F225391

General Info

Members Datasets Scaffolds Average Seq Length
156 123 312 321

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0584785|Ga0436361_0584785_5568_6719
Length 383
Sequence VRLKTGAAKSKVKTHPVRAEFFALPFRFRALPPPPSLWRDKFLRLLFLVPSVDTPAIDPAAGLSFSRALATHGLKLRRARTEILQLNVGKLCDLSCVHCHVNAGPKRKEVITRQTVDRILSWLTETNIPTVDITGGAPEMAPEFRYLVQEVRNIPQIETIIDRCNLTILLEPGYEWLAEFLAAHRVRIVASMPCYQPANVNAQRGDGVFDRSISALRLLNRLGYAQQPALTLDLVYNPNGDFLPPDQTELEADYKRELKLNFDIYFNRLYTITNMPIGRFAAWLRHNGRLEEYMDLLVKAFNPASISGLMCRNTLSVGWRGEVYDCDFNQQLGMQWRKEKPLFVWDLDSSQLEGQDILVGNHCFGCAAGAGSSCGGALVAGDR

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
67 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
68 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
71 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
80 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
123 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0
Isolates 1.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.85
Rhizosphere 91.03
Stem 0
Stem Tuber 0
Unclassified 20.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0584785 3300039447 Bacteria 8927
2 JGI25406J46586_10000003 3300003203 Bacteria 161718
3 Ga0065712_10165545 3300005290 Bacteria 1275
4 Ga0065707_10012462 3300005295 Unclassified 2238
5 Ga0070658_10211438 3300005327 Unclassified 1639
6 Ga0070683_100223504 3300005329 Unclassified 1789
7 Ga0070690_100045304 3300005330 Bacteria 2793
8 Ga0070670_100362162 3300005331 Unclassified 1275
9 Ga0070689_100030862 3300005340 Unclassified 4069
10 Ga0070668_100007960 3300005347 Bacteria 7871
11 Ga0070668_100197374 3300005347 Bacteria 1651
12 Ga0070668_100239040 3300005347 Unclassified 1504
13 Ga0070669_100148881 3300005353 Bacteria 1811
14 Ga0070669_100257710 3300005353 Bacteria 1391
15 Ga0070669_100341509 3300005353 Unclassified 1213
16 Ga0070675_100048006 3300005354 Bacteria 3499
17 Ga0070675_100134943 3300005354 Bacteria 2106
18 Ga0070674_100056296 3300005356 Bacteria 2726
19 Ga0070674_100170942 3300005356 Unclassified 1657
20 Ga0070688_100014892 3300005365 Bacteria 4414
21 Ga0070709_10004458 3300005434 Bacteria 7555
22 Ga0070713_100047808 3300005436 Bacteria 3519
23 Ga0070708_100104541 3300005445 Bacteria 2597
24 Ga0070662_100062292 3300005457 Unclassified 2725
25 Ga0070706_100088481 3300005467 Unclassified 2871
26 Ga0070698_100001537 3300005471 Bacteria 25611
27 Ga0070699_100020249 3300005518 Bacteria 5735
28 Ga0070697_100116283 3300005536 Bacteria 2233
29 Ga0070697_100199967 3300005536 Bacteria 1698
30 Ga0070697_100243354 3300005536 Unclassified 1537
31 Ga0070672_100042176 3300005543 Bacteria 3512
32 Ga0068863_100165611 3300005841 Bacteria 2120
33 Ga0068863_100469737 3300005841 Bacteria 1236
34 Ga0081539_10000077 3300005985 Bacteria 228125
35 Ga0081539_10005323 3300005985 Bacteria 13213
36 Ga0070716_100115321 3300006173 Unclassified 1672
37 Ga0075428_100041570 3300006844 Bacteria 5056
38 Ga0075430_100115272 3300006846 Bacteria 2239
39 Ga0075431_100233848 3300006847 Bacteria 1872
40 Ga0075429_100025613 3300006880 Bacteria 5120
41 Ga0105240_10036114 3300009093 Bacteria 6361
42 Ga0111539_10371606 3300009094 Bacteria 1664
43 Ga0114129_10590978 3300009147 Bacteria 1439
44 Ga0105246_10362519 3300011119 Bacteria 1191
45 Ga0157378_10027940 3300013297 Bacteria 4974
46 Ga0157378_10081178 3300013297 Bacteria 2930
47 Ga0163162_10118145 3300013306 Unclassified 2753
48 Ga0163162_10316144 3300013306 Unclassified 1694
49 Ga0157375_10416590 3300013308 Unclassified 1509
50 Ga0163163_10054771 3300014325 Bacteria 3941
51 Ga0163163_10374850 3300014325 Bacteria 1480
52 Ga0157376_10065580 3300014969 Bacteria 3067
53 Ga0163161_10279135 3300017792 Unclassified 1310
54 Ga0163161_10383484 3300017792 Bacteria 1124
55 Ga0213872_10085945 3300021361 Bacteria 1410
56 Ga0213872_10105717 3300021361 Unclassified 1253
57 Ga0213876_10055038 3300021384 Bacteria 2100
58 Ga0207697_10002761 3300025315 Bacteria 8958
59 Ga0207688_10008366 3300025901 Bacteria 5625
60 Ga0207688_10056167 3300025901 Bacteria 2211
61 Ga0207645_10002057 3300025907 Bacteria 16118
62 Ga0207705_10278336 3300025909 Bacteria 1280
