 Ga0070679_100006551 Ga0070679_10000655111 172
75 3300006175 Ga0070712_100433140 Ga0070712_1004331402 172
76 3300009093 Ga0105240_10033685 Ga0105240_100336856 172
77 3300013104 Ga0157370_10002708 Ga0157370_100027083 172
78 3300025912 Ga0207707_10005011 Ga0207707_1000501112 172
79 3300025913 Ga0207695_10234964 Ga0207695_102349642 172
80 3300025915 Ga0207693_10107031 Ga0207693_101070313 172
81 3300049582 Ga0501048_0551780 Ga0501048_0551780_226_786 172
82 3300049588 Ga0501072_0202716 Ga0501072_0202716_349_909 172
83 3300049591 Ga0501075_0421990 Ga0501075_0421990_85_645 172
84 3300049592 Ga0501076_0654576 Ga0501076_0654576_267_827 172
85 3300049743 Ga0501081_0605448 Ga0501081_0605448_149_709 172
86 3300049823 Ga0501044_0116188 Ga0501044_0116188_747_1301 172
87 3300050512 nmdc:mga0n895_1095293_c1 nmdc:mga0n895_1095293_c1_28_582 172
88 3300054114 Ga0501084_0522066 Ga0501084_0522066_171_731 172
89 3300060353 Ga0501082_0499567 Ga0501082_0499567_354_914 172
90 iso_pu_bacteria 2524023250 2524611391 172
91 iso_pu_bacteria 2842333319 2842335340 172
92 3300005546 Ga0070696_100208175 Ga0070696_1002081752 173
93 3300006852 Ga0075433_10225900 Ga0075433_102259002 173
94 3300006871 Ga0075434_100396206 Ga0075434_1003962062 173
95 3300009147 Ga0114129_10341683 Ga0114129_103416832 173
96 3300009174 Ga0105241_10567545 Ga0105241_105675452 173
97 3300025944 Ga0207661_10149981 Ga0207661_101499813 173
98 3300037471 Ga0395905_0203317 Ga0395905_0203317_162_731 173
99 3300049571 Ga0501034_0660178 Ga0501034_0660178_353_907 173
100 3300049742 Ga0501080_0588343 Ga0501080_0588343_369_923 173
101 3300050507 nmdc:mga05p37_1134553_c1 nmdc:mga05p37_1134553_c1_74_628 173
102 3300050512 nmdc:mga0n895_211124_c1 nmdc:mga0n895_211124_c1_797_1351 173
103 3300050515 nmdc:mga0a205_371871_c1 nmdc:mga0a205_371871_c1_91_645 173
104 3300005366 Ga0070659_100132388 Ga0070659_1001323883 174
105 3300005445 Ga0070708_100571348 Ga0070708_1005713481 174
106 3300005545 Ga0070695_100131053 Ga0070695_1001310532 174
107 3300009553 Ga0105249_10481787 Ga0105249_104817872 174
108 3300014497 Ga0182008_10293115 Ga0182008_102931151 174
109 3300014497 Ga0182008_10306927 Ga0182008_103069272 174
110 3300031731 Ga0307405_10676670 Ga0307405_106766702 174
111 3300031903 Ga0307407_10043185 Ga0307407_100431852 174
112 3300031995 Ga0307409_101353056 Ga0307409_1013530562 174
113 3300032004 Ga0307414_10096207 Ga0307414_100962072 174
114 3300032004 Ga0307414_10561935 Ga0307414_105619352 174
115 3300039453 Ga0436362_0873228 Ga0436362_0873228_478_1065 174
116 3300041407 Ga0439447_036302 Ga0439447_036302_319_897 174
117 3300041413 Ga0439465_0127942 Ga0439465_0127942_199_777 174
118 3300042122 Ga0450920_053297 Ga0450920_053297_93_671 174
119 3300048905 Ga0496102_0116510 Ga0496102_0116510_50_607 174
120 3300048906 Ga0496103_0275153 Ga0496103_0275153_414_971 174
121 3300048913 Ga0496110_0291881 Ga0496110_0291881_67_624 174
122 3300048914 Ga0496111_0257419 Ga0496111_0257419_245_802 174
123 3300048915 Ga0496112_0153016 Ga0496112_0153016_1079_1636 174
124 3300048916 Ga0496113_0119763 Ga0496113_0119763_106_663 174
125 3300049822 Ga0501035_0051053 Ga0501035_0051053_839_1423 174
126 3300005539 Ga0068853_100051936 Ga0068853_1000519364 175
127 3300005617 Ga0068859_100431424 Ga0068859_1004314242 175
128 3300006931 Ga0097620_100431434 Ga0097620_1004314342 175
129 3300026041 Ga0207639_10033961 Ga0207639_100339614 175
130 3300049573 Ga0501037_0637275 Ga0501037_0637275_116_691 175
131 3300049585 Ga0501069_0230754 Ga0501069_0230754_94_654 175
132 3300049586 Ga0501070_0642201 Ga0501070_0642201_172_732 175
133 3300049822 Ga0501035_0157314 Ga0501035_0157314_39_611 175
134 3300050510 nmdc:mga06r32_399023_c1 nmdc:mga06r32_399023_c1_250_840 175
135 iso_pu_bacteria 2844533157 2844538789 175
136 3300031901 Ga0307406_10062805 Ga0307406_100628054 176
137 3300032002 Ga0307416_100114817 Ga0307416_1001148172 176
138 3300039450 Ga0436363_1338364 Ga0436363_1338364_84_647 176
139 3300039447 Ga0436361_0853495 Ga0436361_0853495_1710_2285 178
140 3300003187 JGI25151J46595_10000240 JGI25151J46595_1000024055 179
141 3300005530 Ga0070679_100717240 Ga0070679_1007172401 179
142 3300005983 Ga0081540_1045900 Ga0081540_10459002 179
143 3300025284 Ga0209130_1000282 Ga0209130_100028257 179
144 3300025294 Ga0209025_1000179 Ga0209025_100017983 179
145 3300025297 Ga0209758_1002547 Ga0209758_10025472 179
146 3300025302 Ga0207426_1000191 Ga0207426_1000191104 179
147 3300025921 Ga0207652_10198360 Ga0207652_101983603 179
148 3300025939 Ga0207665_10175782 Ga0207665_101757822 179
149 3300031344 Ga0265316_10018469 Ga0265316_100184692 179
150 3300035170 Ga0373943_0174163 Ga0373943_0174163_259_837 179
151 3300035725 Ga0373947_0078688 Ga0373947_0078688_324_902 179
152 3300042146 Ga0450907_025709 Ga0450907_025709_129_701 179
153 3300045976 Ga0466967_0360749 Ga0466967_0360749_435_1016 179
154 3300046512 Ga0495610_0027427 Ga0495610_0027427_1335_1907 179
155 3300046512 Ga0495610_0042099 Ga0495610_0042099_1395_1967 179
156 3300046694 Ga0495649_0068110 Ga0495649_0068110_745_1317 179
157 3300049571 Ga0501034_0133821 Ga0501034_0133821_444_1025 179
158 3300049573 Ga0501037_0006269 Ga0501037_0006269_3937_4518 179
159 3300049822 Ga0501035_0383637 Ga0501035_0383637_247_828 179
160 3300049823 Ga0501044_0040362 Ga0501044_0040362_4181_4762 179
161 3300053139 Ga0500568_0057395 Ga0500568_0057395_276_848 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