63 Ga0207684_10047255 3300025910 Bacteria 3650
64 Ga0207695_10194319 3300025913 Bacteria 1946
65 Ga0207693_10004132 3300025915 Bacteria 12323
66 Ga0207693_10080584 3300025915 Bacteria 2548
67 Ga0207663_10049712 3300025916 Unclassified 2602
68 Ga0207646_10031021 3300025922 Bacteria 4841
69 Ga0207646_10069912 3300025922 Bacteria 3135
70 Ga0207646_10078268 3300025922 Bacteria 2956
71 Ga0207681_10092868 3300025923 Bacteria 2158
72 Ga0207681_10476919 3300025923 Unclassified 1018
73 Ga0207650_10445659 3300025925 Unclassified 1077
74 Ga0207700_10042810 3300025928 Bacteria 3322
75 Ga0207706_10041547 3300025933 Bacteria 4076
76 Ga0207670_10097228 3300025936 Bacteria 2095
77 Ga0207669_10095903 3300025937 Bacteria 1945
78 Ga0207665_10076942 3300025939 Unclassified 2289
79 Ga0207665_10324082 3300025939 Bacteria 1157
80 Ga0207691_10038576 3300025940 Bacteria 4420
81 Ga0207661_10098376 3300025944 Bacteria 2452
82 Ga0207679_10184959 3300025945 Bacteria 1727
83 Ga0207668_10050302 3300025972 Unclassified 2871
84 Ga0207668_10177173 3300025972 Bacteria 1678
85 Ga0207658_10079299 3300025986 Bacteria 2511
86 Ga0207683_10021617 3300026121 Bacteria 5513
87 Ga0268266_10046483 3300028379 Bacteria 3716
88 Ga0265326_10034238 3300028558 Bacteria 1445
89 Ga0265323_10000225 3300028653 Bacteria 33236
90 Ga0265322_10039874 3300028654 Bacteria 1336
91 Ga0265338_10017083 3300028800 Bacteria 7843
92 Ga0265328_10010041 3300031239 Bacteria 3827
93 Ga0265329_10002724 3300031242 Bacteria 7929
94 Ga0265316_10028217 3300031344 Bacteria 4633
95 Ga0265316_10033568 3300031344 Bacteria 4177
96 Ga0307513_10135935 3300031456 Bacteria 2394
97 Ga0265314_10001210 3300031711 Bacteria 29637
98 Ga0307413_10001010 3300031824 Bacteria 10163
99 Ga0307410_10011473 3300031852 Bacteria 5070
100 Ga0307407_10004902 3300031903 Bacteria 5744
101 Ga0307416_100124341 3300032002 Bacteria 2307
102 Ga0373926_0018577 3300035083 Bacteria 2393
103 Ga0373949_0036081 3300035090 Bacteria 1198
104 Ga0373943_0044754 3300035170 Bacteria 2155
105 Ga0373931_0193015 3300035691 Bacteria 1213
106 Ga0373935_0087055 3300035692 Bacteria 2039
107 Ga0373927_0005083 3300035695 Bacteria 9103
108 Ga0373927_0120565 3300035695 Bacteria 1712
109 Ga0373947_0003054 3300035725 Bacteria 9956
110 Ga0373947_0179864 3300035725 Bacteria 1376
111 Ga0373937_0436538 3300036401 Bacteria 1243
112 Ga0373925_0019154 3300037068 Bacteria 4976
113 Ga0373925_0083673 3300037068 Bacteria 2431
114 Ga0436364_0190514 3300037853 Unclassified 1595
115 Ga0395901_0247918 3300038443 Bacteria 1856
116 Ga0395901_0400236 3300038443 Bacteria 1411
117 Ga0400486_00816 3300038742 Bacteria 1443
118 Ga0436365_0038826 3300039437 Unclassified 2400
119 Ga0436360_0590872 3300039438 Bacteria 6303
120 Ga0436361_0749663 3300039447 Bacteria 6301
121 Ga0436361_0787790 3300039447 Unclassified 1321
122 Ga0436363_0280712 3300039450 Unclassified 3941
123 Ga0453683_0000171 3300044673 Bacteria 89761
124 Ga0453683_0001135 3300044673 Bacteria 24230
125 Ga0453684_0747302 3300044712 Bacteria 1059
126 Ga0451576_0274435 3300045051 Unclassified 1763
127 Ga0495651_0211344 3300046462 Bacteria 1350
128 Ga0495652_0122726 3300046529 Unclassified 2069
129 Ga0495599_0027576 3300046678 Bacteria 3559
130 Ga0495669_0135306 3300046684 Unclassified 1161
131 Ga0495624_0212471 3300046690 Bacteria 1173
132 Ga0495684_0253916 3300047471 Unclassified 1278
133 Ga0495684_0304620 3300047471 Bacteria 1144
134 Ga0496102_0573043 3300048905 Unclassified 1052
135 Ga0496104_0836579 3300048907 Bacteria 826
136 Ga0496109_0172070 3300048912 Bacteria 2032
137 Ga0496109_0231613 3300048912 Bacteria 1738
138 Ga0496112_0102737 3300048915 Bacteria 2828
139 Ga0496112_0525029 3300048915 Unclassified 1118
140 Ga0501031_0094835 3300049568 Bacteria 1947
141 Ga0501032_0013057 3300049569 Bacteria 5914
142 Ga0501033_0150849 3300049570 Bacteria 1677
143 Ga0501034_0013771 3300049571 Bacteria 8321
144 Ga0501037_0100185 3300049573 Bacteria 2092
145 Ga0501042_0228015 3300049578 Bacteria 1344
146 Ga0501046_0026732 3300049580 Bacteria 4713
147 Ga0501072_0072080 3300049588 Bacteria 2730
148 Ga0501075_0133264 3300049591 Bacteria 1893
149 Ga0501080_0384287 3300049742 Bacteria 1265
150 Ga0501044_0344793 3300049823 Bacteria 1410
151 nmdc:mga09592_20049_c2 3300050508 Bacteria 5120
152 nmdc:mga0qj67_153476_c1 3300050509 Bacteria 1868
153 nmdc:mga06r32_526125_c1 3300050510 Bacteria 1158
154 nmdc:mga08y16_341803_c1 3300050511 Bacteria 1538
155 2643894735 2643221577 Bacteria 3710843
156 2644476892 2643221685 Bacteria 3673288
157 Ga0436361_0584785
158 JGI25406J46586_10000003
159 Ga0065712_10165545
160 Ga0065707_10012462
161 Ga0070658_10211438
162 Ga0070683_100223504
163 Ga0070690_100045304
164 Ga0070670_100362162
165 Ga0070689_100030862
166 Ga0070668_100007960
167 Ga0070668_100197374
168 Ga0070668_100239040
169 Ga0070669_100148881
170 Ga0070669_100257710
171 Ga0070669_100341509
172 Ga0070675_100048006
173 Ga0070675_100134943
174 Ga0070674_100056296
175 Ga0070674_100170942
176 Ga0070688_100014892
177 Ga0070709_10004458
178 Ga0070713_100047808
179 Ga0070708_100104541
180 Ga0070662_100062292
181 Ga0070706_100088481
182 Ga0070698_100001537
183 Ga0070699_100020249
184 Ga0070697_100116283
185 Ga0070697_100199967
186 Ga0070697_100243354
187 Ga0070672_100042176
188 Ga0068863_100165611
189 Ga0068863_100469737
190 Ga0081539_10000077
191 Ga0081539_10005323
192 Ga0070716_100115321
193 Ga0075428_100041570
194 Ga0075430_100115272
195 Ga0075431_100233848
196 Ga0075429_100025613
197 Ga0105240_10036114
198 Ga0111539_10371606
199 Ga0114129_10590978
200 Ga0105246_10362519
201 Ga0157378_10027940
202 Ga0157378_10081178
203 Ga0163162_10118145
204 Ga0163162_10316144
205 Ga0157375_10416590
206 Ga0163163_10054771
207 Ga0163163_10374850
208 Ga0157376_10065580
209 Ga0163161_10279135
210 Ga0163161_10383484
211 Ga0213872_10085945
212 Ga0213872_10105717
213 Ga0213876_10055038
214 Ga0207697_10002761
215 Ga0207688_10008366
216 Ga0207688_10056167
217 Ga0207645_10002057
218 Ga0207705_10278336
219 Ga0207684_10047255
220 Ga0207695_10194319
221 Ga0207693_10004132
222 Ga0207693_10080584
223 Ga0207663_10049712
224 Ga0207646_10031021
225 Ga0207646_10069912
226 Ga0207646_10078268
227 Ga0207681_10092868
228 Ga0207681_10476919
229 Ga0207650_10445659
230 Ga0207700_10042810
231 Ga0207706_10041547
232 Ga0207670_10097228
233 Ga0207669_10095903
234 Ga0207665_10076942
235 Ga0207665_10324082
236 Ga0207691_10038576
237 Ga0207661_10098376
238 Ga0207679_10184959
239 Ga0207668_10050302
240 Ga0207668_10177173
241 Ga0207658_10079299
242 Ga0207683_10021617
243 Ga0268266_10046483
244 Ga0265326_10034238
245 Ga0265323_10000225
246 Ga0265322_10039874
247 Ga0265338_10017083
248 Ga0265328_10010041
249 Ga0265329_10002724
250 Ga0265316_10028217
251 Ga0265316_10033568
252 Ga0307513_10135935
253 Ga0265314_10001210
254 Ga0307413_10001010
255 Ga0307410_10011473
256 Ga0307407_10004902
257 Ga0307416_100124341
258 Ga0373926_0018577
259 Ga0373949_0036081
260 Ga0373943_0044754
261 Ga0373931_0193015
262 Ga0373935_0087055
263 Ga0373927_0005083
264 Ga0373927_0120565
265 Ga0373947_0003054
266 Ga0373947_0179864
267 Ga0373937_0436538
268 Ga0373925_0019154
269 Ga0373925_0083673
270 Ga0436364_0190514
271 Ga0395901_0247918
272 Ga0395901_0400236
273 Ga0400486_00816
274 Ga0436365_0038826
275 Ga0436360_0590872
276 Ga0436361_0749663
277 Ga0436361_0787790
278 Ga0436363_0280712
279 Ga0453683_0000171
280 Ga0453683_0001135
281 Ga0453684_0747302
282 Ga0451576_0274435
283 Ga0495651_0211344
284 Ga0495652_0122726
285 Ga0495599_0027576
286 Ga0495669_0135306
287 Ga0495624_0212471
288 Ga0495684_0253916
289 Ga0495684_0304620
290 Ga0496102_0573043
291 Ga0496104_0836579
292 Ga0496109_0172070
293 Ga0496109_0231613
294 Ga0496112_0102737
295 Ga0496112_0525029
296 Ga0501031_0094835
297 Ga0501032_0013057
298 Ga0501033_0150849
299 Ga0501034_0013771
300 Ga0501037_0100185
301 Ga0501042_0228015
302 Ga0501046_0026732
303 Ga0501072_0072080
304 Ga0501075_0133264
305 Ga0501080_0384287
306 Ga0501044_0344793
307 nmdc:mga09592_20049_c2
308 nmdc:mga0qj67_153476_c1
309 nmdc:mga06r32_526125_c1
310 nmdc:mga08y16_341803_c1
311 2643894735
312 2644476892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12345