34

158

0.87

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

48

168

0.87

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

69

160

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j4j-assembly2.cif.gz_B crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a 0.8569 12 167
1j4j-assembly2.cif.gz_B crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a 0.7877 12 167
4j3g-assembly2.cif.gz_C crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis 0.7862 12 167
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.7855 10 167
5wph-assembly1.cif.gz_A crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 0.7843 10 163
ID Description Score Start End Superfamily
af_Q54KJ9_7_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8924 19 165 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.877 97 163 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8487 121 163 3.40.630.30
af_Q54KJ7_19_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8355 16 165 3.40.630.30
1j4jA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8302 12 167 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2E3XE09-F1-model_v4 GNAT family N-acetyltransferase 0.9697 8 167 GO:0016747
AF-A0A537UZ86-F1-model_v4 GNAT family N-acetyltransferase 0.969 18 165 GO:0016747
AF-A0A2E1TSQ6-F1-model_v4 GNAT family N-acetyltransferase 0.9683 12 165 GO:0016747
AF-A0A4R6WSY6-F1-model_v4 Ribosomal protein S18 acetylase RimI-like enzyme 0.9642 5 168 GO:0005840
GO:0016747
AF-A0A7C7N1Q4-F1-model_v4 deleted 0.9639 8 168

Feature Viewer

pLDDT pTM Quality
85.42 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map