DUF3641

Protein of unknown function (DUF3641)

243

377

0.97

PF04055

Radical_SAM

Radical SAM superfamily

86

241

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vsm-assembly2.cif.gz_B crystal structure of viperin with bound [4fe-4s] cluster, 5'-deoxyadenosine, and l-methionine 0.736 44 196
6efn-assembly1.cif.gz_A-2 structure of a ripp maturase, skfb 0.6912 34 314
4wcx-assembly2.cif.gz_C crystal structure of hydg: a maturase of the [fefe]-hydrogenase 0.6779 38 237
6q2q-assembly1.cif.gz_A crystal structure of mouse viperin bound to uridine triphosphate and s-adenosylhomocysteine 0.662 38 286
4wcx-assembly1.cif.gz_A crystal structure of hydg: a maturase of the [fefe]-hydrogenase 0.6608 39 237
ID Description Score Start End Superfamily
af_O33183_77_264_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8426 42 238 3.20.20.70
af_O33183_77_264_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8101 42 238 3.20.20.70
af_O69696_93_337_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8031 46 238 3.20.20.70
af_Q58214_34_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7195 44 247 3.20.20.70
af_P0CH67_115_331_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7122 43 238 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V5JVE4-F1-model_v4 Radical SAM protein 0.9916 21 299 GO:0003824
GO:0046872
GO:0051536
AF-A0A538NQ81-F1-model_v4 Radical SAM/Cys-rich domain protein 0.9911 21 339 GO:0003824
GO:0046872
GO:0051536
AF-A0A3D2TL02-F1-model_v4 Uncharacterized protein 0.9907 24 289 GO:0003824
GO:0046872
GO:0051536
AF-A0A2V5XXD9-F1-model_v4 Radical SAM protein 0.9903 21 339 GO:0003824
GO:0046872
GO:0051536
AF-A0A2V5Z997-F1-model_v4 Radical SAM protein 0.9902 21 339 GO:0003824
GO:0046872
GO:0051536

Map